RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780932|ref|YP_003065345.1| hypothetical protein CLIBASIA_04155 [Candidatus Liberibacter asiaticus str. psy62] (236 letters) >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 43.0 bits (101), Expect = 6e-05 Identities = 36/163 (22%), Positives = 54/163 (33%), Gaps = 59/163 (36%) Query: 114 SILPST--DALEENAVMDKPLNEGLSPS-----SDLGMQAEESMYSPDLVDKCKG---EE 163 S+ PS D+LE N EG PS S+L + + D V+K Sbjct: 318 SLPPSILEDSLENN--------EG-VPSPMLSISNLTQEQVQ-----DYVNKTNSHLPAG 363 Query: 164 E----ALVSSDVGDQ--VA---SSFDQLVKALRESE-SRSLDQ----LS----------L 199 + +LV+ V+ S L LR+++ LDQ S L Sbjct: 364 KQVEISLVNGA--KNLVVSGPPQSLYGLNLTLRKAKAPSGLDQSRIPFSERKLKFSNRFL 421 Query: 200 DVLRPMLREWLDDNLPGIVERLVREEIE------RIARGPIRH 236 V P L I + LV+ + +I P+ Sbjct: 422 PVASPFHSHLLVPASDLINKDLVKNNVSFNAKDIQI---PVYD 461 Score = 41.9 bits (98), Expect = 1e-04 Identities = 37/228 (16%), Positives = 65/228 (28%), Gaps = 86/228 (37%) Query: 29 EFSTSNNVQTQVPARDE---GVIEK--------EDFVQEDKMSNHL-------------F 64 +F+ T+ A D+ E V+ K+ + Sbjct: 36 QFNKILPEPTEGFAADDEPTTPAELVGKFLGYVSSLVEPSKVGQFDQVLNLCLTEFENCY 95 Query: 65 ADQNS-HLKKYGVEYPKKETMSLSDVAARVRAEARGDARIIADAPSP-IANSILPSTDAL 122 + N H + ++ +L ++ ARI+A P +NS L A+ Sbjct: 96 LEGNDIHA--LAAKLLQENDTTLVKTKELIKNYIT--ARIMAKRPFDKKSNSAL--FRAV 149 Query: 123 EEN-----AVMDKPLNEGLSPSSDLGMQA------EE-----SMYSPDLVDKCKGEEEAL 166 E A+ G Q EE Y L Sbjct: 150 GEGNAQLVAI--------------FGGQGNTDDYFEELRDLYQTYHV------------L 183 Query: 167 VSSDVGDQVASSFDQLVKALRESESRSLDQLS--LDVLRPMLREWLDD 212 V GD + S + L + +R + + L++L WL++ Sbjct: 184 V----GDLIKFSAETLSELIRTTLDAE-KVFTQGLNILE-----WLEN 221 Score = 33.4 bits (76), Expect = 0.052 Identities = 29/135 (21%), Positives = 49/135 (36%), Gaps = 20/135 (14%) Query: 111 IANSILPSTDALEENAVMDKPLNE----GLSPSSDLGMQAEESMYSPDLVDKCKGEEEAL 166 + + +L T A L E L ++ +E +LV K G Sbjct: 16 LEHVLLVPTA-SFFIAS---QLQEQFNKILPEPTEGFAADDEPTTPAELVGKFLG----Y 67 Query: 167 VSSDVGDQVASSFDQLVK-ALRESESRSLDQLSLDVLRPMLREWLDDNLPGIVER--LVR 223 VSS V FDQ++ L E E+ L+ + L + L +N +V+ L++ Sbjct: 68 VSSLVEPSKVGQFDQVLNLCLTEFENCYLEGNDIHAL---AAKLLQENDTTLVKTKELIK 124 Query: 224 E--EIERIARGPIRH 236 +A+ P Sbjct: 125 NYITARIMAKRPFDK 139 >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* Length = 296 Score = 34.4 bits (78), Expect = 0.027 Identities = 12/54 (22%), Positives = 21/54 (38%), Gaps = 4/54 (7%) Query: 163 EEALVSSDVGDQVASSFDQLVKALRESESRSLDQLSLDVLRPMLREWLDDNLPG 216 E+ L + + + +K L S L+ + + L+E L D LP Sbjct: 46 EKLLQETGIKESTK---TNTLKKLLR-FSVEAGGLTEENVVGKLQEILCDMLPS 95 >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Score = 33.1 bits (74), Expect = 0.051 Identities = 8/38 (21%), Positives = 19/38 (50%), Gaps = 8/38 (21%) Query: 190 ESRSLDQLSLDVLRPMLREWLDDNLPGIVERLVREEIE 227 E ++L +L + L+ + DD+ P + ++ +E Sbjct: 18 EKQALKKL-----QASLKLYADDSAPALA---IKATME 47 Score = 28.0 bits (61), Expect = 2.1 Identities = 11/41 (26%), Positives = 16/41 (39%), Gaps = 17/41 (41%) Query: 49 EKEDFVQEDKM--SNHLFADQNSHLKKYGVEYPK---KETM 84 EK+ K+ S L+AD ++ P K TM Sbjct: 18 EKQAL---KKLQASLKLYADDSA---------PALAIKATM 46 >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Length = 359 Score = 30.9 bits (69), Expect = 0.23 Identities = 16/101 (15%), Positives = 33/101 (32%), Gaps = 4/101 (3%) Query: 116 LPSTDALEENAVMDKPLNEGLSPSSDL---GMQAEESMYSPDLVDKCKGEEEALVSSDVG 172 L + + ++K + G S + + + + EEAL+ SD G Sbjct: 45 LGRLIKEKAKSDVEK-VFSGFSKTRENLAVIDELLLFWNLAETDRVLDELEEALLVSDFG 103 Query: 173 DQVASSFDQLVKALRESESRSLDQLSLDVLRPMLREWLDDN 213 ++ + ++ S D L+ + E L Sbjct: 104 PKITVRIVERLREDIMSGKLKSGSEIKDALKESVLEMLAKK 144 >3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Length = 341 Score = 30.7 bits (68), Expect = 0.28 Identities = 8/33 (24%), Positives = 19/33 (57%) Query: 82 ETMSLSDVAARVRAEARGDARIIADAPSPIANS 114 ++ L+D+A ++ AE GD I+ + + ++ Sbjct: 2 ASIRLADLAQQLDAELHGDGDIVITGVASMQSA 34 >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Length = 328 Score = 30.1 bits (67), Expect = 0.41 Identities = 11/65 (16%), Positives = 26/65 (40%) Query: 163 EEALVSSDVGDQVASSFDQLVKALRESESRSLDQLSLDVLRPMLREWLDDNLPGIVERLV 222 E L+ +DV +V + + +K + + ++ ++E + + L + Sbjct: 60 EIDLLEADVALEVVDALREKIKQKLVGKKVRIGTDKGKIIEEAVKEAVSEILETSRRIDL 119 Query: 223 REEIE 227 EEI Sbjct: 120 IEEIR 124 >1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone/growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* 2auh_A* 1rqq_A* 2b4s_B* 3bu5_A* 3bu6_A* 1p14_A 3ekk_A* ... Length = 322 Score = 30.1 bits (67), Expect = 0.52 Identities = 14/45 (31%), Positives = 24/45 (53%) Query: 1 MAQYNAVSEPSMEEIVNSIRRILENNDQEFSTSNNVQTQVPARDE 45 QYN PS EI++SI+ +E +E S + + ++P +E Sbjct: 276 CWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENKLPEPEE 320 >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Length = 320 Score = 29.4 bits (65), Expect = 0.84 Identities = 9/59 (15%), Positives = 27/59 (45%), Gaps = 1/59 (1%) Query: 163 EEALVSSDVGDQVASSFDQLVKALRESESRSLDQLSLDVLRPMLREWLDDNLPGIVERL 221 E+ L+ +D+G ++ LV+ + S + + ++ + + + D++ R+ Sbjct: 41 EDVLIQTDMGMKMVLKVSNLVRK-KTKRDTSFENIKDALVESLYQAYTDNDWTNKKYRI 98 >2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Length = 374 Score = 28.8 bits (63), Expect = 1.1 Identities = 10/47 (21%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Query: 68 NSHLKKYGVEYPKKETMSLSDVAARVRAEARGDARIIADAPSPIANS 114 +S L G + T SL +A ++ E +G+ + I + Sbjct: 11 SSGLVPRGSHMSQS-TYSLEQLADFLKVEFQGNGATLLSGVEEIEEA 56 >3ewh_A Vascular endothelial growth factor receptor 2; angiogenesis, receptor tyrosine kinase, DFG-OUT, transferase; HET: K11; 1.60A {Homo sapiens} PDB: 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* 3dtw_A* 3be2_A* 2p2i_A* 1ywn_A* 1vr2_A* 3c7q_A* 2oh4_A* 3cjf_A* 3cjg_A* Length = 314 Score = 27.9 bits (61), Expect = 1.9 Identities = 6/29 (20%), Positives = 12/29 (41%) Query: 1 MAQYNAVSEPSMEEIVNSIRRILENNDQE 29 P+ E+V + +L+ N Q+ Sbjct: 278 CWHGEPSQRPTFSELVEHLGNLLQANAQQ 306 >2b0l_A GTP-sensing transcriptional pleiotropic repressor CODY; DNA-binding, nucleotide-binding, transcription regulation, winged HTH motif.; 2.90A {Bacillus subtilis} SCOP: a.4.5.66 Length = 102 Score = 27.9 bits (62), Expect = 2.1 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 8/65 (12%) Query: 155 LVDKCKGEEEALVSSDVGDQVASSFDQLVKALR--ES----ESRSLDQ--LSLDVLRPML 206 + ++ G E LV+S + D+V + +V ALR ES ESRSL + VL Sbjct: 33 IFEELDGNEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGTYIKVLNNKF 92 Query: 207 REWLD 211 L+ Sbjct: 93 LIELE 97 >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus P2} PDB: 1qzx_A 1qzw_A Length = 433 Score = 27.7 bits (61), Expect = 2.4 Identities = 8/58 (13%), Positives = 22/58 (37%), Gaps = 10/58 (17%) Query: 163 EEALVSSDVGDQVASSFDQLVKALRE-------SESRSLDQLSLDVLRPMLREWLDDN 213 +++L+SSDV ++ L ++E + + ++ L + + Sbjct: 32 QKSLISSDVNVKLV---FSLTAKIKERLNKEKPPSVLERKEWFISIVYDELSKLFGGD 86 >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Length = 443 Score = 27.4 bits (60), Expect = 2.6 Identities = 8/52 (15%), Positives = 20/52 (38%) Query: 163 EEALVSSDVGDQVASSFDQLVKALRESESRSLDQLSLDVLRPMLREWLDDNL 214 + AL+ +DV ++ + ++ E + + ++ E L L Sbjct: 36 QRALIQADVNVRLVLQLTREIQRRALEEKPPAGISKKEHIIKIVYEELTKFL 87 >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Length = 302 Score = 27.5 bits (60), Expect = 2.8 Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 6/60 (10%) Query: 132 LNEGLSPSSD-LGMQAEESMY-SPDLVDKCKGE-EEALVSSDVGDQVASSFDQLVKALRE 188 + G S + + L + E ++ + D+ E EEAL+ SD G ++ ++V+ LRE Sbjct: 3 VFSGFSKTRENLAVIDELLLFWNLAETDRVLDELEEALLVSDFGPKIT---VRIVERLRE 59 >3noq_A THIJ/PFPI family protein; DJ-1 superfamily, isocyanide hydratase, isonitrIle hydratase; HET: NHE; 1.00A {Pseudomonas fluorescens} PDB: 3noo_A 3nor_A* 3nov_A Length = 231 Score = 27.5 bits (61), Expect = 2.8 Identities = 12/69 (17%), Positives = 20/69 (28%), Gaps = 2/69 (2%) Query: 165 ALVSSDVGDQVASS-FDQLVKALRESESRSLDQLSLDVLRPMLREWLDDNLPGIVERLVR 223 L + A QL A + + + R+ D+L E + Sbjct: 164 TLAAELFDAATAQRVQLQLEYAPAPPFNAGSPDTAPASVVQQARQRAADSLHKRRE-ITL 222 Query: 224 EEIERIARG 232 R+A G Sbjct: 223 RAAARLAAG 231 >1q1v_A DEK protein; winged-helix motif, DNA binding protein; NMR {Homo sapiens} SCOP: a.159.4.1 Length = 70 Score = 27.4 bits (61), Expect = 3.2 Identities = 11/50 (22%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Query: 9 EPSMEEIVNSIRRILENNDQEFSTSNNVQTQVPARDEGV--IEKEDFVQE 56 P+ EE+ +I+++L + + E T + +V E++DF++ Sbjct: 11 PPTDEELKETIKKLLASANLEEVTMKQICKKVYENYPTYDLTERKDFIKT 60 >1y6a_A Vascular endothelial growth factor receptor 2; transferase; HET: AAZ; 2.10A {Homo sapiens} PDB: 1y6b_A* 3hng_A* Length = 366 Score = 27.2 bits (59), Expect = 3.4 Identities = 6/29 (20%), Positives = 12/29 (41%) Query: 1 MAQYNAVSEPSMEEIVNSIRRILENNDQE 29 P+ E+V + +L+ N Q+ Sbjct: 337 CWHGEPSQRPTFSELVEHLGNLLQANAQQ 365 >3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Score = 27.2 bits (60), Expect = 3.5 Identities = 2/18 (11%), Positives = 9/18 (50%) Query: 10 PSMEEIVNSIRRILENND 27 + + ++ ++ E+ D Sbjct: 317 LTALRVKKTLAKMSESQD 334 >2qy9_A Cell division protein FTSY; SRP receptor, protein targeting, simibi class GTPase, cell cycle, GTP-binding, inner membrane, membrane; 1.90A {Escherichia coli} SCOP: a.24.13.1 c.37.1.10 PDB: 1fts_A Length = 309 Score = 27.0 bits (59), Expect = 3.5 Identities = 14/59 (23%), Positives = 23/59 (38%), Gaps = 5/59 (8%) Query: 132 LNEGLSPSSD-LGMQAEESMYSPDLVDKCKGE-EEALVSSDVGDQVASSFDQLVKALRE 188 L L + + LG + D E EE L+ +DVG + +++ L E Sbjct: 5 LKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETT---RKIITNLTE 60 >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein-protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2iyl_D* 2cnw_D* 2j7p_D* Length = 304 Score = 27.1 bits (59), Expect = 4.1 Identities = 13/64 (20%), Positives = 29/64 (45%), Gaps = 4/64 (6%) Query: 132 LNEGLSPSSDLGMQAEESMYSPDLVDKCKGE-EEALVSSDVGDQVASSFDQLVKALRESE 190 L GL+ + + + +++ +++ E E AL+++DVG Q V+A + Sbjct: 7 LKAGLAKTRE---RLLKAIPWGGNLEEVLEELEMALLAADVGLSATEEILQEVRASGRKD 63 Query: 191 SRSL 194 + Sbjct: 64 LKEA 67 >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Length = 306 Score = 26.7 bits (58), Expect = 4.3 Identities = 12/50 (24%), Positives = 23/50 (46%), Gaps = 2/50 (4%) Query: 132 LNEGLSPSSD-LGMQAEESMYSPDLVDKCKGE-EEALVSSDVGDQVASSF 179 L +GL + + + + + L D+ + E EE L+ +DVG + Sbjct: 19 LKKGLQKTKETFFGRVVKLLKGKKLDDETREELEELLIQADVGVETTEYI 68 >1l9x_A Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCOP: c.23.16.1 Length = 315 Score = 26.7 bits (58), Expect = 4.4 Identities = 12/65 (18%), Positives = 21/65 (32%), Gaps = 4/65 (6%) Query: 24 ENNDQEFSTSNNVQTQVPARDEGVIEKEDFVQEDKMSNHLFAD---QNSHL-KKYGVEYP 79 E E+ + + A E FV E + +NH F + L ++ Y Sbjct: 243 EKAPYEWKNLDGISHAPNAVKTAFYLAEFFVNEARKNNHHFKSESEEEKALIYQFSPIYT 302 Query: 80 KKETM 84 + Sbjct: 303 GNISS 307 >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} Length = 432 Score = 26.7 bits (58), Expect = 4.8 Identities = 8/55 (14%), Positives = 24/55 (43%), Gaps = 4/55 (7%) Query: 163 EEALVSSDVGDQVASSF-DQLVKALRESESR---SLDQLSLDVLRPMLREWLDDN 213 + AL+ +DV ++ ++ + E ++ S + + ++ L + L + Sbjct: 34 QRALIQADVNVKLVLKMSKEIERRALEEKTPKGLSKKEHIIKIVYEELVKLLGEE 88 >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 3ng1_A 1ffh_A 2ng1_A* Length = 295 Score = 26.6 bits (58), Expect = 5.2 Identities = 15/58 (25%), Positives = 25/58 (43%), Gaps = 10/58 (17%) Query: 163 EEALVSSDVGDQVASSFDQLVKALRE-------SESRSLDQLSLDVLRPMLREWLDDN 213 AL+ +DV +VA V+ +RE ES + ++ L + L+E L Sbjct: 35 RRALMDADVNLEVA---RDFVERVREEALGKQVLESLTPAEVILATVYEALKEALGGE 89 >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Length = 425 Score = 26.6 bits (58), Expect = 5.2 Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 10/55 (18%) Query: 163 EEALVSSDVGDQVASSFDQLVKALRE-------SESRSLDQLSLDVLRPMLREWL 210 AL+ +DV +V V+ +RE ES + ++ L + L+E L Sbjct: 35 RRALMDADVNLEVT---RDFVERVREEALGKQVLESLTPAEVILATVYEALKEAL 86 >3lvf_P GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 1; oxidoreductase, glycolysis, rossmann fold; HET: NAD; 1.70A {Staphylococcus aureus} PDB: 3l6o_Q 3k73_Q 3lc2_O* 3lc7_O 3lc1_P* 3hq4_R* 3kv3_O* 3l4s_Q* 3k9q_Q* 3ksd_Q* 3ksz_O* Length = 338 Score = 26.2 bits (58), Expect = 5.9 Identities = 10/19 (52%), Positives = 12/19 (63%), Gaps = 1/19 (5%) Query: 163 EEALVSSD-VGDQVASSFD 180 E+ +VSSD VG S FD Sbjct: 277 EDEIVSSDVVGMTYGSLFD 295 >2j28_9 Signal recognition particle 54; ribosome, protein/RNA complex; 8.0A {Escherichia coli} Length = 430 Score = 26.2 bits (57), Expect = 6.4 Identities = 10/58 (17%), Positives = 24/58 (41%), Gaps = 10/58 (17%) Query: 163 EEALVSSDVGDQVASSFDQLVKALRE-------SESRSLDQLSLDVLRPMLREWLDDN 213 AL+ +DV V + + ++E ++S + Q + ++R L + + Sbjct: 34 RMALLEADVALPVV---REFINRVKEKAVGHEVNKSLTPGQEFVKIVRNELVAAMGEE 88 >2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 Score = 26.3 bits (57), Expect = 6.5 Identities = 6/29 (20%), Positives = 11/29 (37%) Query: 1 MAQYNAVSEPSMEEIVNSIRRILENNDQE 29 P+ +++V + RIL E Sbjct: 341 CWHAVPSQRPTFKQLVEDLDRILTLTTNE 369 >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Length = 297 Score = 26.2 bits (57), Expect = 7.4 Identities = 10/64 (15%), Positives = 31/64 (48%), Gaps = 2/64 (3%) Query: 163 EEALVSSDVGDQVASSF-DQLVKALRESESRSLDQLSLDVLRPMLREWLDDNLPGIVERL 221 +++L+S+DV ++ S +++ + L+ + + + + ++ + L + G E Sbjct: 33 QKSLISADVNVKLVFSLTNKIKERLKNEKPPTYIERR-EWFIKIVYDELSNLFGGDKEPK 91 Query: 222 VREE 225 V + Sbjct: 92 VIPD 95 >3dxp_A Putative acyl-COA dehydrogenase; YP_295230.1, structural genomics, joint center for structural genomics, JCSG; 2.32A {Ralstonia eutropha JMP134} Length = 359 Score = 26.0 bits (56), Expect = 7.8 Identities = 9/38 (23%), Positives = 14/38 (36%), Gaps = 5/38 (13%) Query: 195 DQLSLDVLRPMLREWLDDNLPGIVERLVREEIERIARG 232 DQ D L W+ ++ G L +E+ G Sbjct: 17 DQQRFDTEA--LEAWMRQHVEGFAGPL---SVEQFKGG 49 >2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural genomics, NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii OT3} Length = 357 Score = 26.0 bits (56), Expect = 7.9 Identities = 9/26 (34%), Positives = 16/26 (61%) Query: 206 LREWLDDNLPGIVERLVREEIERIAR 231 ++E + L + E++ RE+IER R Sbjct: 326 VKEEIIKTLRPLAEKVAREKIERELR 351 >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Length = 504 Score = 25.9 bits (56), Expect = 9.3 Identities = 10/55 (18%), Positives = 22/55 (40%), Gaps = 4/55 (7%) Query: 163 EEALVSSDVGDQVASSFDQLVK--ALRESESRSLD--QLSLDVLRPMLREWLDDN 213 AL+ +DV ++ + VK E + L+ ++ + L + +D Sbjct: 36 CTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNKRKMIQHAVFKELVKLVDPG 90 >2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 Score = 25.8 bits (56), Expect = 9.3 Identities = 17/87 (19%), Positives = 35/87 (40%), Gaps = 4/87 (4%) Query: 1 MAQYNAVSEPSMEEIVNSIRRILEN-NDQEFSTSNNVQTQVPARDEGVIEKEDFVQ-EDK 58 Q + + P E+IV+ + +++ N + TS + D+ ++ F D Sbjct: 286 CWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITSAAARPSNLLLDQSNVDITTFRTTGDW 345 Query: 59 MSNHLFADQNSHLKKYGVEYPKKETMS 85 ++ A GVEY +T++ Sbjct: 346 LNGVWTAHCKEIFT--GVEYSSCDTIA 370 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.310 0.128 0.344 Gapped Lambda K H 0.267 0.0621 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 1,918,365 Number of extensions: 86440 Number of successful extensions: 317 Number of sequences better than 10.0: 1 Number of HSP's gapped: 316 Number of HSP's successfully gapped: 51 Length of query: 236 Length of database: 5,693,230 Length adjustment: 89 Effective length of query: 147 Effective length of database: 3,535,514 Effective search space: 519720558 Effective search space used: 519720558 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits) S2: 55 (25.2 bits)