HHsearch alignment for GI: 254780934 and conserved domain: pfam07811

>pfam07811 TadE TadE-like protein. The members of this family are similar to a region of the protein product of the bacterial tadE locus. In various bacterial species, the tad locus is closely linked to flp-like genes, which encode proteins required for the production of pili involved in adherence to surfaces. It is thought that the tad loci encode proteins that act to assemble or export an Flp pilus in various bacteria. All tad loci but TadA have putative transmembrane regions, and in fact the region in question is this family has a high proportion of hydrophobic amino acid residues.
Probab=96.58  E-value=0.008  Score=35.39  Aligned_cols=42  Identities=26%  Similarity=0.551  Sum_probs=39.0

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             629999999999999999999999999999999999999999
Q gi|254780934|r   17 GGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSL   58 (374)
Q Consensus        17 G~vaiifAl~l~~ll~~~g~avD~~~~~~~ks~Lq~A~DaAa   58 (374)
T Consensus         1 G~a~VEfalv~p~~l~l~~~~~~~~~~~~~~~~~~~Aa~~aa   42 (43)
T pfam07811         1 GAAAVEFALVLPVLLLLLFGIVELGRLFYARQVLQNAAREAA   42 (43)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             916999999999999999999999999999999999998674