BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254780931|ref|YP_003065344.1| hypothetical protein CLIBASIA_04150 [Candidatus Liberibacter asiaticus str. psy62] (56 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done Results from round 1 >gi|254780931|ref|YP_003065344.1| hypothetical protein CLIBASIA_04150 [Candidatus Liberibacter asiaticus str. psy62] gi|254040608|gb|ACT57404.1| hypothetical protein CLIBASIA_04150 [Candidatus Liberibacter asiaticus str. psy62] Length = 56 Score = 114 bits (284), Expect = 6e-24, Method: Compositional matrix adjust. Identities = 56/56 (100%), Positives = 56/56 (100%) Query: 1 MDYPCNKEYFKTISTVFGKLGDMRAQNIFLKDIKDKDIIFYLHILIAFEKVIDYLL 56 MDYPCNKEYFKTISTVFGKLGDMRAQNIFLKDIKDKDIIFYLHILIAFEKVIDYLL Sbjct: 1 MDYPCNKEYFKTISTVFGKLGDMRAQNIFLKDIKDKDIIFYLHILIAFEKVIDYLL 56 >gi|125974804|ref|YP_001038714.1| restriction endonuclease (HaeIII) [Clostridium thermocellum ATCC 27405] gi|125715029|gb|ABN53521.1| restriction endonuclease (HaeIII) [Clostridium thermocellum ATCC 27405] Length = 319 Score = 38.1 bits (87), Expect = 0.40, Method: Composition-based stats. Identities = 17/52 (32%), Positives = 33/52 (63%) Query: 4 PCNKEYFKTISTVFGKLGDMRAQNIFLKDIKDKDIIFYLHILIAFEKVIDYL 55 PC++ YF I+ +F +L ++R Q ++I +K+ FY+ +L AF + ++ L Sbjct: 141 PCSESYFIEINPLFDELEELREQGELWRNISNKEERFYVPLLEAFIRELERL 192 >gi|304390096|ref|ZP_07372050.1| type II site-specific deoxyribonuclease [Mobiluncus curtisii subsp. curtisii ATCC 35241] gi|304326578|gb|EFL93822.1| type II site-specific deoxyribonuclease [Mobiluncus curtisii subsp. curtisii ATCC 35241] Length = 317 Score = 36.6 bits (83), Expect = 1.1, Method: Composition-based stats. Identities = 15/45 (33%), Positives = 26/45 (57%) Query: 4 PCNKEYFKTISTVFGKLGDMRAQNIFLKDIKDKDIIFYLHILIAF 48 PC++ Y+ + +F L +AQ + +I+DKD Y+ +L AF Sbjct: 141 PCSQRYWDDVEPIFTCLAAKKAQGLKWSEIRDKDTTVYVPLLQAF 185 >gi|298346144|ref|YP_003718831.1| type II site-specific deoxyribonuclease [Mobiluncus curtisii ATCC 43063] gi|315657353|ref|ZP_07910235.1| type II restriction enzyme HaeIII [Mobiluncus curtisii subsp. holmesii ATCC 35242] gi|298236205|gb|ADI67337.1| type II site-specific deoxyribonuclease [Mobiluncus curtisii ATCC 43063] gi|315491825|gb|EFU81434.1| type II restriction enzyme HaeIII [Mobiluncus curtisii subsp. holmesii ATCC 35242] Length = 317 Score = 36.6 bits (83), Expect = 1.1, Method: Composition-based stats. Identities = 15/45 (33%), Positives = 26/45 (57%) Query: 4 PCNKEYFKTISTVFGKLGDMRAQNIFLKDIKDKDIIFYLHILIAF 48 PC++ Y+ + +F L +AQ + +I+DKD Y+ +L AF Sbjct: 141 PCSQRYWDDVEPIFTCLAAKKAQGLKWSEIRDKDTTVYVPLLQAF 185 >gi|315654723|ref|ZP_07907629.1| type II restriction enzyme HaeIII [Mobiluncus curtisii ATCC 51333] gi|315491187|gb|EFU80806.1| type II restriction enzyme HaeIII [Mobiluncus curtisii ATCC 51333] Length = 317 Score = 36.6 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 15/45 (33%), Positives = 26/45 (57%) Query: 4 PCNKEYFKTISTVFGKLGDMRAQNIFLKDIKDKDIIFYLHILIAF 48 PC++ Y+ + +F L +AQ + +I+DKD Y+ +L AF Sbjct: 141 PCSQRYWDDVEPIFTCLAAKKAQGLKWSEIRDKDATVYVPLLQAF 185 >gi|148910486|gb|ABR18318.1| unknown [Picea sitchensis] Length = 403 Score = 34.7 bits (78), Expect = 4.0, Method: Composition-based stats. Identities = 18/44 (40%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Query: 5 CNKEYFKTISTVFGKLGDMRAQNIFLKDIKDKDIIFYLHILIAF 48 C+++ FKT+ TVF K D+R I + +K + F LHILI Sbjct: 255 CDRKLFKTVLTVFCKDTDLR-NTITTRVVKKQSATFILHILITL 297 Searching..................................................done Results from round 2 CONVERGED! >gi|254780931|ref|YP_003065344.1| hypothetical protein CLIBASIA_04150 [Candidatus Liberibacter asiaticus str. psy62] gi|254040608|gb|ACT57404.1| hypothetical protein CLIBASIA_04150 [Candidatus Liberibacter asiaticus str. psy62] Length = 56 Score = 96.1 bits (238), Expect = 1e-18, Method: Composition-based stats. Identities = 56/56 (100%), Positives = 56/56 (100%) Query: 1 MDYPCNKEYFKTISTVFGKLGDMRAQNIFLKDIKDKDIIFYLHILIAFEKVIDYLL 56 MDYPCNKEYFKTISTVFGKLGDMRAQNIFLKDIKDKDIIFYLHILIAFEKVIDYLL Sbjct: 1 MDYPCNKEYFKTISTVFGKLGDMRAQNIFLKDIKDKDIIFYLHILIAFEKVIDYLL 56 >gi|125974804|ref|YP_001038714.1| restriction endonuclease (HaeIII) [Clostridium thermocellum ATCC 27405] gi|125715029|gb|ABN53521.1| restriction endonuclease (HaeIII) [Clostridium thermocellum ATCC 27405] Length = 319 Score = 36.8 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 17/52 (32%), Positives = 33/52 (63%) Query: 4 PCNKEYFKTISTVFGKLGDMRAQNIFLKDIKDKDIIFYLHILIAFEKVIDYL 55 PC++ YF I+ +F +L ++R Q ++I +K+ FY+ +L AF + ++ L Sbjct: 141 PCSESYFIEINPLFDELEELREQGELWRNISNKEERFYVPLLEAFIRELERL 192 >gi|304390096|ref|ZP_07372050.1| type II site-specific deoxyribonuclease [Mobiluncus curtisii subsp. curtisii ATCC 35241] gi|304326578|gb|EFL93822.1| type II site-specific deoxyribonuclease [Mobiluncus curtisii subsp. curtisii ATCC 35241] Length = 317 Score = 35.3 bits (80), Expect = 2.9, Method: Composition-based stats. Identities = 15/45 (33%), Positives = 26/45 (57%) Query: 4 PCNKEYFKTISTVFGKLGDMRAQNIFLKDIKDKDIIFYLHILIAF 48 PC++ Y+ + +F L +AQ + +I+DKD Y+ +L AF Sbjct: 141 PCSQRYWDDVEPIFTCLAAKKAQGLKWSEIRDKDTTVYVPLLQAF 185 >gi|298346144|ref|YP_003718831.1| type II site-specific deoxyribonuclease [Mobiluncus curtisii ATCC 43063] gi|315657353|ref|ZP_07910235.1| type II restriction enzyme HaeIII [Mobiluncus curtisii subsp. holmesii ATCC 35242] gi|298236205|gb|ADI67337.1| type II site-specific deoxyribonuclease [Mobiluncus curtisii ATCC 43063] gi|315491825|gb|EFU81434.1| type II restriction enzyme HaeIII [Mobiluncus curtisii subsp. holmesii ATCC 35242] Length = 317 Score = 35.3 bits (80), Expect = 2.9, Method: Composition-based stats. Identities = 15/45 (33%), Positives = 26/45 (57%) Query: 4 PCNKEYFKTISTVFGKLGDMRAQNIFLKDIKDKDIIFYLHILIAF 48 PC++ Y+ + +F L +AQ + +I+DKD Y+ +L AF Sbjct: 141 PCSQRYWDDVEPIFTCLAAKKAQGLKWSEIRDKDTTVYVPLLQAF 185 >gi|315654723|ref|ZP_07907629.1| type II restriction enzyme HaeIII [Mobiluncus curtisii ATCC 51333] gi|315491187|gb|EFU80806.1| type II restriction enzyme HaeIII [Mobiluncus curtisii ATCC 51333] Length = 317 Score = 34.9 bits (79), Expect = 3.5, Method: Composition-based stats. Identities = 15/45 (33%), Positives = 26/45 (57%) Query: 4 PCNKEYFKTISTVFGKLGDMRAQNIFLKDIKDKDIIFYLHILIAF 48 PC++ Y+ + +F L +AQ + +I+DKD Y+ +L AF Sbjct: 141 PCSQRYWDDVEPIFTCLAAKKAQGLKWSEIRDKDATVYVPLLQAF 185 >gi|148910486|gb|ABR18318.1| unknown [Picea sitchensis] Length = 403 Score = 33.7 bits (76), Expect = 7.5, Method: Composition-based stats. Identities = 18/44 (40%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Query: 5 CNKEYFKTISTVFGKLGDMRAQNIFLKDIKDKDIIFYLHILIAF 48 C+++ FKT+ TVF K D+R I + +K + F LHILI Sbjct: 255 CDRKLFKTVLTVFCKDTDLR-NTITTRVVKKQSATFILHILITL 297 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.331 0.150 0.447 Lambda K H 0.267 0.0475 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,308,414,723 Number of Sequences: 14124377 Number of extensions: 48777859 Number of successful extensions: 143310 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 5 Number of HSP's that attempted gapping in prelim test: 143296 Number of HSP's gapped (non-prelim): 18 length of query: 56 length of database: 4,842,793,630 effective HSP length: 29 effective length of query: 27 effective length of database: 4,433,186,697 effective search space: 119696040819 effective search space used: 119696040819 T: 11 A: 40 X1: 16 ( 7.6 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 76 (33.7 bits)