HHsearch alignment for GI: 254780934 and conserved domain: pfam00362

>pfam00362 Integrin_beta Integrin, beta chain. Integrins have been found in animals and their homologues have also been found in cyanobacteria, probably due to horizontal gene transfer. The sequences repeats have been trimmed due to an overlap with EGF.
Probab=98.46  E-value=6.2e-05  Score=47.97  Aligned_cols=185  Identities=16%  Similarity=0.182  Sum_probs=108.7

Q ss_pred             ECCCCCCEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEEECCCCE-------------
Q ss_conf             1037787249999657864511313531379999998876322100236656734899998268505-------------
Q gi|254780934|r  165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE-------------  231 (374)
Q Consensus       165 ~~~~~~~~di~~VlD~SgSM~~~~~~~~~ki~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-------------  231 (374)
T Consensus        94 ~~aedYPVDLYYLMDLS~SM~dD-------l~~lk~LG~~La~~m~~i---T~nfrlGFGSFVDK~v~P~~~t~p~~l~~  163 (424)
T pfam00362        94 RQAEDYPVDLYYLMDLSYSMKDD-------LENLKTLGTDLAKEMANI---TSNFRLGFGSFVDKTVSPYVSTVPEKLKN  163 (424)
T ss_pred             ECCCCCCCEEEEEEECCHHHHHH-------HHHHHHHHHHHHHHHHHH---CCCCEEECCCCCCCCCCCCCCCCHHHHCC
T ss_conf             71356971369986054146778-------999999999999999861---40435630200047668853379778539


Q ss_pred             ----------------EEEECCCCHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEEE
Q ss_conf             ----------------6102047868999998601336877444203676776432223333102578865642799980
Q gi|254780934|r  232 ----------------EFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMT  295 (374)
Q Consensus       232 ----------------~~~~~t~~~~~~~~~i~~l~~~g~~T~~~~~~~~a~~~l~~~~~~~~~~~~~~~~~~k~iillT  295 (374)
T Consensus       164 PC~~~~~~C~~~fgf~~~l~LT~~~~~F~~~v~~q~iSg-NlD~PEGGfDAlmQ~---aVC~~~IGW-R~~arrllv~~T  238 (424)
T pfam00362       164 PCSSKNPGCQPPFGFRHVLSLTDDTDRFNEEVKKQKISG-NLDAPEGGFDAIMQA---AVCGEEIGW-RNEARRLLVFTT  238 (424)
T ss_pred             CCCCCCCCCCCCCCEEEECCCCCCHHHHHHHHHHCCCCC-CCCCCCCCHHHHHHH---HHHCCCCCC-CCCCEEEEEEEC
T ss_conf             875778898898022200246777899999987463646-777875017777788---761423377-778528999985


Q ss_pred             CCCCC--------------CC---------------CCCHHHHHHHHHHHHCCCE-EEEEEECCCCCHHHHHHHCCCCCE
Q ss_conf             68778--------------88---------------8806899999999978987-999992482227889982389817
Q gi|254780934|r  296 DGENL--------------ST---------------KEDQQSLYYCNEAKKRGAI-VYAIGIRVIRSHEFLRACASPNSF  345 (374)
Q Consensus       296 DG~~~--------------~~---------------~~~~~~~~~~~~~k~~gi~-IytIg~~~~~~~~~L~~~As~~~~  345 (374)
T Consensus       239 Da~fH~AgDGkL~GIv~PNDg~CHL~~~g~Yt~s~~~DYPSv~ql~~kl~ennI~~IFAVt~~~~~~Y~~Ls~~i-~gs~  317 (424)
T pfam00362       239 DAGFHFAGDGKLGGIVEPNDGQCHLDDNGEYTASTTLDYPSVGQLAEKLSENNINPIFAVTENVVDLYKELSELI-PGST  317 (424)
T ss_pred             CCCCCCCCCCCEEEEECCCCCCEEECCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEEECHHHHHHHHHHHHHC-CCCE
T ss_conf             887513577633435348887304489876144566788888999999986492599997502458999999757-7652


Q ss_pred             E--EECCHHHH----HHHHHHHHHHH
Q ss_conf             9--83898999----99999999842
Q gi|254780934|r  346 Y--LVENPHSM----YDAFSHIGKDI  365 (374)
Q Consensus       346 ~--~a~~~~~L----~~~f~~I~~~i  365 (374)
T Consensus       318 vg~L~~DSsNIv~LI~~aY~ki~S~V  343 (424)
T pfam00362       318 VGVLSSDSSNVVQLIKDAYNKISSKV  343 (424)
T ss_pred             EEEECCCCHHHHHHHHHHHHHHHEEE
T ss_conf             56624675028999999998752289