RPSBLAST alignment for GI: 254780930 and conserved domain: pfam02321

>gnl|CDD|145461 pfam02321, OEP, Outer membrane efflux protein. The OEP family (Outer membrane efflux protein) form trimeric channels that allow export of a variety of substrates in Gram negative bacteria. Each member of this family is composed of two repeats. The trimeric channel is composed of a 12 stranded all beta sheet barrel that spans the outer membrane, and a long all helical barrel that spans the periplasm. Length = 186
 Score = 79.5 bits (196), Expect = 2e-15
 Identities = 41/186 (22%), Positives = 89/186 (47%), Gaps = 8/186 (4%)

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQL 120
           L++L+ +AL+ N  +  A   I AA+ NI   +++  P    S  + +  N         
Sbjct: 1   LDELLALALENNPDLKAAEAEIEAARANIKLAKSEFLPDLSLSGGYGYNGNNSNGGGDDP 60

Query: 121 DS-------DWKIDLFGQRRH-IESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
            +          +   G+RR  ++++ A L++A AQ++ A+  +  ++  +Y++    KE
Sbjct: 61  RNGSVGLGLSQPLFDGGKRRARVKAAKAQLEAAEAQLEQARRQLRLEVAQAYLNLLAAKE 120

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
           ++ +A Q L+L ++ +EL+  ++  G  S L +++ E E+     ++   E    +    
Sbjct: 121 QLELAKQALELAEEALELAEARYEAGLISLLDVLQAEVELLEARLELLEAEADLELARAQ 180

Query: 233 ISTLLG 238
           +  LLG
Sbjct: 181 LEYLLG 186