HHsearch alignment for GI: 254780934 and conserved domain: TIGR00868

>TIGR00868 hCaCC calcium-activated chloride channel protein 1; InterPro: IPR004727 This entry represents a family of Ca(2+)-regulated chloride channels (CLCA) which includes bovine, murine and human proteins , . Each CLCA exhibits a distinct, often overlapping, tissue expression pattern. With the exception of the truncated, secreted protein hCLCA3 , they are synthesized as an approximately 125 kDa precursor transmembrane glycoprotein that is rapidly cleaved into 90 and 35 kDa subunits. The human proteins have been shown to affect a large number of cell functions including chloride conductance, epithelial secretion, cell-cell adhesion, apoptosis, cell cycle control, mucus production in asthma, and blood pressure. The CLCA proteins expressed on the luminal surface of lung vascular endothelia (bCLCA2; mCLCA1; hCLCA2) serve as adhesion molecules for lung metastatic cancer cells, mediating vascular arrest and lung colonization. Expression of hCLCA2 in normal mammary epithelium is consistently lost in human breast cancer and in all tumorigenic breast cancer cell lines. Re-expression of hCLCA2 in human breast cancer cells abrogates tumorigenicity in nude mice, implying that hCLCA2 acts as a tumour suppressor in breast cancer..
Probab=99.78  E-value=3.1e-18  Score=127.16  Aligned_cols=165  Identities=22%  Similarity=0.242  Sum_probs=119.5

Q ss_pred             EEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEEECCCCEEEEECCC--CHHHHHHHHHH
Q ss_conf             2499996578645113135313799999988763221002366567348999982685056102047--86899999860
Q gi|254780934|r  172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKY  249 (374)
Q Consensus       172 ~di~~VlD~SgSM~~~~~~~~~ki~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t~--~~~~~~~~i~~  249 (374)
T Consensus       308 RiVCLVLDKSGSM~~~d-----RL~RmNQAa~lFL~Q~vE-----~gs~VGmV~FDS~A~i~n~L~~I~s~~~~~~l~a~  377 (874)
T TIGR00868       308 RIVCLVLDKSGSMTKED-----RLKRMNQAAKLFLLQIVE-----KGSWVGMVTFDSAAEIKNELIKITSSDERDALTAN  377 (874)
T ss_pred             EEEEEEECCCCCCCCCC-----HHHHHHHHHHHHEEEEEE-----CCCEEEEEECCCEEEEEEEEEEECCHHHHHHHHHH
T ss_conf             58999863443379885-----334555566430123554-----15267766306445765420775266899899870


Q ss_pred             CCC-CCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHH-HHHHCCCEEEEEEE
Q ss_conf             133-6877444203676776432223333102578865642799980687788888068999999-99978987999992
Q gi|254780934|r  250 LSK-FGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCN-EAKKRGAIVYAIGI  327 (374)
Q Consensus       250 l~~-~g~~T~~~~~~~~a~~~l~~~~~~~~~~~~~~~~~~k~iillTDG~~~~~~~~~~~~~~~~-~~k~~gi~IytIg~  327 (374)
T Consensus       378 LP~~a~GGTSIC~Gl~~aFq~I~~~~~~t~G---------SEi~LLTDGEDN~i~s-------C~~eVkqsGaIiHtiAL  441 (874)
T TIGR00868       378 LPTEASGGTSICSGLKAAFQVIKKSDQSTDG---------SEIVLLTDGEDNTISS-------CIEEVKQSGAIIHTIAL  441 (874)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHCCCCCCC---------CEEEEEECCCCCCEEE-------CHHHHHCCCEEEEEEEC
T ss_conf             7787876803656676665433312666675---------3699830687576231-------30554109808998507


Q ss_pred             CCCCCHHHHHHHC--CCCCEEEECC---HHHHHHHHHHHHH
Q ss_conf             4822278899823--8981798389---8999999999998
Q gi|254780934|r  328 RVIRSHEFLRACA--SPNSFYLVEN---PHSMYDAFSHIGK  363 (374)
Q Consensus       328 ~~~~~~~~L~~~A--s~~~~~~a~~---~~~L~~~f~~I~~  363 (374)
T Consensus       442 GpsAa~el-e~lS~mTGG~~fYa~D~~~~NgLidAFg~lsS  481 (874)
T TIGR00868       442 GPSAAKEL-EELSDMTGGLRFYASDEADNNGLIDAFGALSS  481 (874)
T ss_pred             CHHHHHHH-HHHHHHCCCCEEEEECHHHCCCHHHHHHHHCC
T ss_conf             84589999-99873338711334133331414546642214