HHsearch alignment for GI: 254780934 and conserved domain: cd01470

>cd01470 vWA_complement_factors Complement factors B and C2 are two critical proteases for complement activation. They both contain three CCP or Sushi domains, a trypsin-type serine protease domain and a single VWA domain with a conserved metal ion dependent adhesion site referred commonly as the MIDAS motif. Orthologues of these molecules are found from echinoderms to chordates. During complement activation, the CCP domains are cleaved off, resulting in the formation of an active protease that cleaves and activates complement C3. Complement C2 is in the classical pathway and complement B is in the alternative pathway. The interaction of C2 with C4 and of factor B with C3b are both dependent on Mg2+ binding sites within the VWA domains and the VWA domain of factor B has been shown to mediate the binding of C3. This is consistent with the common inferred function of VWA domains as magnesium-dependent protein interaction domains.
Probab=99.90  E-value=1.8e-21  Score=146.39  Aligned_cols=176  Identities=17%  Similarity=0.261  Sum_probs=133.0

Q ss_pred             EEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEEECCCCEEEEEC----CCCHHHHHHHH
Q ss_conf             24999965786451131353137999999887632210023665673489999826850561020----47868999998
Q gi|254780934|r  172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLL----EWGVSHLQRKI  247 (374)
Q Consensus       172 ~di~~VlD~SgSM~~~~~~~~~ki~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----t~~~~~~~~~i  247 (374)
T Consensus         1 lDivfllD~SgSIg~~------nF~~~k~Fv~~lv~~~~~~~~---~~rvgvv~ys~~~~~~f~l~~~~~~~~~~~~~~i   71 (198)
T cd01470           1 LNIYIALDASDSIGEE------DFDEAKNAIKTLIEKISSYEV---SPRYEIISYASDPKEIVSIRDFNSNDADDVIKRL   71 (198)
T ss_pred             CEEEEEEECCCCCCHH------HHHHHHHHHHHHHHHHCCCCC---CCEEEEEEECCCCEEEEECCCCCCCCHHHHHHHH
T ss_conf             9199999798988878------899999999999998446687---7538999815885389971576666899999999


Q ss_pred             HHCCCCC----CCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEEECCCCCCCCCCHHHH----------HHHH
Q ss_conf             6013368----7744420367677643222333310257886564279998068778888806899----------9999
Q gi|254780934|r  248 KYLSKFG----VSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSL----------YYCN  313 (374)
Q Consensus       248 ~~l~~~g----~~T~~~~~~~~a~~~l~~~~~~~~~~~~~~~~~~k~iillTDG~~~~~~~~~~~~----------~~~~  313 (374)
T Consensus        72 ~~i~y~~~~~~~gT~t~~AL~~~~~~~~~~~~~---~~~~~~~v~~v~illTDG~sn~g~~P~~~~~~~~~~~~~~~~a~  148 (198)
T cd01470          72 EDFNYDDHGDKTGTNTAAALKKVYERMALEKVR---NKEAFNETRHVIILFTDGKSNMGGSPLPTVDKIKNLVYKNNKSD  148 (198)
T ss_pred             HHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHC---CCCCCCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             846033577886468999999999986555304---66444567559999737854578993367888777664101456


Q ss_pred             HHHHCCCEEEEEEECCCCCHHHHHHHCCC--C--CEEEECCHHHHHHHHH
Q ss_conf             99978987999992482227889982389--8--1798389899999999
Q gi|254780934|r  314 EAKKRGAIVYAIGIRVIRSHEFLRACASP--N--SFYLVENPHSMYDAFS  359 (374)
Q Consensus       314 ~~k~~gi~IytIg~~~~~~~~~L~~~As~--~--~~~~a~~~~~L~~~f~  359 (374)
T Consensus       149 ~~r~~gi~ifaiGVG~~~d~~eL~~IAS~~~~e~hvf~v~df~~L~~i~d  198 (198)
T cd01470         149 NPREDYLDVYVFGVGDDVNKEELNDLASKKDNERHFFKLKDYEDLQEVFD  198 (198)
T ss_pred             HHHHCCCEEEEEEECCCCCHHHHHHHHCCCCCCCEEEEECCHHHHHHHHC
T ss_conf             78873947999996661599999998579998716999689999998639