HHsearch alignment for GI: 254780934 and conserved domain: pfam04056

>pfam04056 Ssl1 Ssl1-like. Ssl1-like proteins are 40kDa subunits of the Transcription factor II H complex.
Probab=98.49  E-value=3.1e-05  Score=49.77  Aligned_cols=174  Identities=14%  Similarity=0.138  Sum_probs=120.3

Q ss_pred             CCCEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEEE-CCCCEEEEECCCCHHHHHHHH
Q ss_conf             7872499996578645113135313799999988763221002366567348999982-685056102047868999998
Q gi|254780934|r  169 DARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF-SNKIEEFFLLEWGVSHLQRKI  247 (374)
Q Consensus       169 ~~~~di~~VlD~SgSM~~~~~~~~~ki~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~t~~~~~~~~~i  247 (374)
T Consensus        50 GiiRhl~iilD~S~aM~e~D-lkP~R~~~~l~~l~~Fi~efFdqNPiS---Qlgii~~rn~~a~~ls~lsgnp~~hi~aL  125 (250)
T pfam04056        50 GIIRHLYIVLDCSRAMEEKD-LRPSRFACTIKYLETFVEEFFDQNPIS---QIGLITCKDGRAHRLTDLTGNPRVHIKAL  125 (250)
T ss_pred             CCEEEEEEEEECCHHHHHCC-CCCCHHHHHHHHHHHHHHHHHHCCCCC---CEEEEEEECCEEEEEEECCCCHHHHHHHH
T ss_conf             20168999998827676351-586489999999999999987439830---22799996571378332579989999999


Q ss_pred             HHCCCCC--CCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHCCCEEEEE
Q ss_conf             6013368--77444203676776432223333102578865642799980687788888068999999999789879999
Q gi|254780934|r  248 KYLSKFG--VSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAI  325 (374)
Q Consensus       248 ~~l~~~g--~~T~~~~~~~~a~~~l~~~~~~~~~~~~~~~~~~k~iillTDG~~~~~~~~~~~~~~~~~~k~~gi~IytI  325 (374)
T Consensus       126 ~~~~~~~~~G~pSLqN~Le~a~~~L~~~---------P~~~sREILii~gSL-~T--~DPgdI~~tI~~l~~~~IrvsvI  193 (250)
T pfam04056       126 KSLREAECGGDPSLQNALELARASLKHV---------PSHGSREVLIIFGSL-ST--CDPGDIYSTIDTLKKEKIRCSVI  193 (250)
T ss_pred             HHHHCCCCCCCHHHHHHHHHHHHHHHCC---------CCCCCEEEEEEEEEC-CC--CCCCCHHHHHHHHHHCCCEEEEE
T ss_conf             9874069999920899999999887508---------987854899998204-44--58865999999999759079998


Q ss_pred             EECCCCCHHHHHHHC--CCCCEEEECCHHHHHHHHHH
Q ss_conf             924822278899823--89817983898999999999
Q gi|254780934|r  326 GIRVIRSHEFLRACA--SPNSFYLVENPHSMYDAFSH  360 (374)
Q Consensus       326 g~~~~~~~~~L~~~A--s~~~~~~a~~~~~L~~~f~~  360 (374)
T Consensus       194 ~LaaEv--~Ick~l~~~T~G~y~V~lde~Hfk~ll~~  228 (250)
T pfam04056       194 GLSAEV--FICKELCKATNGTYSVALDETHLKELLLE  228 (250)
T ss_pred             EECHHH--HHHHHHHHHHCCEEEEECCHHHHHHHHHH
T ss_conf             733899--99999999749988875699999999995