RPSBLAST alignment of GI: 254780930 and protein with PDBid: 1yc9

>1yc9_A VCEC, multidrug resistance protein; outer membrane protein; HET: BOG; 1.80A {Vibrio cholerae} Length = 442
 Score =  148 bits (374), Expect = 2e-36
 Identities = 82/417 (19%), Positives = 179/417 (42%), Gaps = 19/417 (4%)

Query: 52  WWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISH----- 106
           WW+ + D  LN L++ ALQ + ++  A  R+  A+       A        + S      
Sbjct: 26  WWQRYQDAQLNHLIEEALQHSPSLCMAMARLKGAQGFARQAGAIRSFDLGLAASATESKV 85

Query: 107 -------RFIPNLKTNSTGQLDSDWKIDLFGQR-RHIESSLANLDSAYAQVDIAKLNVIS 158
                            T  L+  +  D +G+    + ++ + L +A A+   A+L + +
Sbjct: 86  SERYQSATPPDGWNDYGTLTLNFQYDFDFWGKNRAAVVAATSELAAAEAESVAARLMIST 145

Query: 159 KLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESD 218
            +  +Y +           H  L +  K +EL   ++  G  +  S+ + +A   S+E++
Sbjct: 146 SIANAYAELARLYANQETVHAALQVRNKTVELLEKRYANGLETLGSVSQAKAVAASVEAE 205

Query: 219 IPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDI 278
           +  +++S ++  + ++ L+G            +  +        +       L+ +R DI
Sbjct: 206 LLGIQESIQLQKNALAALVGQGPDRAA---SIEEPHITLTSRYGLPSEAGVGLLGHRADI 262

Query: 279 RYQEKKLADSVAKIGIAKSDLYPSLSLN---GSIALTHDNSFPGYNTHWSFGPKLYLPIF 335
                +   +  ++GIA++  YP ++L+   G  A   D+ F   N   + GP +YLP+F
Sbjct: 263 TAARWRAEAAAQQVGIAQAQFYPDVTLSAFIGYQAFGLDHLFDSGNDAGAIGPAIYLPLF 322

Query: 336 DKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKK 395
             G+++  +  AE+  QE    +  T++ A+ E+ + +TS    +  + K + AV+  ++
Sbjct: 323 TGGRLEGQLTSAEARYQEAVAQYNGTLVQALHEIADVVTSSQALQARINKTEQAVQQAEQ 382

Query: 396 SMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
           ++ ++   Y+ G  + LD+L  E +    +  L   + +     + L  A+G G+  
Sbjct: 383 ALHIATNRYQGGLATYLDVLVAEESLLNNQRALVNLQSRAFSLDLALIHALGGGFET 439