>cd00774 GlyRS-like_core Glycyl-tRNA synthetase (GlyRS)-like class II core catalytic domain. GlyRS functions as a homodimer in eukaryotes, archaea and some bacteria and as a heterotetramer in the remainder of prokaryotes. It is responsible for the attachment of glycine to the 3' OH group of ribose of the appropriate tRNA. This domain is primarily responsible for ATP binding and hydrolysis. This alignment contains only sequences from the GlyRS form which homodimerizes. The heterotetramer glyQ is in a different family of class II aaRS. Class II assignment is based upon its structure and the presence of three characteristic sequence motifs. This domain is also found at the N-terminus of the accessory subunit of mitochondrial polymerase gamma (Pol gamma b). Pol gamma b stimulates processive DNA synthesis and is functional as a homodimer, which can associate with the catalytic subunit Pol gamma alpha to form a heterotrimer. Despite significant both structural and sequence similarity with Gly

Probab=99.09 E-value=4.9e-10 Score=84.33 Aligned_cols=143 Identities=17% Similarity=0.236 Sum_probs=100.6 Q ss_pred CCCCCCCCHHHHHHHHHHHHHHHHHHH--HCCCEEEECCCHHHHHHHHCCCCCCCCCCCCEEEEECCCCCEEEECCCCH- Q ss_conf 998765886689999999999999999--85984801652022887520267554333221689869998899988883- Q gi|254780928|r 12 PRGFADCPTKEIRIRNRILDSIRNIYE--NYGFDPIETPLLEYSDSLGKFLPDEDRPNKGVFSLQDDDGQWISLRYDLT- 88 (496) Q Consensus 12 P~G~~D~~p~~~~~~~~i~~~l~~~f~--~~G~~~I~tP~lE~~~~~~~~~~~~~~~~k~~y~f~D~~g~~l~LRpDlT- 88 (496) T Consensus 21 ~ag~yDyGPlG~~LK~Ni~~~W~~~fv~~~~~~~~id~~ii~p~LmF~T~iG~-----------~~~~~~~~yLRPETAQ 89 (254) T cd00774 21 VAGFYDYGPLGVELKNNIKSAWRKSFVLEEEDMLEIDSPIITPELMFKTSIGP-----------VESGGNLGYLRPETAQ 89 (254) T ss_pred HHCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCEECCCCC-----------CCCCCCCEEECHHHHH T ss_conf 31061548237999999999999998743798799541003663220012156-----------5589860353634534 Q ss_pred ---HHHHHHHHHHHHHCCCCHHHHHHHHHHCCC-CCCCC--CCCCCCCCCHHHHHCCCH---HHHHHHHHHHHHHHHHCC Q ss_conf ---899999995112055411233101333025-87644--421111100012100002---457889999999997518 Q gi|254780928|r 89 ---APLARYVAENFDTIVFPCRTYRIGPVFRNE-KHGPG--RFRQFIQCDVDNVGSSAE---TADAEMCMMMADTLEAVG 159 (496) Q Consensus 89 ---~~~aR~~~~~~~~~~~p~k~yy~g~vfR~e-~p~~G--r~REf~Q~g~eiiG~~~~---~~DaEii~l~~~~l~~lg 159 (496) T Consensus 90 GifvnFk~~~~~--~r~kLPFGiaQIGk~FRNEIsPr~~l~R~REF~q~EiE~F~~P~~~~~~~~-~w~~~~l~~~~~~~ 166 (254) T cd00774 90 GIFVNFKNLLEF--NRRKLPFGVAQIGKSFRNEISPRNGLFRVREFTQAEIEFFVDPEKSHPWFD-YWADQRLKWLPKFA 166 (254) T ss_pred HHHHHHHHHHHH--CCCCCCEEEEEEEECCCCCCCCCCCCCCHHCHHHHEEEEEECCCCCHHHHH-HHHHHHHHHHHHHC T ss_conf 779878999996--488888445654202267347776754000002125788857986425789-99999986638738 Q ss_pred CCCCCCEEE Q ss_conf 887771130 Q gi|254780928|r 160 IKRNDYHIG 168 (496) Q Consensus 160 l~~~~~~I~ 168 (496) T Consensus 167 ~~~~~~~~~ 175 (254) T cd00774 167 QSPENLRLT 175 (254) T ss_pred CCCCCEEEE T ss_conf 996653673

HHsearch alignment for GI: 254780928 and conserved domain: cd00774