HHsearch results for GI: 254780930 and protein with PDBid: 3d5k_A

>3d5k_A OPRM, outer membrane protein OPRM; channel, beta-alpha-barrel, antibiotic resistance, lipoprotein, palmitate, transmembrane, transport; 2.40A {Pseudomonas aeruginosa} PDB: 1wp1_A
Probab=99.75  E-value=1.1e-15  Score=118.91  Aligned_cols=176  Identities=18%  Similarity=0.170  Sum_probs=145.7

Q ss_pred             HHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHCCCCCCCCCC--------CCCCCCCCCCCCCCCHHHHHH-HHH
Q ss_conf             99997089989999999999999998754205301110112456655--------544444321110110012345-778
Q gi|254780930|r   66 KIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNL--------KTNSTGQLDSDWKIDLFGQRR-HIE  136 (452)
Q Consensus        66 ~~Al~~np~l~~a~~~i~~a~~~~~~a~a~~~P~~~~~~~~~~~~~~--------~~~~~~~~~~s~~ldl~G~~~-~~~  136 (452)
                      ..++.+||+++.++..++.++..++.+++.++|++++.+++++....        ......+++++|++..+|+.+ .++
T Consensus       266 ~~a~~~~p~l~~~~~~~~~a~~~~~~ak~~~~P~l~l~~~~~~~~~~~~~~~~~~~~~~~~g~~ls~plf~~~~~~~~~~  345 (474)
T 3d5k_A          266 SDLLQRRPDILEAEHQLMAANASIGAARAAFFPSISLTANAGTMSRQLSGLFDAGSGSWLFQPSINLPIFTAGSLRASLD  345 (474)
T ss_dssp             GGHHHHCHHHHHHHHHHHHHHHHHHHHHTTSSCEEEEEEEEEEEESSSTTSSSTTCEEEEEEEEEEEEEECSSHHHHHHH
T ss_pred             HHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCCCCCCEEEEEEEECCCCCCCCHHHHHH
T ss_conf             99997387999999999999999999888537955689752234565433456765540132343011122220222799


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             88877765556799999999999998766667778899999999999999998787655432345677765322235579
Q gi|254780930|r  137 SSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIE  216 (452)
Q Consensus       137 ~a~~~~~~~~~~~~~~~~~l~~~v~~aY~~~~~~~~~~~i~~~~~~~~~~~~~~~~~r~~~G~~~~~d~~~a~~~~~~~~  216 (452)
                      .+....+.+..+++.++.++..++..+|.++....++++..++.++..++.++..+.+|+.|.++..|++.++..+..++
T Consensus       346 ~a~~~~~~a~~~~~~~~~~~~~ev~~a~~~~~~~~~~~~~~~~~~~~a~~~l~~~~~~y~~G~~s~~dll~A~~~l~~a~  425 (474)
T 3d5k_A          346 YAKIQKDINVAQYEKAIQTAFQEVADGLAARGTFTEQLQAQRDLVKASDEYYQLADKRYRTGVDNYLTLLDAQRSLFTAQ  425 (474)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSSCHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHH
T ss_conf             99999999999999999999999999999999999999999999999999999999999869960999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCH
Q ss_conf             8999999856888876877639992
Q gi|254780930|r  217 SDIPTLEKSFRMNVHNISTLLGYPA  241 (452)
Q Consensus       217 ~~l~~~~~~~~~a~~~L~~l~G~~~  241 (452)
                      ..+..++.++..+...|...+|...
T Consensus       426 ~~~~~a~~~~~~a~~~L~~AlGG~~  450 (474)
T 3d5k_A          426 QQLITDRLNQLTSEVNLYKALGGGW  450 (474)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHTCSC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             9999999999999999999707999