HHsearch results for GI: 254780934 and protein with PDBid: 3hrz_D

>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement system, convertase, complement alternate pathway, complement pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 3hs0_D* 2ok5_A*
Probab=99.87  E-value=2.6e-20  Score=138.20  Aligned_cols=190  Identities=16%  Similarity=0.199  Sum_probs=146.3

Q ss_pred             CCCCEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEEECCCCEEEEECC----CCHHHH
Q ss_conf             7787249999657864511313531379999998876322100236656734899998268505610204----786899
Q gi|254780934|r  168 TDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLE----WGVSHL  243 (374)
Q Consensus       168 ~~~~~di~~VlD~SgSM~~~~~~~~~ki~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t----~~~~~~  243 (374)
                      ...++|++|++|.|+||...      +++.+++.++.+++.+...+   ...|++++.|++.......++    .++..+
T Consensus       240 ~~~~~Dl~f~lD~S~s~~~~------~f~~~k~f~~~lv~~~~~~~---~~~rv~vi~ys~~~~~~~~l~~~~~~~~~~~  310 (741)
T 3hrz_D          240 PSGSMNIYLVLDGSGSIGAS------DFTGAKKCLVNLIEKVASYG---VKPRYGLVTYATYPKIWVKVSEADSSNADWV  310 (741)
T ss_dssp             TTCEEEEEEEEECSTTTCHH------HHHHHHHHHHHHHHHHHHTT---CCCEEEEEEESSSEEEEECTTSGGGGCHHHH
T ss_pred             CCCCCEEEEEEECCCCCCHH------HHHHHHHHHHHHHHHCCCCC---CCCEEEEEEECCCCEEEEECCCCCCCCHHHH
T ss_conf             68881389999656654877------89999999999998634688---8746999996477158885166667899999


Q ss_pred             HHHHHHCCC----CCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEEECCCCCCCCCCHHHHHHH-------
Q ss_conf             999860133----687744420367677643222333310257886564279998068778888806899999-------
Q gi|254780934|r  244 QRKIKYLSK----FGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYC-------  312 (374)
Q Consensus       244 ~~~i~~l~~----~g~~T~~~~~~~~a~~~l~~~~~~~~~~~~~~~~~~k~iillTDG~~~~~~~~~~~~~~~-------  312 (374)
                      ...|+.|..    .+++|+++.|+.++.+.+.....   +......+.+|++||+|||..+.+..+.......       
T Consensus       311 ~~~i~~i~~~~~~~~ggT~t~~Al~~~~~~~~~~~~---~~~~~~~~~~~vlillTDG~s~~g~~p~~~~~~~~~~~~~~  387 (741)
T 3hrz_D          311 TKQLNEINYEDHKLKSGTNTKKALQAVYSMMSWPDD---VPPEGWNRTRHVIILMTDGLHNMGGDPITVIDEIRDLLYIG  387 (741)
T ss_dssp             HHHHTTCCGGGGSSSCCCCHHHHHHHHHHHHCCC-----CCCTTGGGEEEEEEEEECSCCCSSSCTHHHHHHHHHHTTCS
T ss_pred             HHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHC---CCCCCCCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             999971776667788875899999999986421101---57555678985999989986557888324444322122234


Q ss_pred             ---HHHHHCCCEEEEEEECCCCCHHHHHHHCC-C---CCEEEECCHHHHHHHHHHHHHHHHEEE
Q ss_conf             ---99997898799999248222788998238-9---817983898999999999998420016
Q gi|254780934|r  313 ---NEAKKRGAIVYAIGIRVIRSHEFLRACAS-P---NSFYLVENPHSMYDAFSHIGKDIVTKR  369 (374)
Q Consensus       313 ---~~~k~~gi~IytIg~~~~~~~~~L~~~As-~---~~~~~a~~~~~L~~~f~~I~~~i~~~~  369 (374)
                         +.+++.||.||+||+|.+.+...|+.+|+ +   .++|.+.+.++|.+++.+|.+..+..+
T Consensus       388 ~~~~~~~~~gi~i~~igvg~~~~~~~L~~iAs~~~~~~~v~~~~d~~~L~~~~~~~~~~~~~~~  451 (741)
T 3hrz_D          388 KDRKNPREDYLDVYVFGVGPLVNQVNINALASKKDNEQHVFKVKDMENLEDVFYQMIDESQSLS  451 (741)
T ss_dssp             SCTTCCCGGGEEEEEEECSSSCCHHHHHHHSCCCTTCCCEECBSSHHHHHHHHHHHHHHHSCTT
T ss_pred             HHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHCCCCCCEEEEECCHHHHHHHHHHHHCCCCCCC
T ss_conf             6677788789399999867758999999997088886239996899998888744300232344