RPSBLAST alignment for GI: 254780930 and conserved domain: PRK09837

>gnl|CDD|182103 PRK09837, PRK09837, copper/silver efflux system outer membrane protein CusC; Provisional. Length = 461
 Score =  125 bits (316), Expect = 2e-29
 Identities = 117/458 (25%), Positives = 218/458 (47%), Gaps = 29/458 (6%)

Query: 12  IVLLAGC-TVGPEYTKPHMPLLPTQFSIGNSKNLINIDTL----KWWESFNDTSLNKLVK 66
            + L GC ++ P+Y +P MP+ P QFS+  +  L+N         W   F D  +  L+ 
Sbjct: 12  ALALTGCVSLAPDYQRPAMPV-PQQFSLSQNG-LVNAADNYQNTGWRTFFVDNQVKTLIS 69

Query: 67  IALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLDSD--- 123
            AL  N  +  AT ++  A+       AD +P      S  +  NLK ++    +     
Sbjct: 70  EALVNNRDLRMATLKVQEARAQYRLTDADRYPQLNGEGSGSWSGNLKGDTATTREYSTGL 129

Query: 124 ---WKIDLFGQRRHI-ESSLAN-LDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAH 178
              + +D FG+ +++ E+   N L S  AQ  +  L ++S +  SY + +    ++ IA 
Sbjct: 130 NLSFDLDFFGRLKNMSEAERQNYLASEEAQRAVHIL-LVSNVAQSYFNQQLAYAQLQIAE 188

Query: 179 QILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLG 238
           + L  Y+++      +   G+++ L+L +    I+S  +DI   +       + +  LLG
Sbjct: 189 ETLRNYQQSYAFVEKQLLTGSSNVLALEQARGVIESTRADIAKRQGELAQANNALQLLLG 248

Query: 239 YPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSD 298
                +    Q Q+ N      + +  G+ + ++  RPDI   E  L  + A IG A++ 
Sbjct: 249 ----SYGKLPQAQTVNSDSLQSVKLPAGLSSQILLQRPDIMEAEHALMAANANIGAARAA 304

Query: 299 LYPSLSLNGSI-ALTHDNS--FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQY 355
            +PS+SL   +   + D S  F   +  W+F PK+ +PIF+ G+ ++N+  AE   Q+  
Sbjct: 305 FFPSISLTSGLSTSSSDLSSLFNASSGMWNFIPKIEIPIFNAGRNQANLDLAEIRQQQSV 364

Query: 356 ITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDIL 415
           + +++ + NA KEV +AL         ++  Q  +   + ++  +   Y+ G  S L++L
Sbjct: 365 VNYEQKIQNAFKEVADALALRQSLNDQISAQQRYLASLQITLQRARALYQHGAVSYLEVL 424

Query: 416 DIERA---TAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           D ER+   T +  +DL+ A RQ+ +  + L+ A+G G+
Sbjct: 425 DAERSLFATRQTLLDLNYA-RQVNE--ISLFTALGGGW 459