HHsearch alignment for GI: 254780934 and conserved domain: cd01458

>cd01458 vWA_ku Ku70/Ku80 N-terminal domain. The Ku78 heterodimer (composed of Ku70 and Ku80) contributes to genomic integrity through its ability to bind DNA double-strand breaks (DSB) in a preferred orientation. DSB's are repaired by either homologues recombination or non-homologues end joining and facilitate repair by the non-homologous end-joining pathway (NHEJ). The Ku heterodimer is required for accurate process that tends to preserve the sequence at the junction. Ku78 is found in all three kingdoms of life. However, only the eukaryotic proteins have a vWA domain fused to them at their N-termini. The vWA domain is not involved in DNA binding but may very likey mediate Ku78's interactions with other proteins. Members of this subgroup lack the conserved MIDAS motif.
Probab=96.71  E-value=0.04  Score=31.25  Aligned_cols=155  Identities=15%  Similarity=0.168  Sum_probs=82.2

Q ss_pred             EEEEEECCCCCCCCCCCC-CHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEEECCCCE----------EEEECCC-CH
Q ss_conf             499996578645113135-31379999998876322100236656734899998268505----------6102047-86
Q gi|254780934|r  173 DMMIVLDVSRSMESFFDS-SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE----------EFFLLEW-GV  240 (374)
Q Consensus       173 di~~VlD~SgSM~~~~~~-~~~ki~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----------~~~~~t~-~~  240 (374)
T Consensus         3 ~ivflID~s~sM~~~~~~~~~s~~~~al~~i~~~~~~ki---is~~~d~vGvv~~~T~~~~n~~~~~~i~vl~~l~~~~a   79 (218)
T cd01458           3 SVVFLVDVSPSMFESKDGEYESPFEEALKCIRQLMKSKI---ISSPKDLVGVVFYGTEESKNPVGYENIYVLLDLDTPGA   79 (218)
T ss_pred             EEEEEEECCHHHCCCCCCCCCCHHHHHHHHHHHHHHHHE---ECCCCCEEEEEEECCCCCCCCCCCCEEEEEECCCCCCH
T ss_conf             799999799778477678888839999999999998650---67899869999976788888789872699633887677


Q ss_pred             HHHHHHHHHCCCC-----------CCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEEECCCCCCCCCC---H
Q ss_conf             8999998601336-----------8774442036767764322233331025788656427999806877888880---6
Q gi|254780934|r  241 SHLQRKIKYLSKF-----------GVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKED---Q  306 (374)
Q Consensus       241 ~~~~~~i~~l~~~-----------g~~T~~~~~~~~a~~~l~~~~~~~~~~~~~~~~~~k~iillTDG~~~~~~~~---~  306 (374)
T Consensus        80 ~~i~~-l~~~~~~~~~~~~~~~~~~~~~~l~~aL~~~~~~f~~~---------~~~~~~krI~lfTdnD~P~~~~~~~~~  149 (218)
T cd01458          80 ERVED-LKELIEPGGLSFAGQVGDSGQVSLSDALWVCLDLFSKG---------KKKKSHKRIFLFTNNDDPHGGDSIKDS  149 (218)
T ss_pred             HHHHH-HHHHHHCCHHHHHHHCCCCCCCCHHHHHHHHHHHHHHC---------CCCCCCCEEEEECCCCCCCCCCHHHHH
T ss_conf             99999-99986010235566448888867999999999999855---------534577779998689989998879999


Q ss_pred             HHHHHHHHHHHCCCEEEEEEECCCCC----HHHHHHHC
Q ss_conf             89999999997898799999248222----78899823
Q gi|254780934|r  307 QSLYYCNEAKKRGAIVYAIGIRVIRS----HEFLRACA  340 (374)
Q Consensus       307 ~~~~~~~~~k~~gi~IytIg~~~~~~----~~~L~~~A  340 (374)
T Consensus       150 ~a~~~a~DL~d~gI~iel~~l~~~~~~Fd~s~FY~dii  187 (218)
T cd01458         150 QAAVKAEDLKDKGIELELFPLSSPGKKFDVSKFYKDII  187 (218)
T ss_pred             HHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHH
T ss_conf             99999988987796899984489988688067788752