Query         gi|254780932|ref|YP_003065345.1| hypothetical protein CLIBASIA_04155 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 236
No_of_seqs    221 out of 390
Neff          9.6 
Searched_HMMs 33803
Date          Wed Jun  1 19:08:40 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780932.hhm -d /home/congqian_1/database/mmdb/mmdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 >2zxl_A RED chlorophyll catabo  74.1       2   6E-05   23.6   2.2   27  186-212   193-223 (229)
  2 >1lj8_A Mannitol dehydrogenase  56.6     1.7   5E-05   24.2  -1.0   45  187-231   192-246 (287)
  3 >1au7_A Protein PIT-1, GHF-1;   51.7       7 0.00021   19.8   1.5   40  171-212    22-69  (82)
  4 >3d1n_I POU domain, class 6, t  51.5     7.1 0.00021   19.8   1.5   40  171-212    23-70  (94)
  5 >2v8q_E 5'-AMP-activated prote  50.5     1.6 4.8E-05   24.3  -1.9   25  206-230    32-56  (70)
  6 >1e3o_C Octamer-binding transc  48.7     8.3 0.00025   19.3   1.5   40  171-212    26-73  (91)
  7 >2np9_A DPGC; protein inhibito  45.3     6.8  0.0002   19.9   0.6   38  195-233   138-178 (233)
  8 >1kij_A DNA gyrase subunit B;   39.2      27 0.00078   15.7   5.1   40  192-231   124-166 (173)
  9 >1rz4_A Eukaryotic translation  37.4      27  0.0008   15.7   2.7   23  202-224    27-49  (71)
 10 >1u00_A HSC66, chaperone prote  37.0      29 0.00085   15.5   4.4   49  170-223    18-66  (72)
 11 >2in3_A Hypothetical protein;   33.5      23 0.00067   16.2   1.8   24  186-214    99-122 (125)
 12 >2dl6_A Chromodomain-helicase-  31.6      17 0.00051   17.1   0.9   22  187-217    32-53  (83)
 13 >2zuv_A Lacto-N-biose phosphor  31.2      31 0.00091   15.3   2.1   16  198-213    80-95  (326)
 14 >1dkx_A Substrate binding doma  29.2      38  0.0011   14.6   4.6   46  172-222    20-65  (84)
 15 >3h2z_A Mannitol-1-phosphate 5  29.1      12 0.00036   18.2  -0.2   34  188-221   124-160 (204)
 16 >2ckc_A Chromodomain-helicase-  28.6      21 0.00062   16.5   0.9   20  186-214    38-57  (80)
 17 >1n13_B PVLARGDC, pyruvoyl-dep  28.4      38  0.0011   14.6   2.2   32  179-210    52-83  (113)
 18 >3cwv_A DNA gyrase, B subunit,  28.3      39  0.0011   14.6   2.2   37  192-228   120-159 (163)
 19 >2kho_A Heat shock protein 70;  27.5      41  0.0012   14.4   4.4   48  170-222    18-65  (82)
 20 >1p94_A Plasmid partition prot  27.3      39  0.0011   14.6   2.1   21  189-213    55-75  (76)
 21 >2ewc_A Conserved hypothetical  26.7      19 0.00057   16.7   0.5   51  165-216    32-93  (126)
 22 >2r7d_A Ribonuclease II family  26.3      42  0.0013   14.3   2.3   16  221-236     9-24  (64)
 23 >3fau_A NEDD4-binding protein   26.2      33 0.00097   15.1   1.6   15  199-213    51-65  (82)
 24 >1ud0_A HSC70, 70 kDa heat-sho  26.0      43  0.0013   14.3   3.9   42  174-220    15-58  (113)
 25 >2cka_A Chromodomain-helicase-  25.7      25 0.00075   15.9   0.9   21  186-215    57-77  (95)
 26 >3gr0_A Protein PRGH; type III  25.6      22 0.00065   16.3   0.6   12  206-217     8-19  (71)
 27 >3gr1_A Protein PRGH; type III  25.5      22 0.00065   16.3   0.6   12  206-217     8-19  (71)
 28 >2v0f_A Chromodomain-helicase-  25.1      26 0.00078   15.8   0.9   19  187-214    31-49  (87)
 29 >2vcp_D N-WAsp, neural wiskott  25.0      33 0.00097   15.1   1.4   15    9-23     12-26  (93)
 30 >2nyc_A Nuclear protein SNF4;   24.6     7.7 0.00023   19.5  -1.9   25  206-230    20-44  (70)
 31 >2fkc_A R.HINP1I restriction e  24.1      41  0.0012   14.4   1.8   21  203-223   146-166 (247)
 32 >1w36_B RECB, exodeoxyribonucl  24.1      31 0.00093   15.2   1.1   12  203-214    23-34  (49)
 33 >2d9i_A NEDD4-binding protein   23.3      35   0.001   14.9   1.3   14  200-213    60-73  (96)
 34 >2h56_A DNA-3-methyladenine gl  23.0      45  0.0013   14.1   1.8   52  178-231     2-54  (77)
 35 >1jd1_A Hypothetical 13.9 kDa   22.6      21 0.00062   16.5  -0.0   52  164-216    42-104 (129)
 36 >2zqe_A MUTS2 protein; alpha/b  22.5      43  0.0013   14.2   1.6   13  201-213    46-58  (83)
 37 >2kfn_A Klenow fragment of DNA  22.3      50  0.0015   13.8   2.1   16  197-212     5-20  (63)
 38 >1ei1_A DNA gyrase B, GYRB; AT  21.4      52  0.0015   13.7   4.3   41  192-232   124-167 (173)
 39 >2vkc_A NEDD4-binding protein   21.4      45  0.0013   14.1   1.5   13  201-213   106-118 (135)
 40 >1s16_A Topoisomerase IV subun  21.4      52  0.0015   13.7   5.3   41  192-232   123-166 (173)
 41 >1sjj_A Actinin; 3-helix bundl  21.2      53  0.0016   13.6   3.2   43  170-216     1-43  (69)
 42 >1t3l_A Dihydropyridine-sensit  20.6      47  0.0014   14.0   1.5   14  222-235    74-87  (196)
 43 >2i3t_B Spindle assembly check  20.1      40  0.0012   14.5   1.0   15    9-23     26-40  (54)
 44 >2cwj_A Putative endonuclease;  20.0      16 0.00046   17.4  -1.1   50  166-216    36-96  (123)

No 1  
>>2zxl_A RED chlorophyll catabolite reductase, chloroplastic; alpha-beta-alpha sandwich, chlorophyll catabolism, coiled coil, NADP, oxidoreductase; 2.40A {Arabidopsis thaliana} PDB: 2zxk_A (A:1-229)
Probab=74.07  E-value=2  Score=23.60  Aligned_cols=27  Identities=26%  Similarity=0.615  Sum_probs=20.9

Q ss_pred             HCCCCCCCHHHHHHHHHHH----HHHHHHHH
Q ss_conf             3265653078999997379----99997661
Q gi|254780932|r  186 LRESESRSLDQLSLDVLRP----MLREWLDD  212 (236)
Q Consensus       186 ~~~~~~~tle~lv~emLrP----mLk~WLD~  212 (236)
                      +..+++.++|+||++.++|    ||+-|||.
T Consensus       193 i~~~~~~~leeIi~~~i~p~A~evl~~WLd~  223 (229)
T 2zxl_A          193 IDAEEEDKLEEILRDHVSPAAKEVLEVWLER  223 (229)
T ss_dssp             EECSCHHHHHHHHHHTHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             2666320188889887899999999999998


No 2  
>>1lj8_A Mannitol dehydrogenase; oxidoreductase, NAD, long-chain dehydrogenase; HET: NAD; 1.70A {Pseudomonas fluorescens} (A:1-287)
Probab=56.57  E-value=1.7  Score=24.15  Aligned_cols=45  Identities=11%  Similarity=0.250  Sum_probs=35.1

Q ss_pred             CCCCCCCHHHHHHHHH---HHHHHHHHHHHC---HHHHHHHH----HHHHHHHHC
Q ss_conf             2656530789999973---799999766103---57899999----999999960
Q gi|254780932|r  187 RESESRSLDQLSLDVL---RPMLREWLDDNL---PGIVERLV----REEIERIAR  231 (236)
Q Consensus       187 ~~~~~~tle~lv~emL---rPmLk~WLD~nL---P~lVErlV----r~EIerv~r  231 (236)
                      +.+|+.+|.++|.+++   -+-|++||++|-   =+||-|||    ++.++++..
T Consensus       192 ~~~NG~~Lk~~vl~~a~~~~~~~~~wi~~~v~FpnSmVDRIvP~~~~~~~~~~~~  246 (287)
T 1lj8_A          192 LPHNGAVTRKALLAFAALHNAELHDWIKAHVSFPNAXVDRITPXTSTAHRLQLHD  246 (287)
T ss_dssp             CTTHHHHHHHHHHHHHHHHCHHHHHHHHHHCCCCCEEEECCCCCCCHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCCHHHHCCCCCCCCHHHHHHHHH
T ss_conf             4450899999999999735867777775152064576242678998789999999


No 3  
>>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA); HET: DNA; 2.30A {Rattus norvegicus} (A:1-82)
Probab=51.70  E-value=7  Score=19.83  Aligned_cols=40  Identities=15%  Similarity=0.328  Sum_probs=21.3

Q ss_pred             HHHHHHHHHHHHHHHHCCCC--------CCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             67899987655556532656--------5307899999737999997661
Q gi|254780932|r  171 VGDQVASSFDQLVKALRESE--------SRSLDQLSLDVLRPMLREWLDD  212 (236)
Q Consensus       171 t~~~v~~~~~~l~~~~~~~~--------~~tle~lv~emLrPmLk~WLD~  212 (236)
                      |...|..+++.|-....++.        ..|+-.+.  =|||.|+.||++
T Consensus        22 TQ~dVG~al~~l~g~~~SQTtIcRFE~l~LS~kn~~--kLkPiL~kWL~e   69 (82)
T 1au7_A           22 TQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNAC--KLKAILSKWLEE   69 (82)
T ss_dssp             CHHHHHHHHHHTTSSCCCHHHHHHHHTTCSBHHHHH--HHHHHHHHHHHH
T ss_pred             CCCCHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHH--HHCHHHHHHHHH
T ss_conf             864677776641588655446676201588866676--504056767887


No 4  
>>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} (I:1-94)
Probab=51.46  E-value=7.1  Score=19.79  Aligned_cols=40  Identities=18%  Similarity=0.336  Sum_probs=20.5

Q ss_pred             HHHHHHHHHHHHHHHHCCCC--------CCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             67899987655556532656--------5307899999737999997661
Q gi|254780932|r  171 VGDQVASSFDQLVKALRESE--------SRSLDQLSLDVLRPMLREWLDD  212 (236)
Q Consensus       171 t~~~v~~~~~~l~~~~~~~~--------~~tle~lv~emLrPmLk~WLD~  212 (236)
                      |...|..+++.|-..+.++.        ..|+-.+.  =|||.|+.||.+
T Consensus        23 TQ~dVG~ALg~l~G~~fSQTtIcRFEaL~LS~KNm~--kLKPlL~kWL~e   70 (94)
T 3d1n_I           23 TQTQVGQAXTATEGPAYSQSAISRFEKLDITPKSAQ--KLKPVLEKWLNE   70 (94)
T ss_dssp             CHHHHHHHHSCSSSCCCCHHHHHHHHTTCSCHHHHH--HHHHHHHHHHHH
T ss_pred             CHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCHH--HHCCHHHHHHHH
T ss_conf             696899999733776356354655998853614598--838367666666


No 5  
>>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protein kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} (E:168-191,E:269-314)
Probab=50.47  E-value=1.6  Score=24.27  Aligned_cols=25  Identities=36%  Similarity=0.728  Sum_probs=20.3

Q ss_pred             HHHHHHHHCHHHHHHHHHHHHHHHH
Q ss_conf             9997661035789999999999996
Q gi|254780932|r  206 LREWLDDNLPGIVERLVREEIERIA  230 (236)
Q Consensus       206 Lk~WLD~nLP~lVErlVr~EIerv~  230 (236)
                      +|=.+++-|=+||+|+|++|+-|++
T Consensus        32 ~kC~~~EtL~tIidRiV~aeVHRLV   56 (70)
T 2v8q_E           32 LKCYLHETLEAIINRLVEAEVHRLV   56 (70)
T ss_dssp             CEECTTSBHHHHHHHHHHHTCSEEE
T ss_pred             EEECCCCCHHHHHHHHHHCCCCEEE
T ss_conf             6989949299999999975998899


No 6  
>>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} (C:1-91)
Probab=48.72  E-value=8.3  Score=19.30  Aligned_cols=40  Identities=25%  Similarity=0.467  Sum_probs=21.2

Q ss_pred             HHHHHHHHHHHHHHHHCCCC--------CCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             67899987655556532656--------5307899999737999997661
Q gi|254780932|r  171 VGDQVASSFDQLVKALRESE--------SRSLDQLSLDVLRPMLREWLDD  212 (236)
Q Consensus       171 t~~~v~~~~~~l~~~~~~~~--------~~tle~lv~emLrPmLk~WLD~  212 (236)
                      |...|..+++.|-....++.        ..|+-.+.  =|||.|+.||.+
T Consensus        26 TQ~dVG~al~~l~g~~fSQTtIcRFE~L~LS~knm~--kLkPlL~kWL~e   73 (91)
T 1e3o_C           26 TQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMS--KLKPLLEKWLND   73 (91)
T ss_dssp             CHHHHHHHHHHHHSCCCCHHHHHHHHHTCSCHHHHH--HHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHHCCCCCCHHHHHHHHHCCCCHHHHH--HHHHHHHHHHHH
T ss_conf             598999999953467521336417887344612178--889999999987


No 7  
>>2np9_A DPGC; protein inhibitor complex, oxidoreductase; HET: YE1; 2.45A {Streptomyces toyocaensis} PDB: 2pg8_A* (A:1-147,A:238-285,A:403-440)
Probab=45.28  E-value=6.8  Score=19.90  Aligned_cols=38  Identities=32%  Similarity=0.433  Sum_probs=28.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHCHHHHHHHHHHH---HHHHHCCC
Q ss_conf             8999997379999976610357899999999---99996032
Q gi|254780932|r  195 DQLSLDVLRPMLREWLDDNLPGIVERLVREE---IERIARGP  233 (236)
Q Consensus       195 e~lv~emLrPmLk~WLD~nLP~lVErlVr~E---Ierv~r~~  233 (236)
                      -.|...||||-||.-- .-.=.+|-=|.|+|   |-+|+||=
T Consensus       138 ~HLldsMLrPNLk~L~-~G~IS~vdFlLrRElGYi~KivRGl  178 (233)
T 2np9_A          138 PHLLDAMLRPNLKYLS-QGGISLVDFLMRRELGYIHKLVRGV  178 (233)
T ss_dssp             HHHHHHHHSCCHHHHH-TTCCCTTTTHHHHHHTHHHHHHHCE
T ss_pred             HHHHHHCCCCCHHHHH-HCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             2488752489899896-2677642156666667888888877


No 8  
>>1kij_A DNA gyrase subunit B; topoisomerase, gyrase B-coumarin complex; HET: DNA NOV; 2.30A {Thermus thermophilus} (A:218-390)
Probab=39.24  E-value=27  Score=15.74  Aligned_cols=40  Identities=23%  Similarity=0.199  Sum_probs=30.5

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHC---HHHHHHHHHHHHHHHHC
Q ss_conf             30789999973799999766103---57899999999999960
Q gi|254780932|r  192 RSLDQLSLDVLRPMLREWLDDNL---PGIVERLVREEIERIAR  231 (236)
Q Consensus       192 ~tle~lv~emLrPmLk~WLD~nL---P~lVErlVr~EIerv~r  231 (236)
                      .-+-.+|..+++-.|..||..|-   =.|++++++.-=.|.+.
T Consensus       124 ~~~~~~v~~~v~~~l~~~l~~n~~~a~~I~~k~~~~a~~R~~~  166 (173)
T 1kij_A          124 PEAGTAVGQVVYERLLEILEENPRIAKAVYEKALRAAQAREAA  166 (173)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             5478899999999999999979799999999999999999999


No 9  
>>1rz4_A Eukaryotic translation initiation factor 3 subunit 11; heat analogous motif, winged-helix, biosynthetic protein; 2.10A {Homo sapiens} (A:128-198)
Probab=37.42  E-value=27  Score=15.68  Aligned_cols=23  Identities=22%  Similarity=0.122  Sum_probs=18.5

Q ss_pred             HHHHHHHHHHHHCHHHHHHHHHH
Q ss_conf             37999997661035789999999
Q gi|254780932|r  202 LRPMLREWLDDNLPGIVERLVRE  224 (236)
Q Consensus       202 LrPmLk~WLD~nLP~lVErlVr~  224 (236)
                      =|-+|.+||+.++-.-++..|++
T Consensus        27 ~~~~L~~~Lg~~~d~~l~~~v~~   49 (71)
T 1rz4_A           27 DRWLLAEXLGDLSDSQLKVWXSK   49 (71)
T ss_dssp             CHHHHHHHTTSCCHHHHHHHHHH
T ss_pred             CHHHHHHHHCCCCHHHHHHHHHH
T ss_conf             99999998689998999999998


No 10 
>>1u00_A HSC66, chaperone protein HSCA; DNAK, HSP70; 1.95A {Escherichia coli} (A:133-204)
Probab=37.05  E-value=29  Score=15.51  Aligned_cols=49  Identities=14%  Similarity=0.203  Sum_probs=34.6

Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHCHHHHHHHHH
Q ss_conf             567899987655556532656530789999973799999766103578999999
Q gi|254780932|r  170 DVGDQVASSFDQLVKALRESESRSLDQLSLDVLRPMLREWLDDNLPGIVERLVR  223 (236)
Q Consensus       170 ~t~~~v~~~~~~l~~~~~~~~~~tle~lv~emLrPmLk~WLD~nLP~lVErlVr  223 (236)
                      ....++.+++.++...+.......++.++.+     |+.||+.|=..-++..+.
T Consensus        18 ~~i~~~e~~L~e~~~~l~~~ek~~i~~~i~e-----l~~~l~~~d~~~i~~~~~   66 (72)
T 1u00_A           18 RVLESLHGALAADAALLSAAERQVIDDAAAH-----LSEVAQGDDVDAIEQAIK   66 (72)
T ss_dssp             HHHHHHHHHHHHHGGGSCHHHHHHHHHHHHH-----HHHHTTSSCHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHCCHHHHHHHHHHHHH-----HHHHHHCCCHHHHHHHHH
T ss_conf             4423123335544200238899999999999-----999874788999999999


No 11 
>>2in3_A Hypothetical protein; DSBA family, FRNE-like subfamily, disulfide isomerase, structural genomics, PSI-2, protein structure initiative; 1.85A {Nitrosomonas europaea} (A:1-84,A:176-216)
Probab=33.49  E-value=23  Score=16.22  Aligned_cols=24  Identities=29%  Similarity=0.594  Sum_probs=17.7

Q ss_pred             HCCCCCCCHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             32656530789999973799999766103
Q gi|254780932|r  186 LRESESRSLDQLSLDVLRPMLREWLDDNL  214 (236)
Q Consensus       186 ~~~~~~~tle~lv~emLrPmLk~WLD~nL  214 (236)
                      ++.|+-+-|+     -|+|.|--||.+|-
T Consensus        99 ~~~~~~~~~~-----~~~~~~~~~~~~~~  122 (125)
T 2in3_A           99 LITTGYRPIE-----ALRQLLDTWLQQHG  122 (125)
T ss_dssp             EEESSCCCHH-----HHHHHHHHHHHHCC
T ss_pred             EECCCCCCHH-----HHHHHHHHHHHHCC
T ss_conf             7457998999-----99999999998537


No 12 
>>2dl6_A Chromodomain-helicase-DNA-binding protein 8; BRK, CHD8, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} (A:)
Probab=31.59  E-value=17  Score=17.05  Aligned_cols=22  Identities=14%  Similarity=0.203  Sum_probs=13.0

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHCHHH
Q ss_conf             2656530789999973799999766103578
Q gi|254780932|r  187 RESESRSLDQLSLDVLRPMLREWLDDNLPGI  217 (236)
Q Consensus       187 ~~~~~~tle~lv~emLrPmLk~WLD~nLP~l  217 (236)
                      .|..+..+.+         |.+||.+|==+-
T Consensus        32 ~G~~AP~~k~---------L~~WL~~hP~y~   53 (83)
T 2dl6_A           32 VGEDAPRRAE---------LEMWLQGHPEFA   53 (83)
T ss_dssp             CGGGSCBSTT---------HHHHHHHCTTSC
T ss_pred             CCCCCCCHHH---------HHHHHHHCCCCE
T ss_conf             4666867779---------999999885957


No 13 
>>2zuv_A Lacto-N-biose phosphorylase; beta-alpha-barrel, TIM barrel, glycosyltransferase, transferase; HET: NDG; 1.85A {Bifidobacterium longum} PDB: 2zus_A* 2zuu_A* 2zut_A* 2zuw_A* (A:1-70,A:179-434)
Probab=31.20  E-value=31  Score=15.30  Aligned_cols=16  Identities=19%  Similarity=0.534  Sum_probs=10.7

Q ss_pred             HHHHHHHHHHHHHHHH
Q ss_conf             9997379999976610
Q gi|254780932|r  198 SLDVLRPMLREWLDDN  213 (236)
Q Consensus       198 v~emLrPmLk~WLD~n  213 (236)
                      +++-|+=.|+.|||.|
T Consensus        80 t~~yl~~~l~kwLd~~   95 (326)
T 2zuv_A           80 TRKFVFDTFEQWLKDS   95 (326)
T ss_dssp             HHHHHHHHHHHHHHTC
T ss_pred             HHHHHHHHHHHHHHHC
T ss_conf             7999999999999868


No 14 
>>1dkx_A Substrate binding domain of DNAK; DNAK, heat shock protein 70 kDa (HSP70), complex (molecular chaperone/peptide); 2.00A {Escherichia coli} (A:136-219)
Probab=29.21  E-value=38  Score=14.65  Aligned_cols=46  Identities=9%  Similarity=0.082  Sum_probs=30.6

Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHCHHHHHHHH
Q ss_conf             789998765555653265653078999997379999976610357899999
Q gi|254780932|r  172 GDQVASSFDQLVKALRESESRSLDQLSLDVLRPMLREWLDDNLPGIVERLV  222 (236)
Q Consensus       172 ~~~v~~~~~~l~~~~~~~~~~tle~lv~emLrPmLk~WLD~nLP~lVErlV  222 (236)
                      .-++.+.+.++...+......+|+..+.+     |++||+.|=...++...
T Consensus        20 iy~~e~~L~e~~~~l~~~~k~~i~~~i~e-----l~~~l~~~d~~~i~~~~   65 (84)
T 1dkx_A           20 LHSTRKQVEEAGDKLPADDKTAIESALTA-----LETALKGEDKAAIEAKM   65 (84)
T ss_dssp             HHHHHHHHHHHGGGSCHHHHHHHHHHHHH-----HHHHHTSSCHHHHHHHH
T ss_pred             HHHHHHHHHHHCCCCCHHHHHHHHHHHHH-----HHHHHHCCCHHHHHHHH
T ss_conf             57776666641211116689999999999-----99988659999999999


No 15 
>>3h2z_A Mannitol-1-phosphate 5-dehydrogenase; PSI-2, protein structure initiative, structural genomics; 1.90A {Shigella flexneri 2a str} (A:1-204)
Probab=29.09  E-value=12  Score=18.15  Aligned_cols=34  Identities=15%  Similarity=0.388  Sum_probs=26.4

Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHC---HHHHHHH
Q ss_conf             656530789999973799999766103---5789999
Q gi|254780932|r  188 ESESRSLDQLSLDVLRPMLREWLDDNL---PGIVERL  221 (236)
Q Consensus       188 ~~~~~tle~lv~emLrPmLk~WLD~nL---P~lVErl  221 (236)
                      .+++..|...|.+.+=+.+++||++|-   -+||-|+
T Consensus       124 ~~ng~~lk~~v~~~~~~~~~~wi~~~v~Fp~t~VDRI  160 (204)
T 3h2z_A          124 VRGTTQLKGHVXNALPEDAKAWVEEHVGFVDSAVDRI  160 (204)
T ss_dssp             TTHHHHHHHHHHTTSCGGGHHHHHHHEEEECEEEECC
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHCEECCCCCCCCC
T ss_conf             0106899999998500779999984623654213445


No 16 
>>2ckc_A Chromodomain-helicase-DNA-binding protein 7; protein-protein interaction, phosphorylation, disease mutation, nucleotide-binding; NMR {Homo sapiens} (A:)
Probab=28.61  E-value=21  Score=16.48  Aligned_cols=20  Identities=25%  Similarity=0.368  Sum_probs=14.5

Q ss_pred             HCCCCCCCHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             32656530789999973799999766103
Q gi|254780932|r  186 LRESESRSLDQLSLDVLRPMLREWLDDNL  214 (236)
Q Consensus       186 ~~~~~~~tle~lv~emLrPmLk~WLD~nL  214 (236)
                      +.|..+.++.+         |..||+.|=
T Consensus        38 L~G~~AP~~~~---------L~~WL~~hP   57 (80)
T 2ckc_A           38 LVGEDAPKNKD---------LVEWLKLHP   57 (80)
T ss_dssp             ECTTSSCBHHH---------HHHHHHHCT
T ss_pred             CCCCCCCCHHH---------HHHHHHHCC
T ss_conf             56777977779---------999999896


No 17 
>>1n13_B PVLARGDC, pyruvoyl-dependent arginine decarboxylase alpha chain; pyruvoyl group, pyruvate, agmatine, lyase; 1.40A {Methanocaldococcus jannaschii} (B:)
Probab=28.42  E-value=38  Score=14.62  Aligned_cols=32  Identities=0%  Similarity=-0.055  Sum_probs=21.8

Q ss_pred             HHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             65555653265653078999997379999976
Q gi|254780932|r  179 FDQLVKALRESESRSLDQLSLDVLRPMLREWL  210 (236)
Q Consensus       179 ~~~l~~~~~~~~~~tle~lv~emLrPmLk~WL  210 (236)
                      |+-+...--.++....|++++.||+=||..|=
T Consensus        52 ~Gyi~E~~g~~~~e~ae~~a~~Ml~~~~e~rg   83 (113)
T 1n13_B           52 CGLIMEYEGKCSKKEAEKTVREMAKIGFEMRG   83 (113)
T ss_dssp             CBEEEEEEESSCHHHHHHHHHHHHHHHHHHHT
T ss_pred             CEEEEEECCCCCHHHHHHHHHHHHHHHHHHCC
T ss_conf             47999743789779999999999999998728


No 18 
>>3cwv_A DNA gyrase, B subunit, truncated; structural genomics, unknown function, ATP-binding, isomerase, nucleotide-binding, topoisomerase; HET: DNA; 1.95A {Myxococcus xanthus dk 1622} (A:207-369)
Probab=28.26  E-value=39  Score=14.59  Aligned_cols=37  Identities=19%  Similarity=0.239  Sum_probs=25.6

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHC---HHHHHHHHHHHHHH
Q ss_conf             30789999973799999766103---57899999999999
Q gi|254780932|r  192 RSLDQLSLDVLRPMLREWLDDNL---PGIVERLVREEIER  228 (236)
Q Consensus       192 ~tle~lv~emLrPmLk~WLD~nL---P~lVErlVr~EIer  228 (236)
                      ..+..+|...++-.|..||.+|-   =.|+++++...=.|
T Consensus       120 ~~~~~~v~~~v~~~l~~~l~~n~~~a~~I~~k~~~~~~~R  159 (163)
T 3cwv_A          120 PGLEEAIRKQLQPLFIELLREHPVTPALLARRTSGSEGHH  159 (163)
T ss_dssp             TTHHHHHHHHHHHHHHHHHHTCTTHHHHHTTC--------
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHCCCCC
T ss_conf             8899999999999999999979799999999998666765


No 19 
>>2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} (A:524-605)
Probab=27.47  E-value=41  Score=14.44  Aligned_cols=48  Identities=8%  Similarity=0.094  Sum_probs=32.4

Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHCHHHHHHHH
Q ss_conf             56789998765555653265653078999997379999976610357899999
Q gi|254780932|r  170 DVGDQVASSFDQLVKALRESESRSLDQLSLDVLRPMLREWLDDNLPGIVERLV  222 (236)
Q Consensus       170 ~t~~~v~~~~~~l~~~~~~~~~~tle~lv~emLrPmLk~WLD~nLP~lVErlV  222 (236)
                      ...-++.++..++...+.......|+..+.+     |++||+.|=-.-++...
T Consensus        18 ~~i~~~e~~L~e~~~~l~~~ek~~i~~~i~~-----~~~~l~~~d~~~i~~k~   65 (82)
T 2kho_A           18 HLLHSTRKQVEEAGDKLPADDKTAIESALTA-----LETALKGEDKAAIEAKM   65 (82)
T ss_dssp             HHHHHHHHHHHHHGGGSCHHHHHHHHHHHHH-----HHHHTTSSCHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHCCHHHHHHHHHHHHH-----HHHHHHCCCHHHHHHHH
T ss_conf             9999999999974522999999999999999-----99988638999999999


No 20 
>>1p94_A Plasmid partition protein PArg; ribbon-helix-helix, dimer, DNA binding, cell cycle; NMR {Salmonella enterica} (A:)
Probab=27.31  E-value=39  Score=14.59  Aligned_cols=21  Identities=19%  Similarity=0.560  Sum_probs=16.0

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             5653078999997379999976610
Q gi|254780932|r  189 SESRSLDQLSLDVLRPMLREWLDDN  213 (236)
Q Consensus       189 ~~~~tle~lv~emLrPmLk~WLD~n  213 (236)
                      .++.++-|+..++    +..||.+|
T Consensus        55 ~~g~sitdVi~~L----vd~WL~en   75 (76)
T 1p94_A           55 RKGTSITDVVNQL----VDNWLKEN   75 (76)
T ss_dssp             HHTCCHHHHHHHH----HHHHHHHC
T ss_pred             HCCCCHHHHHHHH----HHHHHHCC
T ss_conf             8588499999999----99988626


No 21 
>>2ewc_A Conserved hypothetical protein; YJGF proteins family, COG0251, putative translation initiation inhibitor, structural genomics, PSI; 2.15A {Streptococcus pyogenes m1 gas} (A:)
Probab=26.68  E-value=19  Score=16.71  Aligned_cols=51  Identities=22%  Similarity=0.389  Sum_probs=37.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHH-----------HHHHHHHHHHHHHHCHH
Q ss_conf             12235567899987655556532656530789999-----------97379999976610357
Q gi|254780932|r  165 ALVSSDVGDQVASSFDQLVKALRESESRSLDQLSL-----------DVLRPMLREWLDDNLPG  216 (236)
Q Consensus       165 ~l~S~~t~~~v~~~~~~l~~~~~~~~~~tle~lv~-----------emLrPmLk~WLD~nLP~  216 (236)
                      .+.......|+..+|.++...+... +-+++++|+           +-++-.+++|+.+|.|.
T Consensus        32 ~~d~~d~~~Q~~~~l~ni~~~L~~a-g~~~~dvv~~~~yl~d~~~~~~~~~~~~~~f~~~~Pa   93 (126)
T 2ewc_A           32 GNVGQDIESQINGAFDEXERRLALV-GLTLDAVVQXDCLFRDVWNIPVXEKXIKERFNGRYPA   93 (126)
T ss_dssp             CSTTSCHHHHHHHHHHHHHHHHHTT-TCCGGGEEEEEEEESSGGGHHHHHHHHHHHSTTCCCE
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHH-CCCHHHHEEEEEEECCHHHHHHHHHHHHHHCCCCCCC
T ss_conf             2358899999999999999999981-5686571599999826289898878999858999999


No 22 
>>2r7d_A Ribonuclease II family protein; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.80A {Deinococcus radiodurans R1} (A:1-64)
Probab=26.34  E-value=42  Score=14.31  Aligned_cols=16  Identities=38%  Similarity=0.524  Sum_probs=11.4

Q ss_pred             HHHHHHHHHHCCCCCC
Q ss_conf             9999999996032469
Q gi|254780932|r  221 LVREEIERIARGPIRH  236 (236)
Q Consensus       221 lVr~EIerv~r~~~r~  236 (236)
                      +-+.|||.+|+|-+-|
T Consensus         9 ~~l~EIEalAlg~s~~   24 (64)
T 2r7d_A            9 AQRTEVELLARGRADK   24 (64)
T ss_dssp             HHHHHHHHHHTTSCSC
T ss_pred             CCEEEEEEHHCCCCCC
T ss_conf             8889999911089997


No 23 
>>3fau_A NEDD4-binding protein 2; SMR, small-MUTS related domain, nicking endonuclease, alternative splicing, ATP-binding, coiled coil, cytoplasm, hydrolase; 1.90A {Homo sapiens} (A:)
Probab=26.21  E-value=33  Score=15.11  Aligned_cols=15  Identities=13%  Similarity=0.412  Sum_probs=12.1

Q ss_pred             HHHHHHHHHHHHHHH
Q ss_conf             997379999976610
Q gi|254780932|r  199 LDVLRPMLREWLDDN  213 (236)
Q Consensus       199 ~emLrPmLk~WLD~n  213 (236)
                      .-.||+.++.||.+|
T Consensus        51 ~~~lk~~V~~~L~~~   65 (82)
T 3fau_A           51 VARIKPAVIKYLISH   65 (82)
T ss_dssp             --CHHHHHHHHHHHT
T ss_pred             CCHHHHHHHHHHHHC
T ss_conf             640899999999868


No 24 
>>1ud0_A HSC70, 70 kDa heat-shock-like protein; chaperone; 3.45A {Rattus norvegicus} (A:)
Probab=25.97  E-value=43  Score=14.26  Aligned_cols=42  Identities=14%  Similarity=0.333  Sum_probs=24.4

Q ss_pred             HHHHHHHH--HHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHCHHHHHH
Q ss_conf             99987655--556532656530789999973799999766103578999
Q gi|254780932|r  174 QVASSFDQ--LVKALRESESRSLDQLSLDVLRPMLREWLDDNLPGIVER  220 (236)
Q Consensus       174 ~v~~~~~~--l~~~~~~~~~~tle~lv~emLrPmLk~WLD~nLP~lVEr  220 (236)
                      ++...+.+  +...+.......|+..+.+     |++||+.|=-.-++.
T Consensus        15 ~~~~~l~d~~~~~ki~~~ek~~i~~~i~~-----~~~wL~~~~~a~~e~   58 (113)
T 1ud0_A           15 NXKATVEDEKLQGKINDEDKQKILDKCNE-----IISWLDKNQTAEKEE   58 (113)
T ss_dssp             HHHHHHTSGGGTTTSCHHHHHHHHHHHHH-----HHHHHHHHHHHHHHH
T ss_pred             HHHHHHCCHHHCCCCCHHHHHHHHHHHHH-----HHHHHHCCCCCCHHH
T ss_conf             99997512411233789999999999999-----999986587432999


No 25 
>>2cka_A Chromodomain-helicase-DNA-binding protein 8; BRK domain, transcription elongation, chromatin remodeling, protein-protein interaction, transcription; NMR {Homo sapiens} (A:)
Probab=25.66  E-value=25  Score=15.88  Aligned_cols=21  Identities=19%  Similarity=0.371  Sum_probs=15.0

Q ss_pred             HCCCCCCCHHHHHHHHHHHHHHHHHHHHCH
Q ss_conf             326565307899999737999997661035
Q gi|254780932|r  186 LRESESRSLDQLSLDVLRPMLREWLDDNLP  215 (236)
Q Consensus       186 ~~~~~~~tle~lv~emLrPmLk~WLD~nLP  215 (236)
                      +.|..+.++.+         |..||+.|==
T Consensus        57 l~G~~AP~~~~---------L~~WL~~hP~   77 (95)
T 2cka_A           57 LVGEDAPRRAE---------LEMWLQGHPE   77 (95)
T ss_dssp             ECTTSSCBHHH---------HHHHHHHCTT
T ss_pred             CCCCCCCCHHH---------HHHHHHHCCC
T ss_conf             45566967789---------9999998879


No 26 
>>3gr0_A Protein PRGH; type III secretion system, inner membrane protein, cell membrane, membrane, transmembrane, virulence; 2.30A {Salmonella typhimurium} (A:60-130)
Probab=25.55  E-value=22  Score=16.31  Aligned_cols=12  Identities=33%  Similarity=0.855  Sum_probs=8.0

Q ss_pred             HHHHHHHHCHHH
Q ss_conf             999766103578
Q gi|254780932|r  206 LREWLDDNLPGI  217 (236)
Q Consensus       206 Lk~WLD~nLP~l  217 (236)
                      +..||+.|-|.|
T Consensus         8 is~WL~~~~P~l   19 (71)
T 3gr0_A            8 ISIWLDTYYPQL   19 (71)
T ss_dssp             HHHHHHHHSTTC
T ss_pred             HHHHHHHCCCCC
T ss_conf             999998418986


No 27 
>>3gr1_A Protein PRGH; type III secretion system, inner membrane protein, cell membrane, membrane, transmembrane, virulence; 2.80A {Salmonella typhimurium} (A:60-130)
Probab=25.53  E-value=22  Score=16.31  Aligned_cols=12  Identities=33%  Similarity=0.855  Sum_probs=8.0

Q ss_pred             HHHHHHHHCHHH
Q ss_conf             999766103578
Q gi|254780932|r  206 LREWLDDNLPGI  217 (236)
Q Consensus       206 Lk~WLD~nLP~l  217 (236)
                      +..||+.|-|.|
T Consensus         8 is~WL~~~~P~l   19 (71)
T 3gr1_A            8 ISIWLDTYYPQL   19 (71)
T ss_dssp             HHHHHHHHCTTC
T ss_pred             HHHHHHHCCCCC
T ss_conf             999998428985


No 28 
>>2v0f_A Chromodomain-helicase-DNA-binding protein 7; nucleotide-binding, chromatin regulator, charge syndrome, phosphorylation, disease mutation; NMR {Homo sapiens} (A:)
Probab=25.07  E-value=26  Score=15.75  Aligned_cols=19  Identities=21%  Similarity=0.540  Sum_probs=12.8

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             2656530789999973799999766103
Q gi|254780932|r  187 RESESRSLDQLSLDVLRPMLREWLDDNL  214 (236)
Q Consensus       187 ~~~~~~tle~lv~emLrPmLk~WLD~nL  214 (236)
                      .|..+.++.+         |..||+.|=
T Consensus        31 ~G~~AP~~~~---------L~~WL~~hP   49 (87)
T 2v0f_A           31 GGAMAPPMKD---------LPRWLEENP   49 (87)
T ss_dssp             CSSSSCBGGG---------HHHHHHHCT
T ss_pred             CCCCCCCHHH---------HHHHHHHCC
T ss_conf             4555822778---------999999888


No 29 
>>2vcp_D N-WAsp, neural wiskott-aldrich syndrome protein; actin-binding, transcription, muscle protein, nucleotide-binding, transcription regulation; HET: HIC ATP; 3.2A {Homo sapiens} (D:)
Probab=25.02  E-value=33  Score=15.09  Aligned_cols=15  Identities=13%  Similarity=0.186  Sum_probs=9.6

Q ss_pred             CCCHHHHHHHHHHHH
Q ss_conf             887999998676762
Q gi|254780932|r    9 EPSMEEIVNSIRRIL   23 (236)
Q Consensus         9 EPSMeeILASIRRII   23 (236)
                      -..|+.||++||+-.
T Consensus        12 ~~~~~~lL~~Ir~G~   26 (93)
T 2vcp_D           12 AGNKAALLDQIREGA   26 (93)
T ss_pred             CCCHHHHHHHHHCCC
T ss_conf             888999999998289


No 30 
>>2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} (A:1-15,A:90-144)
Probab=24.65  E-value=7.7  Score=19.52  Aligned_cols=25  Identities=16%  Similarity=0.290  Sum_probs=18.9

Q ss_pred             HHHHHHHHCHHHHHHHHHHHHHHHH
Q ss_conf             9997661035789999999999996
Q gi|254780932|r  206 LREWLDDNLPGIVERLVREEIERIA  230 (236)
Q Consensus       206 Lk~WLD~nLP~lVErlVr~EIerv~  230 (236)
                      +|=.++++|=+++||||+.++-|++
T Consensus        20 ~~C~~sdtL~tVierlv~agVhRLV   44 (70)
T 2nyc_A           20 YTCTKNDKLSTIMDNIRKARVHRFF   44 (70)
T ss_dssp             CEECTTSBHHHHHHHHHHHTCSEEE
T ss_pred             EEECCCCCHHHHHHHHHHCCEEEEE
T ss_conf             8989999799999988862756999


No 31 
>>2fkc_A R.HINP1I restriction endonuclease; protein dimerizaton, DNA superhelix, protein-DNA-metal ION complex, hydrolase/DNA complex; 2.39A {Haemophilus influenzae} PDB: 1ynm_A 2fkh_B 2fl3_A 2flc_A (A:)
Probab=24.13  E-value=41  Score=14.39  Aligned_cols=21  Identities=19%  Similarity=0.544  Sum_probs=17.3

Q ss_pred             HHHHHHHHHHHCHHHHHHHHH
Q ss_conf             799999766103578999999
Q gi|254780932|r  203 RPMLREWLDDNLPGIVERLVR  223 (236)
Q Consensus       203 rPmLk~WLD~nLP~lVErlVr  223 (236)
                      +=.|..|+.+|++-+++.+.|
T Consensus       146 q~~iln~f~~Nkilvl~DI~r  166 (247)
T 2fkc_A          146 QNIVLNWLEKNRVLVLTDILR  166 (247)
T ss_dssp             HHHHHHHHHHTHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
T ss_conf             999999999727999999982


No 32 
>>1w36_B RECB, exodeoxyribonuclease V beta chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} (B:965-1013)
Probab=24.12  E-value=31  Score=15.24  Aligned_cols=12  Identities=42%  Similarity=0.985  Sum_probs=9.5

Q ss_pred             HHHHHHHHHHHC
Q ss_conf             799999766103
Q gi|254780932|r  203 RPMLREWLDDNL  214 (236)
Q Consensus       203 rPmLk~WLD~nL  214 (236)
                      -|||+.|+++=|
T Consensus        23 ~pvL~qWi~~VL   34 (49)
T 1w36_B           23 EPVLTEWITAVL   34 (49)
T ss_dssp             HHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHH
T ss_conf             699999999998


No 33 
>>2d9i_A NEDD4-binding protein 2; SMR domain, N4BP2, BCL-3 binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} (A:)
Probab=23.34  E-value=35  Score=14.85  Aligned_cols=14  Identities=14%  Similarity=0.399  Sum_probs=11.3

Q ss_pred             HHHHHHHHHHHHHH
Q ss_conf             97379999976610
Q gi|254780932|r  200 DVLRPMLREWLDDN  213 (236)
Q Consensus       200 emLrPmLk~WLD~n  213 (236)
                      -.||+.++.||.+|
T Consensus        60 ~~lk~~V~~~L~~~   73 (96)
T 2d9i_A           60 ARIKPAVIKYLISH   73 (96)
T ss_dssp             TCHHHHHHHHHHHT
T ss_pred             CHHHHHHHHHHHHC
T ss_conf             42999999999868


No 34 
>>2h56_A DNA-3-methyladenine glycosidase; 10174367, EC 3.2.2.-, structural genomics, PSI-2, protein structure initiative; 2.55A {Bacillus halodurans} (A:50-126)
Probab=22.97  E-value=45  Score=14.13  Aligned_cols=52  Identities=13%  Similarity=0.106  Sum_probs=37.2

Q ss_pred             HHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHH-HHCHHHHHHHHHHHHHHHHC
Q ss_conf             7655556532656530789999973799999766-10357899999999999960
Q gi|254780932|r  178 SFDQLVKALRESESRSLDQLSLDVLRPMLREWLD-DNLPGIVERLVREEIERIAR  231 (236)
Q Consensus       178 ~~~~l~~~~~~~~~~tle~lv~emLrPmLk~WLD-~nLP~lVErlVr~EIerv~r  231 (236)
                      .|..|..++++++  |-...+..+++-+.+-|.+ ..++......+.+.|..+--
T Consensus         2 pf~~Li~~Ilsqq--ts~~~a~~~~~rl~~~~~~~~~~~~~~~~~~~~~ir~~G~   54 (77)
T 2h56_A            2 PFQSLVSSIVEQQ--LSIKAASAIYGRVEQLVGGALEKPEQLYRVSDEALRQAGV   54 (77)
T ss_dssp             HHHHHHHHHHHTT--SCHHHHHHHHHHHHHHHTSCCCCTHHHHTSCHHHHHHTTC
T ss_pred             HHHHHHHHHHHCC--CCHHHHHHHHHHHHHHHHCCCCCHHHHHHCCHHHHHHHHH
T ss_conf             8999999998170--0399999999999998600236889986379999877764


No 35 
>>1jd1_A Hypothetical 13.9 kDa protein in FCY2-PET117 intergenic region; translation inhibitor, structural genomics, PSI; 1.70A {Saccharomyces cerevisiae} (A:)
Probab=22.55  E-value=21  Score=16.47  Aligned_cols=52  Identities=17%  Similarity=0.381  Sum_probs=37.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHH-----------HHHHHHHHHHHHHHCHH
Q ss_conf             112235567899987655556532656530789999-----------97379999976610357
Q gi|254780932|r  164 EALVSSDVGDQVASSFDQLVKALRESESRSLDQLSL-----------DVLRPMLREWLDDNLPG  216 (236)
Q Consensus       164 ~~l~S~~t~~~v~~~~~~l~~~~~~~~~~tle~lv~-----------emLrPmLk~WLD~nLP~  216 (236)
                      ...++.....|+..+|+++...+... +.+++++|+           +.+.-.+++|+++|.|.
T Consensus        42 ~~~~~~~~~~Q~~~~~~ni~~~L~~a-g~~~~~vv~~~~y~~d~~~~~~~~~v~~~~f~~~~Pa  104 (129)
T 1jd1_A           42 NKLVEGSIADKAEQVIQNIKNVLEAS-NSSLDRVVKVNIFLADINHFAEFNSVYAKYFNTHKPA  104 (129)
T ss_dssp             SCBCCSCHHHHHHHHHHHHHHHHHHT-TCCGGGEEEEEEEESCGGGHHHHHHHHHHHSSSSCCE
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHC-CCCHHHEEEEEEEECCHHHHHHHHHHHHHHCCCCCCC
T ss_conf             41347858998999999999999981-9997996999999686550999999999986999994


No 36 
>>2zqe_A MUTS2 protein; alpha/beta, ATP-binding, DNA-binding, nucleotide-binding, DNA binding protein; 1.70A {Thermus thermophilus HB8} (A:)
Probab=22.48  E-value=43  Score=14.24  Aligned_cols=13  Identities=38%  Similarity=0.539  Sum_probs=10.4

Q ss_pred             HHHHHHHHHHHHH
Q ss_conf             7379999976610
Q gi|254780932|r  201 VLRPMLREWLDDN  213 (236)
Q Consensus       201 mLrPmLk~WLD~n  213 (236)
                      .||.++.+||.+|
T Consensus        46 vLk~~v~~~L~~~   58 (83)
T 2zqe_A           46 ALRQAIREALRRD   58 (83)
T ss_dssp             HHHHHHHHHHHHC
T ss_pred             HHHHHHHHHHHCC
T ss_conf             9999999999659


No 37 
>>2kfn_A Klenow fragment of DNA polymerase I; complex (polymerase/DNA), exonuclease, transferase, transferase/DNA complex; HET: US1; 2.03A {Escherichia coli} (A:386-396,A:473-524)
Probab=22.30  E-value=50  Score=13.79  Aligned_cols=16  Identities=19%  Similarity=0.451  Sum_probs=13.4

Q ss_pred             HHHHHHHHHHHHHHHH
Q ss_conf             9999737999997661
Q gi|254780932|r  197 LSLDVLRPMLREWLDD  212 (236)
Q Consensus       197 lv~emLrPmLk~WLD~  212 (236)
                      |..-+-||-+|+|+|.
T Consensus         5 ~~~~~~~P~Vk~~~~~   20 (63)
T 2kfn_A            5 IMAHLSRPGVLEYMER   20 (63)
T ss_dssp             HHHHHTTHHHHHHHHH
T ss_pred             HEEEEECCCHHHHHHH
T ss_conf             2343403508789999


No 38 
>>1ei1_A DNA gyrase B, GYRB; ATPase domain, dimer, isomerase; HET: DNA ANP; 2.30A {Escherichia coli} (A:219-391)
Probab=21.41  E-value=52  Score=13.67  Aligned_cols=41  Identities=17%  Similarity=0.221  Sum_probs=30.8

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHC---HHHHHHHHHHHHHHHHCC
Q ss_conf             30789999973799999766103---578999999999999603
Q gi|254780932|r  192 RSLDQLSLDVLRPMLREWLDDNL---PGIVERLVREEIERIARG  232 (236)
Q Consensus       192 ~tle~lv~emLrPmLk~WLD~nL---P~lVErlVr~EIerv~r~  232 (236)
                      ..+-.+|...++..|..||.+|-   =.|+++++...=.|.+..
T Consensus       124 ~~~~~~v~~~v~~~l~~~l~~n~~~a~~I~~k~l~~a~~R~~~k  167 (173)
T 1ei1_A          124 SEVKSAVEQQMNELLAEYLLENPTDAKIVVGKIIDAARAREAAR  167 (173)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             77888999999999999999797999999999999999999999


No 39 
>>2vkc_A NEDD4-binding protein 2; human BCL3 binding protein, alternative splicing, homologous recombination, mismatch repair, small MUTS related; NMR {Homo sapiens} (A:)
Probab=21.38  E-value=45  Score=14.14  Aligned_cols=13  Identities=15%  Similarity=0.437  Sum_probs=9.2

Q ss_pred             HHHHHHHHHHHHH
Q ss_conf             7379999976610
Q gi|254780932|r  201 VLRPMLREWLDDN  213 (236)
Q Consensus       201 mLrPmLk~WLD~n  213 (236)
                      .||+.+.+||.+|
T Consensus       106 ~Lk~~V~~~L~~~  118 (135)
T 2vkc_A          106 RIKPAVIKYLISH  118 (135)
T ss_dssp             THHHHHHHHHHTT
T ss_pred             CCHHHHHHHHHHC
T ss_conf             2399999999878


No 40 
>>1s16_A Topoisomerase IV subunit B; two-domain protein complexed with ADPNP; HET: ANP; 2.10A {Escherichia coli} (A:218-390)
Probab=21.38  E-value=52  Score=13.66  Aligned_cols=41  Identities=17%  Similarity=0.318  Sum_probs=30.7

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHC---HHHHHHHHHHHHHHHHCC
Q ss_conf             30789999973799999766103---578999999999999603
Q gi|254780932|r  192 RSLDQLSLDVLRPMLREWLDDNL---PGIVERLVREEIERIARG  232 (236)
Q Consensus       192 ~tle~lv~emLrPmLk~WLD~nL---P~lVErlVr~EIerv~r~  232 (236)
                      ..+-.+|...++--|..||.+|-   =.||++++++.=+|.-+.
T Consensus       123 ~~~~~~v~~~v~~~l~~~l~~np~~a~~I~~k~~~~ar~~~~ka  166 (173)
T 1s16_A          123 RQCAAFVSGVVKDAFILWLNQNVQAAELLAEMAISSAQRRMRAA  166 (173)
T ss_dssp             THHHHHHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             76888999999999999998797999999999999999999976


No 41 
>>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} (A:795-863)
Probab=21.20  E-value=53  Score=13.64  Aligned_cols=43  Identities=26%  Similarity=0.362  Sum_probs=30.7

Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHCHH
Q ss_conf             56789998765555653265653078999997379999976610357
Q gi|254780932|r  170 DVGDQVASSFDQLVKALRESESRSLDQLSLDVLRPMLREWLDDNLPG  216 (236)
Q Consensus       170 ~t~~~v~~~~~~l~~~~~~~~~~tle~lv~emLrPmLk~WLD~nLP~  216 (236)
                      ++.++|..+|..|+   .+..-.|-++|-++|- |---++|=+|+|.
T Consensus         1 dTaEqv~~sFr~lA---~~KpyIT~~eLr~~L~-peqaeyc~~~M~~   43 (69)
T 1sjj_A            1 DTADQVMASFKILA---GDKNYITVDELRRELP-PDQAEYCIARMAP   43 (69)
T ss_dssp             SSSHHHHHHHHGGG---TSSSEEEHHHHHHHSC-HHHHHHHHHHSEE
T ss_pred             CCHHHHHHHHHHHC---CCCCCCCHHHHHHHCC-HHHHHHHHHHCCC
T ss_conf             98999999999871---8998778999974389-8999999985855


No 42 
>>1t3l_A Dihydropyridine-sensitive L-type, calcium channel beta-2 subunit; protein-peptide complex, SH3 domain, guanylate kinase domain; 2.20A {Oryctolagus cuniculus} (A:142-337)
Probab=20.57  E-value=47  Score=13.96  Aligned_cols=14  Identities=43%  Similarity=0.392  Sum_probs=11.5

Q ss_pred             HHHHHHHHHCCCCC
Q ss_conf             99999999603246
Q gi|254780932|r  222 VREEIERIARGPIR  235 (236)
Q Consensus       222 Vr~EIerv~r~~~r  235 (236)
                      |+.|||||-+-+|+
T Consensus        74 Vq~eiErIfelar~   87 (196)
T 1t3l_A           74 VQSEIERIFELART   87 (196)
T ss_dssp             HHHHHHHHHHHTTT
T ss_pred             CCCHHHHHHHHHHH
T ss_conf             45409999999973


No 43 
>>2i3t_B Spindle assembly checkpoint component; WD40 protein, beta propeller, mitotic spindle checkpoint, cell cycle; 2.80A {Saccharomyces cerevisiae} (B:)
Probab=20.06  E-value=40  Score=14.49  Aligned_cols=15  Identities=33%  Similarity=0.470  Sum_probs=12.6

Q ss_pred             CCCHHHHHHHHHHHH
Q ss_conf             887999998676762
Q gi|254780932|r    9 EPSMEEIVNSIRRIL   23 (236)
Q Consensus         9 EPSMeeILASIRRII   23 (236)
                      |=|.|||||-+|-|-
T Consensus        26 Ef~~EEiLA~srn~Y   40 (54)
T 2i3t_B           26 EFSLEEVLAISRNVY   40 (54)
T ss_dssp             BCCHHHHHHHTTTCS
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             401999999875068


No 44 
>>2cwj_A Putative endonuclease; hydrolase, endoribonucrease, structural genomics, NPPSFA; 3.60A {Aeropyrum pernix K1} (A:)
Probab=20.01  E-value=16  Score=17.35  Aligned_cols=50  Identities=16%  Similarity=0.339  Sum_probs=38.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHH-----------HHHHHHHHHHHHHHCHH
Q ss_conf             2235567899987655556532656530789999-----------97379999976610357
Q gi|254780932|r  166 LVSSDVGDQVASSFDQLVKALRESESRSLDQLSL-----------DVLRPMLREWLDDNLPG  216 (236)
Q Consensus       166 l~S~~t~~~v~~~~~~l~~~~~~~~~~tle~lv~-----------emLrPmLk~WLD~nLP~  216 (236)
                      +...+...++...|.++...+... +.++.++|+           +.++-.+++|+++|.|.
T Consensus        36 ~~~~d~~~Q~~~~~~ni~~~l~~~-g~~~~~vv~v~v~~~~~~~~~~~~~v~~~~f~~~~Pa   96 (123)
T 2cwj_A           36 LEEGGFKESAKRALDNLKAIVEGA-GYSMDDIVKVTVYITDISRFSEFNEVYREYFNRPYPA   96 (123)
T ss_dssp             ECSSSSHHHHHHHHHHHHHHHHHT-SCCGGGCCEEEEEESSSSHHHHHHHHHHTTCCSSCCE
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHC-CCCCCCEEEEEEEECCHHHHHHHHHHHHHHCCCCCCC
T ss_conf             145339999999998589999755-9953330899999724334588999999874898752


Done!