HHsearch alignment for GI: 254780934 and conserved domain: COG5148

>COG5148 RPN10 26S proteasome regulatory complex, subunit RPN10/PSMD4 [Posttranslational modification, protein turnover, chaperones].
Probab=94.74  E-value=0.28  Score=26.25  Aligned_cols=146  Identities=10%  Similarity=0.092  Sum_probs=96.3

Q ss_pred             EEEEEECCCCCC-CCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEEECC-CCEEEEECCCCHHHHHHHHHHC
Q ss_conf             499996578645-11313531379999998876322100236656734899998268-5056102047868999998601
Q gi|254780934|r  173 DMMIVLDVSRSM-ESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN-KIEEFFLLEWGVSHLQRKIKYL  250 (374)
Q Consensus       173 di~~VlD~SgSM-~~~~~~~~~ki~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~t~~~~~~~~~i~~l  250 (374)
T Consensus         5 atvvliDNse~s~NgDy--~ptRFeAQkd~ve~if~~K~ndnpE---ntiGli~~~~a~p~vlsT~T~~~gkilt~lhd~   79 (243)
T COG5148           5 ATVVLIDNSEASQNGDY--LPTRFEAQKDAVESIFSKKFNDNPE---NTIGLIPLVQAQPNVLSTPTKQRGKILTFLHDI   79 (243)
T ss_pred             EEEEEEECHHHHHCCCC--CCHHHHHHHHHHHHHHHHHHCCCCC---CEEEEEECCCCCCCHHCCCHHHHHHHHHHHCCC
T ss_conf             28999847066524897--7078888788999999877238963---315445635688512113065412888772365


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCC-CEEEEEEECCCCCCCCCCHHHHHHHHHHHHCCCEEEEEEECC
Q ss_conf             3368774442036767764322233331025788656-427999806877888880689999999997898799999248
Q gi|254780934|r  251 SKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY-KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV  329 (374)
Q Consensus       251 ~~~g~~T~~~~~~~~a~~~l~~~~~~~~~~~~~~~~~-~k~iillTDG~~~~~~~~~~~~~~~~~~k~~gi~IytIg~~~  329 (374)
T Consensus        80 ~~~g-~a~~~~~lqiaql~lkhR---------~nk~q~qriVaFvgSpi--~es-edeLirlak~lkknnVAidii~fGE  146 (243)
T COG5148          80 RLHG-GADIMRCLQIAQLILKHR---------DNKGQRQRIVAFVGSPI--QES-EDELIRLAKQLKKNNVAIDIIFFGE  146 (243)
T ss_pred             CCCC-CCHHHHHHHHHHHHHHCC---------CCCCCCEEEEEEECCCC--CCC-HHHHHHHHHHHHHCCEEEEEEEHHH
T ss_conf             1247-640888999999998601---------48765058999946845--326-7999999999986683589986034


Q ss_pred             CCCHHHH
Q ss_conf             2227889
Q gi|254780934|r  330 IRSHEFL  336 (374)
Q Consensus       330 ~~~~~~L  336 (374)
T Consensus       147 ~~n~~~l  153 (243)
T COG5148         147 AANMAGL  153 (243)
T ss_pred             HHHHHHH
T ss_conf             5556678