HHsearch alignment for GI: 254780934 and conserved domain: cd01461

>cd01461 vWA_interalpha_trypsin_inhibitor vWA_interalpha trypsin inhibitor (ITI): ITI is a glycoprotein composed of three polypeptides- two heavy chains and one light chain (bikunin). Bikunin confers the protease-inhibitor function while the heavy chains are involved in rendering stability to the extracellular matrix by binding to hyaluronic acid. The heavy chains carry the VWA domain with a conserved MIDAS motif. Although the exact role of the VWA domains remains unknown, it has been speculated to be involved in mediating protein-protein interactions with the components of the extracellular matrix.
Probab=99.93  E-value=6.4e-24  Score=161.01  Aligned_cols=162  Identities=20%  Similarity=0.219  Sum_probs=128.5

Q ss_pred             CCEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEEECCCCEEEEEC--CCCH---HHHH
Q ss_conf             8724999965786451131353137999999887632210023665673489999826850561020--4786---8999
Q gi|254780934|r  170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLL--EWGV---SHLQ  244 (374)
Q Consensus       170 ~~~di~~VlD~SgSM~~~~~~~~~ki~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--t~~~---~~~~  244 (374)
T Consensus         1 ~P~div~viD~SgSM~g~------~l~~ak~a~~~~l~~l~~------~d~~~iv~F~~~~~~~~~~~~~~~~~~~~~a~   68 (171)
T cd01461           1 LPKEVVFVIDTSGSMSGT------KIEQTKEALLTALKDLPP------GDYFNIIGFSDTVEEFSPSSVSATAENVAAAI   68 (171)
T ss_pred             CCCEEEEEECCCCCCCCH------HHHHHHHHHHHHHHHCCC------CCEEEEEEECCEEEEECCCCEECCHHHHHHHH
T ss_conf             984699999179889863------999999999999982998------78799999878065980775307999999999


Q ss_pred             HHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHCCCEEEE
Q ss_conf             99860133687744420367677643222333310257886564279998068778888806899999999978987999
Q gi|254780934|r  245 RKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYA  324 (374)
Q Consensus       245 ~~i~~l~~~g~~T~~~~~~~~a~~~l~~~~~~~~~~~~~~~~~~k~iillTDG~~~~~~~~~~~~~~~~~~k~~gi~Iyt  324 (374)
T Consensus        69 ~~i~~l~~~G-~T~i~~aL~~a~~~l~~-----------~~~~~~~iillTDG~~~~---~~~~~~~~~~~~~~~i~i~t  133 (171)
T cd01461          69 EYVNRLQALG-GTNMNDALEAALELLNS-----------SPGSVPQIILLTDGEVTN---ESQILKNVREALSGRIRLFT  133 (171)
T ss_pred             HHHHCCCCCC-CCHHHHHHHHHHHHHHH-----------CCCCCCEEEEECCCCCCC---HHHHHHHHHHHHCCCCEEEE
T ss_conf             8875478899-86699999999998863-----------579861899975788688---68999999997448963999


Q ss_pred             EEECCCCCHHHHHHHC--CCCCEEEECCHHHHHHHH
Q ss_conf             9924822278899823--898179838989999999
Q gi|254780934|r  325 IGIRVIRSHEFLRACA--SPNSFYLVENPHSMYDAF  358 (374)
Q Consensus       325 Ig~~~~~~~~~L~~~A--s~~~~~~a~~~~~L~~~f  358 (374)
T Consensus       134 ig~G~~~~~~~L~~iA~~~~G~~~~v~~~~~l~~~~  169 (171)
T cd01461         134 FGIGSDVNTYLLERLAREGRGIARRIYETDDIESQL  169 (171)
T ss_pred             EEECCCCCHHHHHHHHHCCCCEEEECCCHHHHHHHH
T ss_conf             997897999999999972898899889878999976