HHsearch results for GI: 254780934 and protein with PDBid: 1q0p_A

>1q0p_A Complement factor B; VON willebrand factor, MAC-1, I domain, A domain, hydrolase; 1.80A {Homo sapiens} SCOP: c.62.1.1
Probab=99.91  E-value=8.5e-23  Score=153.05  Aligned_cols=189  Identities=17%  Similarity=0.214  Sum_probs=147.2

Q ss_pred             CCCCEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEEECCCCEEEEECCC----CHHHH
Q ss_conf             77872499996578645113135313799999988763221002366567348999982685056102047----86899
Q gi|254780934|r  168 TDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEW----GVSHL  243 (374)
Q Consensus       168 ~~~~~di~~VlD~SgSM~~~~~~~~~ki~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t~----~~~~~  243 (374)
                      ..+++||+||||.||||..      .+++.+|+++..+++.+...   ....|++++.|++.+....+++.    ++...
T Consensus        12 ~~~~~DivfvlD~SgSm~~------~~~~~~k~~~~~li~~~~~~---~~~~rvgvv~fs~~~~~~~~l~~~~~~~~~~~   82 (223)
T 1q0p_A           12 PSGSMNIYLVLDGSDSIGA------SNFTGAKKSLVNLIEKVASY---GVKPRYGLVTYATYPKIWVKVSEADSSNADWV   82 (223)
T ss_dssp             ---CEEEEEEEECSTTTCH------HHHHHHHHHHHHHHHHHHTT---TCCCEEEEEEESSSEEEEECTTSGGGGCHHHH
T ss_pred             CCCCEEEEEEEECCCCCCH------HHHHHHHHHHHHHHHHHCCC---CCCCEEEEEEECCCEEEEECCCCCCHHHHHHH
T ss_conf             9898618999948888882------88999999999999973368---87758999997593789970786302456789


Q ss_pred             HHHHHHCCC----CCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHH------
Q ss_conf             999860133----6877444203676776432223333102578865642799980687788888068999999------
Q gi|254780934|r  244 QRKIKYLSK----FGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCN------  313 (374)
Q Consensus       244 ~~~i~~l~~----~g~~T~~~~~~~~a~~~l~~~~~~~~~~~~~~~~~~k~iillTDG~~~~~~~~~~~~~~~~------  313 (374)
                      ...++.+..    .+++|++..++..+.+.+.....   .......+..|++||+|||.+|.+.+.......+.      
T Consensus        83 ~~~~~~i~~~~~~~~g~T~~~~Al~~a~~~~~~~~~---~~~~~~~~~~~~ivllTDG~~~~~~~~~~~~~~~~~~~~~~  159 (223)
T 1q0p_A           83 TKQLNEINYEDHKLKSGTNTKKALQAVYSMMSWPDD---VPPEGWNRTRHVIILMTDGLHNMGGDPITVIDEIRDLLYIG  159 (223)
T ss_dssp             HHHHHTCCTTSCSCTTCCCHHHHHHHHHHHHCCTTS---SCCTTGGGCEEEEEEEECSCCCSSSCTHHHHHHHHHHTTCS
T ss_pred             HHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHC---CCCCCCCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             999985454216688897599999999999864011---46666777742899976887677898289999998633467


Q ss_pred             ----HHHHCCCEEEEEEECCCCCHHHHHHHCCC----CCEEEECCHHHHHHHHHHHHHHHHEE
Q ss_conf             ----99978987999992482227889982389----81798389899999999999842001
Q gi|254780934|r  314 ----EAKKRGAIVYAIGIRVIRSHEFLRACASP----NSFYLVENPHSMYDAFSHIGKDIVTK  368 (374)
Q Consensus       314 ----~~k~~gi~IytIg~~~~~~~~~L~~~As~----~~~~~a~~~~~L~~~f~~I~~~i~~~  368 (374)
                          .+++.|+.+|+||+|.+.+...|+.+|+.    .+||.+.+.++|.++|.+|..+..++
T Consensus       160 ~~~~~~~~~g~~i~~igvg~~~~~~~L~~iAs~~~~~~~~~~~~d~~~L~~~~~~i~~e~~s~  222 (223)
T 1q0p_A          160 KDRKNPREDYLDVYVFGVGPLVNQVNINALASKKDNEQHVFKVKDMENLEDVFYQMIDESQSL  222 (223)
T ss_dssp             CBTTBCCGGGEEEEEEECSSCCCHHHHHHHSCCCTTCCCEEETTC-----------------C
T ss_pred             HHHHHHHHCCCEEEEEECCCCCCHHHHHHHHCCCCCCEEEEECCCHHHHHHHHHHHHHHHCCC
T ss_conf             999998767965999736875699999999749899747999089999999999999861478