BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780931|ref|YP_003065344.1| hypothetical protein CLIBASIA_04150 [Candidatus Liberibacter asiaticus str. psy62] (56 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780931|ref|YP_003065344.1| hypothetical protein CLIBASIA_04150 [Candidatus Liberibacter asiaticus str. psy62] Length = 56 Score = 114 bits (284), Expect = 4e-28, Method: Compositional matrix adjust. Identities = 56/56 (100%), Positives = 56/56 (100%) Query: 1 MDYPCNKEYFKTISTVFGKLGDMRAQNIFLKDIKDKDIIFYLHILIAFEKVIDYLL 56 MDYPCNKEYFKTISTVFGKLGDMRAQNIFLKDIKDKDIIFYLHILIAFEKVIDYLL Sbjct: 1 MDYPCNKEYFKTISTVFGKLGDMRAQNIFLKDIKDKDIIFYLHILIAFEKVIDYLL 56 >gi|254780193|ref|YP_003064606.1| lipid A ABC exporter family, fused ATPase and inner membrane subunits [Candidatus Liberibacter asiaticus str. psy62] Length = 528 Score = 21.6 bits (44), Expect = 2.6, Method: Composition-based stats. Identities = 9/21 (42%), Positives = 13/21 (61%) Query: 30 LKDIKDKDIIFYLHILIAFEK 50 L I+D D++F LH + EK Sbjct: 485 LSAIQDADMVFVLHDQVIVEK 505 >gi|254781017|ref|YP_003065430.1| GHMP kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 324 Score = 20.4 bits (41), Expect = 5.8, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 18/34 (52%) Query: 1 MDYPCNKEYFKTISTVFGKLGDMRAQNIFLKDIK 34 ++YP E + I + GKL + Q + K++K Sbjct: 201 IEYPEINEINQKIYALMGKLSQISCQALRNKNLK 234 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.331 0.150 0.447 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,298 Number of Sequences: 1233 Number of extensions: 1171 Number of successful extensions: 3 Number of sequences better than 100.0: 3 Number of HSP's better than 100.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 56 length of database: 328,796 effective HSP length: 28 effective length of query: 28 effective length of database: 294,272 effective search space: 8239616 effective search space used: 8239616 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 31 (16.5 bits)