Query         gi|254780930|ref|YP_003065343.1| nodulation protein (outer membrane efflux protein) [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 452
No_of_seqs    237 out of 6667
Neff          9.6 
Searched_HMMs 23785
Date          Tue May 31 22:44:59 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780930.hhm -d /home/congqian_1/database/pdb/pdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 3d5k_A OPRM, outer membrane pr 100.0       0       0  456.9  46.4  431   18-452     1-452 (474)
  2 1yc9_A VCEC, multidrug resista 100.0       0       0  446.1  44.3  408   42-452    16-439 (442)
  3 1ek9_A Outer membrane protein  100.0       0       0  356.4  41.6  385   60-448     2-406 (428)
  4 1ek9_A Outer membrane protein   99.8 4.9E-18 2.1E-22  134.2  21.6  180   61-240   209-407 (428)
  5 1yc9_A VCEC, multidrug resista  99.8 3.1E-17 1.3E-21  129.0  21.4  181  269-449    40-227 (442)
  6 3d5k_A OPRM, outer membrane pr  99.7 1.1E-15 4.6E-20  118.9  21.4  176   66-241   266-450 (474)
  7 3lnn_A Membrane fusion protein  88.7    0.89 3.7E-05   21.4   7.8   63  175-237   101-163 (359)
  8 2f1m_A Acriflavine resistance   74.9       3 0.00012   18.0   8.4   58  180-237    75-132 (277)
  9 3c9h_A ABC transporter, substr  64.1    0.71   3E-05   22.1  -1.1   21   58-78     44-64  (355)
 10 3fpp_A Macrolide-specific effl  56.2     6.8 0.00029   15.6   9.3   65  171-235    82-146 (341)
 11 2w5v_A Alkaline phosphatase; p  48.6       3 0.00013   18.0   0.0   20    1-20      1-20  (375)
 12 1dbg_A Chondroitinase B; beta   44.9     3.7 0.00016   17.4   0.0   22    1-22      1-22  (506)
 13 1twy_A ABC transporter, peripl  43.4     4.2 0.00017   17.1   0.1   20    1-20      1-20  (290)
 14 2v25_A Major cell-binding fact  37.8     5.6 0.00023   16.2   0.0   22    1-22      1-22  (259)

No 1  
>3d5k_A OPRM, outer membrane protein OPRM; channel, beta-alpha-barrel, antibiotic resistance, lipoprotein, palmitate, transmembrane, transport; 2.40A {Pseudomonas aeruginosa} PDB: 1wp1_A
Probab=100.00  E-value=0  Score=456.88  Aligned_cols=431  Identities=22%  Similarity=0.385  Sum_probs=374.0

Q ss_pred             HCCCCCCCCCCCCCCCCCCC-----CCCCCCCCCCCCHHHHHHHCCHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             02689999999564750102-----4677666676862343660998799999999970899899999999999999987
Q gi|254780930|r   18 CTVGPEYTKPHMPLLPTQFS-----IGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSV   92 (452)
Q Consensus        18 C~~~p~~~~p~~~~~~~~~~-----~~~~~~~~~~~~~~ww~~~~d~~L~~~i~~Al~~np~l~~a~~~i~~a~~~~~~a   92 (452)
                      |++.|++.+|+.|+.+....     .....+..+.....||..|+||||+++|+.|++|||+|++++.+++++++++..+
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~w~~~~~d~tL~~~I~~Al~nnp~l~~a~~~i~~a~~~~~~a   80 (474)
T 3d5k_A            1 CSLIPDYQRPEAPVAAAYPQGQAYGQNTGAAAVPAADIGWREFFRDPQLQQLIGVALENNRDLRVAALNVEAFRAQYRIQ   80 (474)
T ss_dssp             CCCCCCCCCCCCCSCSSCCCSTTCCCCCCSCSSCTTTSCHHHHBCCHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999979998665666655455677656776653699865988899999999970999999999999999999997


Q ss_pred             HHHHCCCHHHCCCCCCCCCCC---------CCC---CCCCCCCCCCCHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             542053011101124566555---------444---443211101100123457-7888877765556799999999999
Q gi|254780930|r   93 RADLFPSSYASISHRFIPNLK---------TNS---TGQLDSDWKIDLFGQRRH-IESSLANLDSAYAQVDIAKLNVISK  159 (452)
Q Consensus        93 ~a~~~P~~~~~~~~~~~~~~~---------~~~---~~~~~~s~~ldl~G~~~~-~~~a~~~~~~~~~~~~~~~~~l~~~  159 (452)
                      ++.++|++++++++.+.....         ...   .......|++++||++.. ++.+....+.++..++.++.+++.+
T Consensus        81 ~a~~~P~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~a~~~~~~~~~~~~~~~~~l~~~  160 (474)
T 3d5k_A           81 RADLFPRIGVDGSGTRQRLPGDLSTTGSPAISSQYGVTLGTTAWELDLFGRLRSLRDQALEQYLATEQAQRSAQTTLVAS  160 (474)
T ss_dssp             HHTTSCCEEEEEEEEEEEECTTTSSSSSCEEEEEEEEEEEEEEEEECTTSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHCCCCCEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCEEEEEHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             43408804676334311467655678887765431112342122005200020499999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             99876666777889999999999999999878765543234567776532223557989999998568888768776399
Q gi|254780930|r  160 LIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGY  239 (452)
Q Consensus       160 v~~aY~~~~~~~~~~~i~~~~~~~~~~~~~~~~~r~~~G~~~~~d~~~a~~~~~~~~~~l~~~~~~~~~a~~~L~~l~G~  239 (452)
                      +.++||+++.+++.+++.++.++..++.++.++.+++.|.++..|+.+++..+..++..+..++.++..++..|..++|.
T Consensus       161 v~~aY~~~~~~~~~l~i~~~~~~~~~~~~~~~~~r~~~G~~~~~d~~~a~~~l~~~~~~l~~a~~~l~~a~~~L~~llg~  240 (474)
T 3d5k_A          161 VATAYLTLKADQAQLQLTKDTLGTYQKSFDLTQRSYDVGVASALDLRQAQTAVEGARATLAQYTRLVAQDQNALVLLLGS  240 (474)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTSSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTS
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             99999999999999999999999999999999999986886087899999998877789999999999999999998389


Q ss_pred             CHHHHCCCCCCCCCCCCCCHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHCCCCCCCCCCCCC---C
Q ss_conf             9213000123455443310012210488789973023455655589999643010112222100112222112234---4
Q gi|254780930|r  240 PATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDN---S  316 (452)
Q Consensus       240 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~RPdi~~a~~~~~~a~~~i~~a~a~~~P~i~l~~~~~~~~~~---~  316 (452)
                      ++...........    +......+..+...++.+||||+.++..++.++.+++.+++.++|+|++++++++...+   .
T Consensus       241 ~~~~~~~~~~~~~----~~~~~~~~~~~~~~a~~~~p~l~~~~~~~~~a~~~~~~ak~~~~P~l~l~~~~~~~~~~~~~~  316 (474)
T 3d5k_A          241 GIPANLPQGLGLD----QTLLTEVPAGLPSDLLQRRPDILEAEHQLMAANASIGAARAAFFPSISLTANAGTMSRQLSGL  316 (474)
T ss_dssp             CCCTTCCCCCCTT----SCCBCCCCCCCGGGHHHHCHHHHHHHHHHHHHHHHHHHHHTTSSCEEEEEEEEEEEESSSTTS
T ss_pred             CCCCCCCCCCCCC----CCCCCCCCHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCC
T ss_conf             9863211111112----246877853669999973879999999999999999998885379556897522345654334


Q ss_pred             CCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             54454104431122345101245665677999999999999999999999999999999999999999999999999999
Q gi|254780930|r  317 FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKS  396 (452)
Q Consensus       317 ~~~~~~~~~~g~~l~~Pif~gg~~~a~i~~a~~~~~~a~~~~~~~~~~a~~ev~~a~~~~~~~~~~~~~~~~~~~~a~~~  396 (452)
                      +......|.+|++++||||+||+++++++.++++.+++..+++++++++..+|++++.++....+++..+++.++.+++.
T Consensus       317 ~~~~~~~~~~g~~ls~plf~~~~~~~~~~~a~~~~~~a~~~~~~~~~~~~~ev~~a~~~~~~~~~~~~~~~~~~~~a~~~  396 (474)
T 3d5k_A          317 FDAGSGSWLFQPSINLPIFTAGSLRASLDYAKIQKDINVAQYEKAIQTAFQEVADGLAARGTFTEQLQAQRDLVKASDEY  396 (474)
T ss_dssp             SSTTCEEEEEEEEEEEEEECSSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCEEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             56765540132343011122220222799999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             99999998718832899999999999999999999999999999999984999998
Q gi|254780930|r  397 MSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP  452 (452)
Q Consensus       397 ~~~~~~~y~~G~~~~~dll~a~~~~~~a~~~~~~a~~~~~~a~~~L~~AlGGg~~~  452 (452)
                      ++.++.+|+.|.++++||+++++++++++.++++++++++.+.++|++|+||||+|
T Consensus       397 l~~~~~~y~~G~~s~~dll~A~~~l~~a~~~~~~a~~~~~~a~~~L~~AlGG~~~~  452 (474)
T 3d5k_A          397 YQLADKRYRTGVDNYLTLLDAQRSLFTAQQQLITDRLNQLTSEVNLYKALGGGWNQ  452 (474)
T ss_dssp             HHHHHHHHHTTSSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCSCCS
T ss_pred             HHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             99999999869960999999999999999999999999999999999970799999


No 2  
>1yc9_A VCEC, multidrug resistance protein; outer membrane protein; HET: BOG; 1.80A {Vibrio cholerae}
Probab=100.00  E-value=0  Score=446.09  Aligned_cols=408  Identities=20%  Similarity=0.328  Sum_probs=364.8

Q ss_pred             CCCCCCCCHHHHHHHCCHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHCCCCCCCCC----------
Q ss_conf             6666768623436609987999999999708998999999999999999875420530111011245665----------
Q gi|254780930|r   42 KNLINIDTLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPN----------  111 (452)
Q Consensus        42 ~~~~~~~~~~ww~~~~d~~L~~~i~~Al~~np~l~~a~~~i~~a~~~~~~a~a~~~P~~~~~~~~~~~~~----------  111 (452)
                      ....+++..+||+.|+||||+++|+.|++|||+|++++.+++++++.+..+++.++|++++++++.....          
T Consensus        16 ~~~~~~~~~~w~~~~~d~tL~~~I~~Al~nnp~l~~a~~~~~~a~~~~~~a~~~~~P~l~~~~~~~~~~~~~~~~~~~~~   95 (442)
T 1yc9_A           16 QAEMDWPSANWWQRYQDAQLNHLIEEALQHSPSLCMAMARLKGAQGFARQAGAIRSFDLGLAASATESKVSERYQSATPP   95 (442)
T ss_dssp             -----CCCTTGGGGGCCHHHHHHHHHHHHSCHHHHHHHHHHHHHHHHHHHHHGGGSCEEEEEEEEEEEECCSSSSCSSCC
T ss_pred             CCCCCCCCHHHHHHCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEEEECCCCCCCCCCCCC
T ss_conf             12479983678876799889999999996499999999999999999999637458805677422114566555677888


Q ss_pred             --CCCCCCCCCCCCCCCCHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             --5544444321110110012345-7788887776555679999999999999876666777889999999999999999
Q gi|254780930|r  112 --LKTNSTGQLDSDWKIDLFGQRR-HIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNI  188 (452)
Q Consensus       112 --~~~~~~~~~~~s~~ldl~G~~~-~~~~a~~~~~~~~~~~~~~~~~l~~~v~~aY~~~~~~~~~~~i~~~~~~~~~~~~  188 (452)
                        ....+..+++++|++++||++. .++.+....+.++..++.++.+++.+|..+|++++.+++.+++.++.++..++.+
T Consensus        96 ~~~~~~~~~~~~~~~~l~~~g~~~~~~~~a~~~~~~a~~~~~~~~~~l~~~v~~~y~~~~~~~~~~~~~~~~l~~~~~~~  175 (442)
T 1yc9_A           96 DGWNDYGTLTLNFQYDFDFWGKNRAAVVAATSELAAAEAESVAARLMISTSIANAYAELARLYANQETVHAALQVRNKTV  175 (442)
T ss_dssp             CSEEEEEEEEEEEEEECCTTSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCEEEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             77664321246789986103311299999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHCCCCCCCCCCCCCCHHHHHCCCCH
Q ss_conf             87876554323456777653222355798999999856888876877639992130001234554433100122104887
Q gi|254780930|r  189 ELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIP  268 (452)
Q Consensus       189 ~~~~~r~~~G~~~~~d~~~a~~~~~~~~~~l~~~~~~~~~a~~~L~~l~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  268 (452)
                      +.++.+++.|.++..|+.+++.++..++..+..++.++..++..|..++|.+|.....+.........   ..+.+...+
T Consensus       176 ~~~~~~~~~G~~~~~d~~~a~~~l~~~~~~l~~~~~~~~~a~~~L~~llg~~~~~~~~~~~~~~~~~~---~~~~~~~~~  252 (442)
T 1yc9_A          176 ELLEKRYANGLETLGSVSQAKAVAASVEAELLGIQESIQLQKNALAALVGQGPDRAASIEEPHITLTS---RYGLPSEAG  252 (442)
T ss_dssp             HHHHHHHHTTSSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCCGGGGGGCCCCCCCCCC---CC-------
T ss_pred             HHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCC---CCCCCHHHH
T ss_conf             99999996575117689999987511269999999999999999999847687521246654212345---667806667


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHCCCCCCCCCCC---CCCCCCCCCEEEEECCCCCCCCHHHHHHHHHH
Q ss_conf             899730234556555899996430101122221001122221122---34454454104431122345101245665677
Q gi|254780930|r  269 ADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIR  345 (452)
Q Consensus       269 ~~~l~~RPdi~~a~~~~~~a~~~i~~a~a~~~P~i~l~~~~~~~~---~~~~~~~~~~~~~g~~l~~Pif~gg~~~a~i~  345 (452)
                      ..++.+||||+.++..+++++.+++.+++.++|+|++.+++++..   ++.+...+..|++|++++||||+||+++++++
T Consensus       253 ~~~l~~~p~l~~~~~~~~~a~~~~~~~~~~~~P~l~l~~~~~~~~~~~~~~~~~~~~~~~~g~~ls~plf~~~~~~~~~~  332 (442)
T 1yc9_A          253 VGLLGHRADITAARWRAEAAAQQVGIAQAQFYPDVTLSAFIGYQAFGLDHLFDSGNDAGAIGPAIYLPLFTGGRLEGQLT  332 (442)
T ss_dssp             CGGGTTCHHHHHHHHHHHHHHHHHHHHHHTTSCEEEEEEEEEEEEESGGGTTSTTCEEEEEEEEEECCCCCTTHHHHHHH
T ss_pred             HHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCEEECCCCCCCCCCCCHHHCCCCCCCCCCCCCCCCCHHH
T ss_conf             77885396999999999999999999875208873045521300034544345652012114323576332364100599


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999999999999999999998718832899999999999999
Q gi|254780930|r  346 RAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVE  425 (452)
Q Consensus       346 ~a~~~~~~a~~~~~~~~~~a~~ev~~a~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~y~~G~~~~~dll~a~~~~~~a~  425 (452)
                      .+++..+++..++++..+++..+|++++..+....+++..+++.+..+++.++.++.+|+.|.++++||+++++++++++
T Consensus       333 ~a~~~~~~a~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~y~~G~~s~~dvl~a~~~l~~a~  412 (442)
T 1yc9_A          333 SAEARYQEAVAQYNGTLVQALHEIADVVTSSQALQARINKTEQAVQQAEQALHIATNRYQGGLATYLDVLVAEESLLNNQ  412 (442)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTSSCHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHH
T ss_conf             99999999999999999999999999999999999999999999999999999999999879961999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             999999999999999999984999998
Q gi|254780930|r  426 VDLSIAKRQLAKSYVDLYIAIGSGYNP  452 (452)
Q Consensus       426 ~~~~~a~~~~~~a~~~L~~AlGGg~~~  452 (452)
                      .+++++++++..+.++|++||||||.|
T Consensus       413 ~~~~~~~~~~~~a~~~L~~AlGgg~~~  439 (442)
T 1yc9_A          413 RALVNLQSRAFSLDLALIHALGGGFET  439 (442)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHTCCCC-
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             999999999999999999981799898


No 3  
>1ek9_A Outer membrane protein TOLC; integral membrane protein, alpha helical barrel, beta barrel; 2.10A {Escherichia coli} SCOP: f.5.1.1 PDB: 1tqq_A 2vde_A 2vdd_A
Probab=100.00  E-value=0  Score=356.43  Aligned_cols=385  Identities=14%  Similarity=0.168  Sum_probs=340.5

Q ss_pred             HHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHCCCCCCCCCC-------CCCCCCCCCCCCCCCHHHHH
Q ss_conf             79999999997089989999999999999998754205301110112456655-------54444432111011001234
Q gi|254780930|r   60 SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNL-------KTNSTGQLDSDWKIDLFGQR  132 (452)
Q Consensus        60 ~L~~~i~~Al~~np~l~~a~~~i~~a~~~~~~a~a~~~P~~~~~~~~~~~~~~-------~~~~~~~~~~s~~ldl~G~~  132 (452)
                      .|.++++.|++|||+|+.++.+++++++.+..+++.++|++++++++++....       ...++.+++++|+|..||+.
T Consensus         2 ~L~~~~~~Al~nnp~l~~a~~~~~~a~~~~~~a~~~~~P~v~~~~~~~~~~~~~~~~~~~~~~~~~~l~l~q~l~~~g~~   81 (428)
T 1ek9_A            2 NLMQVYQQARLSNPELRKSAADRDAAFEKINEARSPLLPQLGLGADYTYSNGYRDANGINSNATSASLQLTQSIFDMSKW   81 (428)
T ss_dssp             CHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHGGGSCEEEEEEEEEEEEECSSSTTCEEEEEEEEEEEEEEEECHHHH
T ss_pred             CHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEEECCCCCCCCCCCCCCEEEEEEEEEEEECCHHH
T ss_conf             88999999997199999999999999999999734648836899766533577777777766425889999885356346


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             57788887776555679999999999999876666777889999999999999999878765543234567776532223
Q gi|254780930|r  133 RHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEI  212 (452)
Q Consensus       133 ~~~~~a~~~~~~~~~~~~~~~~~l~~~v~~aY~~~~~~~~~~~i~~~~~~~~~~~~~~~~~r~~~G~~~~~d~~~a~~~~  212 (452)
                      +.++.+....+.+...+..++.+++.+|..+||+++.+++.+++.++.++..++.++.++.+++.|.++..|+.+++.++
T Consensus        82 ~~~~~a~~~~~~a~~~~~~~~~~~~~~v~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G~~~~~d~~~~~~~~  161 (428)
T 1ek9_A           82 RALTLQEKAAGIQDVTYQTDQQTLILNTATAYFNVLNAIDVLSYTQAQKEAIYRQLDQTTQRFNVGLVAITDVQNARAQY  161 (428)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSSCHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHH
T ss_conf             89999999999999999999999999999999999998889999998999999999999999975887611477787766


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHCCCCCCCCCCCCCCHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             55798999999856888876877639992130001234554433100122104887899730234556555899996430
Q gi|254780930|r  213 KSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI  292 (452)
Q Consensus       213 ~~~~~~l~~~~~~~~~a~~~L~~l~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~RPdi~~a~~~~~~a~~~i  292 (452)
                      ..++..+..++.++..++..|..++|.++...............+....    .+...++.+|||++.++..++.+..++
T Consensus       162 ~~~~~~l~~~~~~~~~~~~~L~~l~g~~~~~~~~~~~~~~~~~~~~~~~----~~~~~a~~~~p~l~~~~~~~~~~~~~~  237 (428)
T 1ek9_A          162 DTVLANELTARNNLDNAVEQLRQITGNYYPELAALNVENFKTDKPQPVN----ALLKEAEKRNLSLLQARLSQDLAREQI  237 (428)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHSCCCSEEEEECTTTCCCCCCCCHH----HHHHHHHHHCHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCHH----HHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             7789889999988999999999883898411112354445667863036----788999874055554279999999999


Q ss_pred             CCHHHHHHHHCCCCCCCCCCCCCC-------------CCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             101122221001122221122344-------------5445410443112234510124566567799999999999999
Q gi|254780930|r  293 GIAKSDLYPSLSLNGSIALTHDNS-------------FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQ  359 (452)
Q Consensus       293 ~~a~a~~~P~i~l~~~~~~~~~~~-------------~~~~~~~~~~g~~l~~Pif~gg~~~a~i~~a~~~~~~a~~~~~  359 (452)
                      +.+++.++|+|++++++++...+.             .......|++|++++||||+||+.+++++.++...+.+..+++
T Consensus       238 ~~~~~~~~P~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gl~~~~plf~g~~~~~~~~~a~~~~~~~~~~~~  317 (428)
T 1ek9_A          238 RQAQDGHLPTLDLTASTGISDTSYSGSKTRGAAGTQYDDSNMGQNKVGLSFSLPIYQGGMVNSQVKQAQYNFVGASEQLE  317 (428)
T ss_dssp             HHHHGGGSCEEEEEEEEEEECCEEESTTSSSSCCSTTSCCCCEEEEEEEEEEEEEEETTHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHCCCCEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEECCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99998149966899864134555444445555664434445544279999987413206677788899999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999999871883289999999999999999999999999999
Q gi|254780930|r  360 ETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSY  439 (452)
Q Consensus       360 ~~~~~a~~ev~~a~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~y~~G~~~~~dll~a~~~~~~a~~~~~~a~~~~~~a~  439 (452)
                      +....+..++++++..+....+++..+++.+..+++.++.++.+|+.|..+++||+++++++++++.+++++++++..+.
T Consensus       318 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~y~~G~~s~~dll~a~~~~~~a~~~~~~a~~~~~~a~  397 (428)
T 1ek9_A          318 SAHRSVVQTVRSSFNNINASISSINAYKQAVVSAQSSLDAMEAGYSVGTRTIVDVLDATTTLYNAKQELANARYNYLINQ  397 (428)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999999999999999999999999999999986997199999999999999999999999999999


Q ss_pred             HHHHHHHCC
Q ss_conf             999998499
Q gi|254780930|r  440 VDLYIAIGS  448 (452)
Q Consensus       440 ~~L~~AlGG  448 (452)
                      ++|++++|.
T Consensus       398 ~~l~~~~G~  406 (428)
T 1ek9_A          398 LNIKSALGT  406 (428)
T ss_dssp             HHHHHHHTC
T ss_pred             HHHHHHHCC
T ss_conf             999998689


No 4  
>1ek9_A Outer membrane protein TOLC; integral membrane protein, alpha helical barrel, beta barrel; 2.10A {Escherichia coli} SCOP: f.5.1.1 PDB: 1tqq_A 2vde_A 2vdd_A
Probab=99.83  E-value=4.9e-18  Score=134.23  Aligned_cols=180  Identities=17%  Similarity=0.199  Sum_probs=158.5

Q ss_pred             HHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHCCCCCCCCC------------------CCCCCCCCCCC
Q ss_conf             999999999708998999999999999999875420530111011245665------------------55444443211
Q gi|254780930|r   61 LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPN------------------LKTNSTGQLDS  122 (452)
Q Consensus        61 L~~~i~~Al~~np~l~~a~~~i~~a~~~~~~a~a~~~P~~~~~~~~~~~~~------------------~~~~~~~~~~~  122 (452)
                      +..++..++.+||+++.+...++.++..++.+++.++|++++.+++++...                  .....+.++++
T Consensus       209 ~~~~~~~a~~~~p~l~~~~~~~~~~~~~~~~~~~~~~P~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gl~~  288 (428)
T 1ek9_A          209 VNALLKEAEKRNLSLLQARLSQDLAREQIRQAQDGHLPTLDLTASTGISDTSYSGSKTRGAAGTQYDDSNMGQNKVGLSF  288 (428)
T ss_dssp             HHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHGGGSCEEEEEEEEEEECCEEESTTSSSSCCSTTSCCCCEEEEEEEEE
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEE
T ss_conf             36788999874055554279999999999999981499668998641345554444455556644344455442799999


Q ss_pred             CCCCCHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             10110012345-77888877765556799999999999998766667778899999999999999998787655432345
Q gi|254780930|r  123 DWKIDLFGQRR-HIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATS  201 (452)
Q Consensus       123 s~~ldl~G~~~-~~~~a~~~~~~~~~~~~~~~~~l~~~v~~aY~~~~~~~~~~~i~~~~~~~~~~~~~~~~~r~~~G~~~  201 (452)
                      +|+|..+|+.+ .++.++.....++.+++..+.++..++..+|..+..+.+.+++.++.++..++.++..+.+|+.|..+
T Consensus       289 ~~plf~g~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~y~~G~~s  368 (428)
T 1ek9_A          289 SLPIYQGGMVNSQVKQAQYNFVGASEQLESAHRSVVQTVRSSFNNINASISSINAYKQAVVSAQSSLDAMEAGYSVGTRT  368 (428)
T ss_dssp             EEEEEETTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSSC
T ss_pred             EEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             87413206677788899999999999999999999999999999999999999999999999999999999999869971


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             677765322235579899999985688887687763999
Q gi|254780930|r  202 KLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYP  240 (452)
Q Consensus       202 ~~d~~~a~~~~~~~~~~l~~~~~~~~~a~~~L~~l~G~~  240 (452)
                      ..|++.++..+.+++.++.+++.++..+...|..++|.-
T Consensus       369 ~~dll~a~~~~~~a~~~~~~a~~~~~~a~~~l~~~~G~L  407 (428)
T 1ek9_A          369 IVDVLDATTTLYNAKQELANARYNYLINQLNIKSALGTL  407 (428)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             999999999999999999999999999999999986899


No 5  
>1yc9_A VCEC, multidrug resistance protein; outer membrane protein; HET: BOG; 1.80A {Vibrio cholerae}
Probab=99.80  E-value=3.1e-17  Score=129.00  Aligned_cols=181  Identities=15%  Similarity=0.119  Sum_probs=154.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHCCCCCCCCCCCCCC-------CCCCCCEEEEECCCCCCCCHHHHHH
Q ss_conf             899730234556555899996430101122221001122221122344-------5445410443112234510124566
Q gi|254780930|r  269 ADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS-------FPGYNTHWSFGPKLYLPIFDKGKIK  341 (452)
Q Consensus       269 ~~~l~~RPdi~~a~~~~~~a~~~i~~a~a~~~P~i~l~~~~~~~~~~~-------~~~~~~~~~~g~~l~~Pif~gg~~~  341 (452)
                      ..++.|+|||+.++..++++...++.+++.++|+|+++++++......       ..+....+..++++++|||+||++.
T Consensus        40 ~~Al~nnp~l~~a~~~~~~a~~~~~~a~~~~~P~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~g~~~  119 (442)
T 1yc9_A           40 EEALQHSPSLCMAMARLKGAQGFARQAGAIRSFDLGLAASATESKVSERYQSATPPDGWNDYGTLTLNFQYDFDFWGKNR  119 (442)
T ss_dssp             HHHHHSCHHHHHHHHHHHHHHHHHHHHHGGGSCEEEEEEEEEEEECCSSSSCSSCCCSEEEEEEEEEEEEEECCTTSHHH
T ss_pred             HHHHHCCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEEEECCCCCCCCCCCCCCCCCCCCCEEEEEEEEEECCCCCH
T ss_conf             99996499999999999999999999637458805677422114566555677888776643212467899861033112


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHH
Q ss_conf             56779999999999999999999999999999999999999999999999999999999999871883289999999999
Q gi|254780930|r  342 SNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERAT  421 (452)
Q Consensus       342 a~i~~a~~~~~~a~~~~~~~~~~a~~ev~~a~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~y~~G~~~~~dll~a~~~~  421 (452)
                      ..++.++...+.+..+++.+..++..+|..+|..+..+.+.+...++.++.+++.++.++.+|+.|..+..|++.++..+
T Consensus       120 ~~~~~a~~~~~~a~~~~~~~~~~l~~~v~~~y~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~G~~~~~d~~~a~~~l  199 (442)
T 1yc9_A          120 AAVVAATSELAAAEAESVAARLMISTSIANAYAELARLYANQETVHAALQVRNKTVELLEKRYANGLETLGSVSQAKAVA  199 (442)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSSCHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHH
T ss_conf             99999999999999999999999999999999999999999999999999999999999999965751176899999875


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             9999999999999999999999984999
Q gi|254780930|r  422 AKVEVDLSIAKRQLAKSYVDLYIAIGSG  449 (452)
Q Consensus       422 ~~a~~~~~~a~~~~~~a~~~L~~AlGGg  449 (452)
                      .+++..+.+++.++..+...|...+|..
T Consensus       200 ~~~~~~l~~~~~~~~~a~~~L~~llg~~  227 (442)
T 1yc9_A          200 ASVEAELLGIQESIQLQKNALAALVGQG  227 (442)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHTTCC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             1126999999999999999999984768


No 6  
>3d5k_A OPRM, outer membrane protein OPRM; channel, beta-alpha-barrel, antibiotic resistance, lipoprotein, palmitate, transmembrane, transport; 2.40A {Pseudomonas aeruginosa} PDB: 1wp1_A
Probab=99.75  E-value=1.1e-15  Score=118.91  Aligned_cols=176  Identities=18%  Similarity=0.170  Sum_probs=145.7

Q ss_pred             HHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHCCCCCCCCCC--------CCCCCCCCCCCCCCCHHHHHH-HHH
Q ss_conf             99997089989999999999999998754205301110112456655--------544444321110110012345-778
Q gi|254780930|r   66 KIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNL--------KTNSTGQLDSDWKIDLFGQRR-HIE  136 (452)
Q Consensus        66 ~~Al~~np~l~~a~~~i~~a~~~~~~a~a~~~P~~~~~~~~~~~~~~--------~~~~~~~~~~s~~ldl~G~~~-~~~  136 (452)
                      ..++.+||+++.++..++.++..++.+++.++|++++.+++++....        ......+++++|++..+|+.+ .++
T Consensus       266 ~~a~~~~p~l~~~~~~~~~a~~~~~~ak~~~~P~l~l~~~~~~~~~~~~~~~~~~~~~~~~g~~ls~plf~~~~~~~~~~  345 (474)
T 3d5k_A          266 SDLLQRRPDILEAEHQLMAANASIGAARAAFFPSISLTANAGTMSRQLSGLFDAGSGSWLFQPSINLPIFTAGSLRASLD  345 (474)
T ss_dssp             GGHHHHCHHHHHHHHHHHHHHHHHHHHHTTSSCEEEEEEEEEEEESSSTTSSSTTCEEEEEEEEEEEEEECSSHHHHHHH
T ss_pred             HHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCCCCCCEEEEEEEECCCCCCCCHHHHHH
T ss_conf             99997387999999999999999999888537955689752234565433456765540132343011122220222799


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             88877765556799999999999998766667778899999999999999998787655432345677765322235579
Q gi|254780930|r  137 SSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIE  216 (452)
Q Consensus       137 ~a~~~~~~~~~~~~~~~~~l~~~v~~aY~~~~~~~~~~~i~~~~~~~~~~~~~~~~~r~~~G~~~~~d~~~a~~~~~~~~  216 (452)
                      .+....+.+..+++.++.++..++..+|.++....++++..++.++..++.++..+.+|+.|.++..|++.++..+..++
T Consensus       346 ~a~~~~~~a~~~~~~~~~~~~~ev~~a~~~~~~~~~~~~~~~~~~~~a~~~l~~~~~~y~~G~~s~~dll~A~~~l~~a~  425 (474)
T 3d5k_A          346 YAKIQKDINVAQYEKAIQTAFQEVADGLAARGTFTEQLQAQRDLVKASDEYYQLADKRYRTGVDNYLTLLDAQRSLFTAQ  425 (474)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSSCHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHH
T ss_conf             99999999999999999999999999999999999999999999999999999999999869960999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCH
Q ss_conf             8999999856888876877639992
Q gi|254780930|r  217 SDIPTLEKSFRMNVHNISTLLGYPA  241 (452)
Q Consensus       217 ~~l~~~~~~~~~a~~~L~~l~G~~~  241 (452)
                      ..+..++.++..+...|...+|...
T Consensus       426 ~~~~~a~~~~~~a~~~L~~AlGG~~  450 (474)
T 3d5k_A          426 QQLITDRLNQLTSEVNLYKALGGGW  450 (474)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHTCSC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             9999999999999999999707999


No 7  
>3lnn_A Membrane fusion protein (MFP-RND) heavy metal CAT tricomponent efflux HMXB (CZCB-LIKE)...; structural genomics, PSI-2; 2.80A {Cupriavidus metallidurans}
Probab=88.65  E-value=0.89  Score=21.45  Aligned_cols=63  Identities=8%  Similarity=0.058  Sum_probs=47.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             999999999999998787655432345677765322235579899999985688887687763
Q gi|254780930|r  175 SIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLL  237 (452)
Q Consensus       175 ~i~~~~~~~~~~~~~~~~~r~~~G~~~~~d~~~a~~~~~~~~~~l~~~~~~~~~a~~~L~~l~  237 (452)
                      ...+..++..+..++..+.+++.|.++..++.+++..+..++..+..++..+......+....
T Consensus       101 ~~a~~~l~~a~~~~~r~~~L~~~~~~s~~~~~~~~~~~~~a~~~~~~a~~~l~~~~~~~~~~~  163 (359)
T 3lnn_A          101 AKARAAMTMARRNLDRQRELDKSEIAAKRDFEQAQSDYDQAASESQRADARLAQLGAKGGGTL  163 (359)
T ss_dssp             HHHHHHHHHHHHHHHHHHTTTSSSCCCCTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHGGGB
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             999987887778999998764233203235788876555456677788999987776540223


No 8  
>2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport protein; 2.71A {Escherichia coli}
Probab=74.93  E-value=3  Score=18.02  Aligned_cols=58  Identities=7%  Similarity=0.017  Sum_probs=44.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             9999999998787655432345677765322235579899999985688887687763
Q gi|254780930|r  180 ILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLL  237 (452)
Q Consensus       180 ~~~~~~~~~~~~~~r~~~G~~~~~d~~~a~~~~~~~~~~l~~~~~~~~~a~~~L~~l~  237 (452)
                      .++..+..++..+..++.|..+..++..++..+...+.++..++.++...+..|....
T Consensus        75 ~l~~a~~~~~r~~~l~~~~~~~~~~~~~a~~~~~~~~~~l~~a~a~l~~~~~~l~~~~  132 (277)
T 2f1m_A           75 AANIAQLTVNRYQKLLGTQYISKQEYDQALADAQQANAAVTAAKAAVETARINLAYTK  132 (277)
T ss_dssp             HHHHHHHHHHHHHTTTTSTTCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTE
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCEE
T ss_conf             5554100467887764436532101577776677656579999999877765202249


No 9  
>3c9h_A ABC transporter, substrate binding protein; structural genomics, MCSG, PSI-2, protein structure initiative; HET: CIT; 1.90A {Agrobacterium tumefaciens str}
Probab=64.08  E-value=0.71  Score=22.07  Aligned_cols=21  Identities=10%  Similarity=0.025  Sum_probs=16.1

Q ss_pred             CHHHHHHHHHHHHHCHHHHHH
Q ss_conf             987999999999708998999
Q gi|254780930|r   58 DTSLNKLVKIALQQNLTILQA   78 (452)
Q Consensus        58 d~~L~~~i~~Al~~np~l~~a   78 (452)
                      .+.++.+|+.--+.||++++-
T Consensus        44 ~~~~~~li~~Fe~~~PgI~V~   64 (355)
T 3c9h_A           44 EPLATPMIEGFQKANPDIAVH   64 (355)
T ss_dssp             HHHHHHHHHHHHHHCTTCEEE
T ss_pred             HHHHHHHHHHHHHHCCCCEEE
T ss_conf             789999999999878893899


No 10 
>3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli}
Probab=56.16  E-value=6.8  Score=15.64  Aligned_cols=65  Identities=17%  Similarity=0.166  Sum_probs=47.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             88999999999999999987876554323456777653222355798999999856888876877
Q gi|254780930|r  171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIST  235 (452)
Q Consensus       171 ~~~~~i~~~~~~~~~~~~~~~~~r~~~G~~~~~d~~~a~~~~~~~~~~l~~~~~~~~~a~~~L~~  235 (452)
                      +.+++..+..++.++...+..+..++.|..+..++...+.........+..++..+..+...+..
T Consensus        82 ~~~l~~a~~~l~~a~~~~~r~~~l~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~  146 (341)
T 3fpp_A           82 RAQRQQAEAELKLARVTYSRQQRLAQTQAVSQQDLDNAATEMAVKQAQIGTIDAQIKRNQASLDT  146 (341)
T ss_dssp             HHHHHHHHHHHHHHTHHHHHHHHHHHTSSSTTHHHHHHHHHHHHTHHHHHHHHHHHHHTHHHHTT
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             65489998788874433201234420376526666555432102356788877799876665555


No 11 
>2w5v_A Alkaline phosphatase; psychrophiles, cold adaptation, hydrolase; HET: SEP; 1.78A {Antarctic bacterium TAB5} PDB: 2w5w_A* 2w5x_A* 2iuc_A 2iuc_B
Probab=48.57  E-value=3  Score=17.98  Aligned_cols=20  Identities=25%  Similarity=0.577  Sum_probs=15.3

Q ss_pred             CCCHHHHHHHHHHHHHHHCC
Q ss_conf             93069999999999975026
Q gi|254780930|r    1 MNILRAIFSLFIVLLAGCTV   20 (452)
Q Consensus         1 M~~~~~~~~l~~~~l~gC~~   20 (452)
                      ||+.+.+++++++++.+|..
T Consensus         1 m~~~~~~~~l~~l~~~~~~~   20 (375)
T 2w5v_A            1 MKLKKIVFTLIALGLFSCKT   20 (375)
T ss_dssp             --------------------
T ss_pred             CCCHHHHHHHHHHHHHHHHH
T ss_conf             96159999999999999864


No 12 
>1dbg_A Chondroitinase B; beta helix, polysaccharide lyase, dematan sulfate; HET: MAN RAM GCU MXY G4D BGC; 1.70A {Pedobacter heparinus} SCOP: b.80.1.4 PDB: 1dbo_A* 1ofl_A* 1ofm_A*
Probab=44.93  E-value=3.7  Score=17.39  Aligned_cols=22  Identities=18%  Similarity=0.413  Sum_probs=14.2

Q ss_pred             CCCHHHHHHHHHHHHHHHCCCC
Q ss_conf             9306999999999997502689
Q gi|254780930|r    1 MNILRAIFSLFIVLLAGCTVGP   22 (452)
Q Consensus         1 M~~~~~~~~l~~~~l~gC~~~p   22 (452)
                      ||||+.+..++++++..|++.|
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~   22 (506)
T 1dbg_A            1 MKMLNKLAGYLLPIMVLLNVAP   22 (506)
T ss_dssp             ----------------------
T ss_pred             CHHHHHHHHHHHHHHHHHCCCC
T ss_conf             9279999999999998733040


No 13 
>1twy_A ABC transporter, periplasmic substrate-binding protein; nysgxrc target, structural genomics, protein structure initiative; 1.65A {Vibrio cholerae o1 biovar eltor str} SCOP: c.94.1.1
Probab=43.40  E-value=4.2  Score=17.06  Aligned_cols=20  Identities=25%  Similarity=0.376  Sum_probs=14.5

Q ss_pred             CCCHHHHHHHHHHHHHHHCC
Q ss_conf             93069999999999975026
Q gi|254780930|r    1 MNILRAIFSLFIVLLAGCTV   20 (452)
Q Consensus         1 M~~~~~~~~l~~~~l~gC~~   20 (452)
                      ||++|.++.++++++.+|+.
T Consensus         1 m~~~~~~l~~~~a~~~~~~~   20 (290)
T 1twy_A            1 MSLIRMALAAVCALLFSITT   20 (290)
T ss_dssp             --------------------
T ss_pred             CCHHHHHHHHHHHHHHHHHH
T ss_conf             94689999999999999983


No 14 
>2v25_A Major cell-binding factor; antigen, adhesin, aspartate, glutamate, transport, ABC transport, virulence factor, receptor; 1.49A {Campylobacter jejuni}
Probab=37.85  E-value=5.6  Score=16.24  Aligned_cols=22  Identities=18%  Similarity=0.381  Sum_probs=16.7

Q ss_pred             CCCHHHHHHHHHHHHHHHCCCC
Q ss_conf             9306999999999997502689
Q gi|254780930|r    1 MNILRAIFSLFIVLLAGCTVGP   22 (452)
Q Consensus         1 M~~~~~~~~l~~~~l~gC~~~p   22 (452)
                      |.+.|.++.+.+++|++|+...
T Consensus         1 m~~~k~l~~~~~~~l~~~~~~~   22 (259)
T 2v25_A            1 MVFRKSLLKLAVFALGACVAFS   22 (259)
T ss_dssp             ----------------------
T ss_pred             CCHHHHHHHHHHHHHHHHHHHC
T ss_conf             9637999999999999998723


Done!