HHsearch results for GI: 254780934 and protein with PDBid: 1m2v_B

>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1
Probab=96.19  E-value=0.05  Score=29.35  Aligned_cols=175  Identities=14%  Similarity=0.100  Sum_probs=100.0

Q ss_pred             CCEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEEECCCCEEE----------------
Q ss_conf             8724999965786451131353137999999887632210023665673489999826850561----------------
Q gi|254780934|r  170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEF----------------  233 (374)
Q Consensus       170 ~~~di~~VlD~SgSM~~~~~~~~~ki~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----------------  233 (374)
                      .+--++||+|.|.+.-..   +  -++.+++++...++.+..   .....+++++.|+..+...                
T Consensus       302 ~pp~~vFvIDvS~~av~s---g--~l~~~~~~i~~~L~~l~~---~~~~~~VglItfd~~V~~y~l~~~~~~~~~~~~~~  373 (926)
T 1m2v_B          302 PPATYCFLIDVSQSSIKS---G--LLATTINTLLQNLDSIPN---HDERTRISILCVDNAIHYFKIPLDSENNEESADQI  373 (926)
T ss_dssp             CCCBEEEEEECSHHHHHS---C--HHHHHHHHHHHTTTTSCC---TTSCCEECEEEESSSEEEEECCCC---------CC
T ss_pred             CCCEEEEEEECCHHHHHH---H--HHHHHHHHHHHHHHHCCC---CCCCCEEEEEEECCCEEEEECCCCCCCCCCCCCCC
T ss_conf             984899999898888777---8--999999999999974636---78773699999778489983577777643224675


Q ss_pred             --------------------EECCCCHHHHHHHHHHCCCC-----CCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             --------------------02047868999998601336-----87744420367677643222333310257886564
Q gi|254780934|r  234 --------------------FLLEWGVSHLQRKIKYLSKF-----GVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK  288 (374)
Q Consensus       234 --------------------~~~t~~~~~~~~~i~~l~~~-----g~~T~~~~~~~~a~~~l~~~~~~~~~~~~~~~~~~  288 (374)
                                          .++...+..+...++.|...     ..++..+.++..+...+...              -
T Consensus       374 ~~~~~~dl~~~f~p~~~~~l~~l~e~~~~i~~lL~~L~~~~~~~~~~~~~lG~Al~~a~~ll~~~--------------g  439 (926)
T 1m2v_B          374 NMMDIADLEEPFLPRPNSMVVSLKACRQNIETLLTKIPQIFQSNLITNFALGPALKSAYHLIGGV--------------G  439 (926)
T ss_dssp             EEEEECCCSSCCCSCSSSSSEETTTTHHHHHHHHHHHHHHTSSCCCCCCCHHHHHHHHHHHHTTT--------------C
T ss_pred             CCCCCCCHHHHCCCCCCCCEEEHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHCC--------------C
T ss_conf             20241014540567875434336887999999998425640688887323999999999987547--------------9


Q ss_pred             EEEEEEECCCCCCCC--------------CC----------HHHHHHHHHHHHCCCEEEEEEECCC-CCHHHHHHHC--C
Q ss_conf             279998068778888--------------80----------6899999999978987999992482-2278899823--8
Q gi|254780934|r  289 KIIVFMTDGENLSTK--------------ED----------QQSLYYCNEAKKRGAIVYAIGIRVI-RSHEFLRACA--S  341 (374)
Q Consensus       289 k~iillTDG~~~~~~--------------~~----------~~~~~~~~~~k~~gi~IytIg~~~~-~~~~~L~~~A--s  341 (374)
                      -.|+++++|..+.|.              ..          .-...++..+.+.+|.|..+.+..+ .+-..|..++  |
T Consensus       440 GkI~~f~sg~pt~G~G~l~~r~~~~~~~~~~e~~~~~~~~~~fY~~la~~~~~~~isvdlF~~~~~~~dla~l~~l~~~T  519 (926)
T 1m2v_B          440 GKIIVVSGTLPNLGIGKLQRRNESGVVNTSKETAQLLSCQDSFYKNFTIDCSKVQITVDLFLASEDYMDVASLSNLSRFT  519 (926)
T ss_dssp             EEEEEEESSCCCSSTTCCCCCCC----CCTTHHHHHTSCSSTHHHHHHHHHHHHTEEEEEEEEESSCCCHHHHHHHHHTT
T ss_pred             CEEEEEECCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCHHHHHHHHHHHHHHCCEEEEEEEECCCCCCHHHHHHHHHHC
T ss_conf             86999947898778863422555333466034454246217999999999997790799998048767738877777634


Q ss_pred             CCCEEEEC-----CHHHHHHHHHHHHHHHH
Q ss_conf             98179838-----98999999999998420
Q gi|254780934|r  342 PNSFYLVE-----NPHSMYDAFSHIGKDIV  366 (374)
Q Consensus       342 ~~~~~~a~-----~~~~L~~~f~~I~~~i~  366 (374)
                      +|..|.-+     ...+....+.++.+.++
T Consensus       520 GG~i~~y~~f~~~~~~d~~~l~~dl~~~~~  549 (926)
T 1m2v_B          520 AGQTHFYPGFSGKNPNDIVKFSTEFAKHIS  549 (926)
T ss_dssp             TCCEEEEESCCTTSHHHHHHHHHHHHHHHH
T ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             855998178764436778999999997533