HHsearch alignment for GI: 254780934 and conserved domain: KOG1226

>KOG1226 consensus.
Probab=97.52  E-value=0.00082  Score=41.31  Aligned_cols=145  Identities=12%  Similarity=0.193  Sum_probs=81.3

Q ss_pred             CCCCCCEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEEECCCC---------------
Q ss_conf             03778724999965786451131353137999999887632210023665673489999826850---------------
Q gi|254780934|r  166 SQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI---------------  230 (374)
Q Consensus       166 ~~~~~~~di~~VlD~SgSM~~~~~~~~~ki~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---------------  230 (374)
T Consensus       127 ~a~~yPVDLYyLMDlS~SM~DDl----~~l~~LG~~L~~~m~~lT------~nfrlGFGSFVDK~v~P~i~~~pekl~np  196 (783)
T KOG1226         127 QAEDYPVDLYYLMDLSYSMKDDL----ENLKSLGTDLAREMRKLT------SNFRLGFGSFVDKTVSPYISTTPEKLRNP  196 (783)
T ss_pred             ECCCCCEEEEEEEECCHHHHHHH----HHHHHHHHHHHHHHHHHH------CCCCCCCCCHHCCCCCCCCCCCCHHHCCC
T ss_conf             03579703799861302456569----999999999999999875------46776653111244354111680775389


Q ss_pred             -------------EEEEECCCCHHHHHHHHHHCCCCCCCCCCCCH-HHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEEEC
Q ss_conf             -------------56102047868999998601336877444203-6767764322233331025788656427999806
Q gi|254780934|r  231 -------------EEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPG-LKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTD  296 (374)
Q Consensus       231 -------------~~~~~~t~~~~~~~~~i~~l~~~g~~T~~~~~-~~~a~~~l~~~~~~~~~~~~~~~~~~k~iillTD  296 (374)
T Consensus       197 c~~~~~C~ppfgfkhvLsLT~~~~~F~~~V~~q~ISg-NlDaPEGGfDAimQaa----vC~~~IGW-R~~a~~LLVF~td  270 (783)
T KOG1226         197 CPNYKNCAPPFGFKHVLSLTNDAEEFNEEVGKQRISG-NLDAPEGGFDAIMQAA----VCTEKIGW-RNDATRLLVFSTD  270 (783)
T ss_pred             CCCCCCCCCCCCCCEEEECCCCHHHHHHHHHHCEECC-CCCCCCCHHHHHHHHH----HCCCCCCC-CCCCEEEEEEECC
T ss_conf             9874457798554002106887699999875435326-8898982298887664----14655220-1265168999707


Q ss_pred             CCCC--------------CC---------------CCCHHHHHHHHHHHHCCC-EEEEEE
Q ss_conf             8778--------------88---------------880689999999997898-799999
Q gi|254780934|r  297 GENL--------------ST---------------KEDQQSLYYCNEAKKRGA-IVYAIG  326 (374)
Q Consensus       297 G~~~--------------~~---------------~~~~~~~~~~~~~k~~gi-~IytIg  326 (374)
T Consensus       271 ~~~H~a~DgkLaGiv~pnDG~CHL~~~g~Yt~S~~qdyPSia~l~~kl~~~ni~~IFAVt  330 (783)
T KOG1226         271 AGFHFAGDGKLAGIVQPNDGQCHLDKNGEYTQSTTQDYPSIAQLAQKLADNNINTIFAVT  330 (783)
T ss_pred             CCEEEECCCCEEEEECCCCCCCCCCCCCCCCEECCCCCCCHHHHHHHHHHHCCHHHHHHH
T ss_conf             513451155312585378874156877751201377777389999987660453477876