HHsearch results for GI: 254780934 and protein with PDBid: 2x31_A

>2x31_A Magnesium-chelatase 60 kDa subunit; ligase, bacteriochlorophyll biosynthesis, photosynthesis; 7.50A {Rhodobacter capsulatus}
Probab=99.64  E-value=9.6e-18  Score=122.97  Aligned_cols=169  Identities=15%  Similarity=0.185  Sum_probs=118.7

Q ss_pred             CCEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEEECCCCEE-EEECCCCHHHHHHHHH
Q ss_conf             872499996578645113135313799999988763221002366567348999982685056-1020478689999986
Q gi|254780934|r  170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE-FFLLEWGVSHLQRKIK  248 (374)
Q Consensus       170 ~~~di~~VlD~SgSM~~~~~~~~~ki~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~t~~~~~~~~~i~  248 (374)
                      .+.+|+||+|.||||...      |++.+|.++..++......     ..+++++.|...... ..+++.+....+..++
T Consensus         4 ~~~~iv~vlD~SGSM~~~------~~~~~k~~~~~~l~~~~~~-----~d~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~   72 (189)
T 2x31_A            4 SDRVLIFAVDASGSAAVA------RLSEAKGAVELLLGRAYAA-----RDHVSLITFRGTAAQVLLQPSRSLTQTKRQLQ   72 (189)
T ss_dssp             SCCEEEEEEECCTTSCC--------CHHHHHHHHHHHHHSCTT-----TSCCCEEEESBSCCCBCTTTCSCHHHHHHHHH
T ss_pred             CCCEEEEEEEECCCCCCH------HHHHHHHHHHHHHHHHCCC-----CCEEEEEEEEECCCCCCCCCCCCHHHHHHHHH
T ss_conf             774699999817578926------9999999999999972568-----96799999993243135887468999999985


Q ss_pred             HCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEEECCCCCCCCCCHHHHHH--------HHHHHHCCC
Q ss_conf             013368774442036767764322233331025788656427999806877888880689999--------999997898
Q gi|254780934|r  249 YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYY--------CNEAKKRGA  320 (374)
Q Consensus       249 ~l~~~g~~T~~~~~~~~a~~~l~~~~~~~~~~~~~~~~~~k~iillTDG~~~~~~~~~~~~~~--------~~~~k~~gi  320 (374)
                      .+.+.| +|+...++..++..+...         ..+...++|||+|||.+|.+.........        +...+..||
T Consensus        73 ~~~~~G-gT~~~~al~~a~~~~~~~---------~~~~~~~~iillTDG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gi  142 (189)
T 2x31_A           73 GLPGGG-GTPLASGMEMAMVTAKQA---------RSRGMTPTIALLTDGRGNIALDGTANRELAGEQATKVARAIRASGM  142 (189)
T ss_dssp             HCCCCB-CCCCHHHHHHHHHHHHTC---------TTTCSSEEEEECCBSCCSSCCTHHHHHGGGTCCCEEEEECTGGGGS
T ss_pred             HCCCCC-CCCHHHHHHHHHHHHHHH---------CCCCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             344579-861789999999999972---------2458877799964798776878604589999999999999872698


Q ss_pred             EEEEEEECCCCCHHHHHHHC--CCCCEEEECCH--HHHHHHHHH
Q ss_conf             79999924822278899823--89817983898--999999999
Q gi|254780934|r  321 IVYAIGIRVIRSHEFLRACA--SPNSFYLVENP--HSMYDAFSH  360 (374)
Q Consensus       321 ~IytIg~~~~~~~~~L~~~A--s~~~~~~a~~~--~~L~~~f~~  360 (374)
                      .+++|+++.. ....|+++|  ++|+||..++.  ++|.+++.+
T Consensus       143 ~~~~i~~g~~-~~~~l~~iA~~~gG~y~~~~~~~~~~l~~~~~~  185 (189)
T 2x31_A          143 PAVIIDTAMR-PNPALVDLARTMDAHYIALPRATAHKMADVLGA  185 (189)
T ss_dssp             CCTHHHHHHS-SCSSSCSTTTEEEESSTTTHHHHHHHHHHHHHH
T ss_pred             CEEEEECCCC-CHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHH
T ss_conf             3799847978-769999999761999997599999999999999