HHsearch results for GI: 254780934 and protein with PDBid: 1m2o_A

>1m2o_A SEC23, protein transport protein SEC23, SEC23P; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 PDB: 1m2v_A 2qtv_A*
Probab=96.46  E-value=0.036  Score=30.25  Aligned_cols=170  Identities=14%  Similarity=0.068  Sum_probs=96.4

Q ss_pred             CEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEEECCCCEEEE----------------
Q ss_conf             7249999657864511313531379999998876322100236656734899998268505610----------------
Q gi|254780934|r  171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFF----------------  234 (374)
Q Consensus       171 ~~di~~VlD~SgSM~~~~~~~~~ki~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----------------  234 (374)
                      +--.+||+|.|.+.        ..++.+++++...++.+.      +..++|+++|+..+....                
T Consensus       121 pp~~vFvID~s~~s--------~~l~~l~~sl~~~l~~lp------~~~~VglITf~~~v~~~~l~~~~~~~~~v~~g~~  186 (768)
T 1m2o_A          121 PPIFFFVVDLTSET--------ENLDSLKESIITSLSLLP------PNALIGLITYGNVVQLHDLSSETIDRCNVFRGDR  186 (768)
T ss_dssp             CCEEEEEEECCSCH--------HHHHHHHHHHHHHHHTSC------TTCEEEEEEESSEEEECCCSSSSSEEEEEEETTS
T ss_pred             CCEEEEEEECCCCH--------HHHHHHHHHHHHHHHHCC------CCCEEEEEEECCEEEEEECCCCCCCCEEEECCCC
T ss_conf             98899999898656--------789999999999996199------9766999994787999988787766303632765


Q ss_pred             -------------------------------------------ECCCCHHHHHHHHHHCCCCCC--------CCCCCCHH
Q ss_conf             -------------------------------------------204786899999860133687--------74442036
Q gi|254780934|r  235 -------------------------------------------LLEWGVSHLQRKIKYLSKFGV--------STNSTPGL  263 (374)
Q Consensus       235 -------------------------------------------~~t~~~~~~~~~i~~l~~~g~--------~T~~~~~~  263 (374)
                                                                 ++...+..+.+.++.|....+        ....+.++
T Consensus       187 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~pl~e~~~~i~~lL~~L~~~~~~~~~~~~~~r~~g~Al  266 (768)
T 1m2o_A          187 EYQLEALTEMLTGQKPTGPGGAASHLPNAMNKVTPFSLNRFFLPLEQVEFKLNQLLENLSPDQWSVPAGHRPLRATGSAL  266 (768)
T ss_dssp             CCCHHHHHHHHHSCCCC---------------CCSSSGGGGSEEHHHHHHHHHHHHHTCCCSCSCCCTTBCCCCCHHHHH
T ss_pred             CCCHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHH
T ss_conf             53177776554035666654332346763222355541112466999999999999875303556743245766507899


Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCCEEEEEEECCCCCCCCC-------------C---------------HHHHHHHHHH
Q ss_conf             76776432223333102578865642799980687788888-------------0---------------6899999999
Q gi|254780934|r  264 KYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKE-------------D---------------QQSLYYCNEA  315 (374)
Q Consensus       264 ~~a~~~l~~~~~~~~~~~~~~~~~~k~iillTDG~~~~~~~-------------~---------------~~~~~~~~~~  315 (374)
                      ..|...+.....          +.--.|+++++|.+|.|.-             .               .-...++..+
T Consensus       267 ~~A~~ll~~~~~----------~~GgrI~~f~sg~pt~GpG~l~~~~~~~~~rs~~d~~~~~~~~~~~a~~fY~~la~~~  336 (768)
T 1m2o_A          267 NIASLLLQGCYK----------NIPARIILFASGPGTVAPGLIVNSELKDPLRSHHDIDSDHAQHYKKACKFYNQIAQRV  336 (768)
T ss_dssp             HHHHHHHHHHCT----------TSCCEEEEEESSCCCSSSSCCSCSBTTSCCCCHHHHHHTCCTTHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHC----------CCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHCCCCHHHHHHHHHHHH
T ss_conf             999999987506----------7887899992799987885341444344456644432101220451789999999999


Q ss_pred             HHCCCEEEEEEECCC-CCHHHHHHHC--CCCCEEEECCH--HHHHHHHHHHHHH
Q ss_conf             978987999992482-2278899823--89817983898--9999999999984
Q gi|254780934|r  316 KKRGAIVYAIGIRVI-RSHEFLRACA--SPNSFYLVENP--HSMYDAFSHIGKD  364 (374)
Q Consensus       316 k~~gi~IytIg~~~~-~~~~~L~~~A--s~~~~~~a~~~--~~L~~~f~~I~~~  364 (374)
                      .+.||.|....+..+ .+-..|+.++  |+|..|..++.  ..+.+.|....+.
T Consensus       337 ~~~~isvDiF~~s~~~~~l~~l~~l~~~TGG~v~~~~~f~~~~~~~~~~~~~~~  390 (768)
T 1m2o_A          337 AANGHTVDIFAGCYDQIGMSEMKQLTDSTGGVLLLTDAFSTAIFKQSYLRLFAK  390 (768)
T ss_dssp             HHHTCEEEEEEECSSCCSHHHHHHHHHHHTCCEEEESCTTSHHHHHHHHHTTCB
T ss_pred             HHCCEEEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCCCCCHHHHHHHHHH
T ss_conf             878979999981487667186653775388509970777520128999999865