HHsearch results for GI: 254780934 and protein with PDBid: 1atz_A

>1atz_A VON willebrand factor; collagen-binding, hemostasis, dinucleotide binding fold; 1.80A {Homo sapiens} SCOP: c.62.1.1 PDB: 2adf_A 1fe8_A 1ao3_A
Probab=99.86  E-value=1.7e-20  Score=139.39  Aligned_cols=178  Identities=14%  Similarity=0.144  Sum_probs=139.6

Q ss_pred             CCEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEEECCCCEEEEECC--CCHHHHHHHH
Q ss_conf             87249999657864511313531379999998876322100236656734899998268505610204--7868999998
Q gi|254780934|r  170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKI  247 (374)
Q Consensus       170 ~~~di~~VlD~SgSM~~~~~~~~~ki~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t--~~~~~~~~~i  247 (374)
                      .++||+||+|.|+||...      +++.+|..+..+++.+..   .....|++++.|++.+....++.  .+++.+...|
T Consensus         4 ~~~DivfllD~S~s~~~~------~~~~~k~fv~~~i~~~~i---~~~~~rv~vv~y~~~~~~~~~l~~~~~~~~~~~~i   74 (189)
T 1atz_A            4 QPLDVILLLDGSSSFPAS------YFDEMKSFAKAFISKANI---GPRLTQVSVLQYGSITTIDVPWNVVPEKAHLLSLV   74 (189)
T ss_dssp             CCEEEEEEEECSSSSCHH------HHHHHHHHHHHHHHHSCB---STTSEEEEEEEESSSEEEEECTTCCCCHHHHHHHH
T ss_pred             CCEEEEEEEECCCCCCHH------HHHHHHHHHHHHHHHCCC---CCCCCEEEEEEEEEEEEEEEEEECCCCHHHHHHHH
T ss_conf             857899999487998868------999999999999997075---88874899999750138999852367589999999


Q ss_pred             HHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHCCCEEEEEEE
Q ss_conf             60133687744420367677643222333310257886564279998068778888806899999999978987999992
Q gi|254780934|r  248 KYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGI  327 (374)
Q Consensus       248 ~~l~~~g~~T~~~~~~~~a~~~l~~~~~~~~~~~~~~~~~~k~iillTDG~~~~~~~~~~~~~~~~~~k~~gi~IytIg~  327 (374)
                      +.+...|++|+++.++.++.+.+.......      .++.+|++|++|||..+..     ....++.+|+.||+||+||+
T Consensus        75 ~~l~~~gg~t~~~~al~~a~~~~~~~~~g~------R~~a~k~vvlltdg~~~~~-----~~~~~~~lk~~~i~v~~igi  143 (189)
T 1atz_A           75 DVMQREGGPSQIGDALGFAVRYLTSEMHGA------RPGASKAVVILVTDVSVDS-----VDAAADAARSNRVTVFPIGI  143 (189)
T ss_dssp             HTCCCCCCCCCHHHHHHHHHHHHHSCCTTC------CTTSEEEEEEEECSCCSSC-----CHHHHHHHHHTTEEEEEEEE
T ss_pred             HHHHHCCCCCCCCHHHHHHHHHHHHHHCCC------CCCCEEEEEEEECCCCCCC-----HHHHHHHHHHCCCEEEEEEE
T ss_conf             988743778763257899999974010279------9988058999925998651-----89999999988999999995


Q ss_pred             CCCCCHHHHHHHCCC---CCEEEECCHHHHH---HHHHHHHHHHHE
Q ss_conf             482227889982389---8179838989999---999999984200
Q gi|254780934|r  328 RVIRSHEFLRACASP---NSFYLVENPHSMY---DAFSHIGKDIVT  367 (374)
Q Consensus       328 ~~~~~~~~L~~~As~---~~~~~a~~~~~L~---~~f~~I~~~i~~  367 (374)
                      |...+.+.|+.+|+.   .+.|.+.+.++|.   +..+.|.+.||+
T Consensus       144 g~~~~~~~l~~ia~~~~~~~~~~~~~~~~l~~l~~~~~~~~~~iC~  189 (189)
T 1atz_A          144 GDRYDAAQLRILAGPAGDSNVVKLQRIEDLPTMVTLGNSFLHKLCS  189 (189)
T ss_dssp             SSSSCHHHHHHHTGGGGGGGCEEESSTTHHHHHHHSCSHHHHHC--
T ss_pred             CCCCCHHHHHHHHCCCCCCCEEEECCHHHHHHHHHHHHHHHHHHCC
T ss_conf             8869999999985788877589946876688899999999884477