BLAST/PSIBLAST alignment of GI: 254780934 and GI: 315122347 at iteration 1
>gi|315122347|ref|YP_004062836.1| hypothetical protein CKC_02995 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 362
>gi|313495749|gb|ADR52348.1| hypothetical protein CKC_02995 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 362
 Score =  206 bits (525), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 118/370 (31%), Positives = 215/370 (58%), Gaps = 29/370 (7%)

Query: 6   LNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQI 65
           + IRNFF N +G +TI +AI  P+I +++ ++ E+S+I+  K  L ++IDR+L+   T I
Sbjct: 4   IKIRNFFQNKRGIITITSAIIFPLIIILMAIVFEMSNIYLEKERLQAVIDRALLDTVTMI 63

Query: 66  MNEGNGNNRKKLKGGDILCR----IKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVV 121
                     KLK  + + +    +   W  + + EL  + F +D+ +++  TS+ +   
Sbjct: 64  ----------KLKNIEDVVKNVGPVNTIWTKNLKYELEHSDFSSDVQNVIDDTSMKLESD 113

Query: 122 PQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVS 181
              +  SI+AIS+YK+P K C        ++++ +P+ SS+K+     + +D+MIVLDVS
Sbjct: 114 SNFKTLSITAISQYKMPFKICNIHLLCPKNKYVTVPVLSSMKIGRNEGSDIDLMIVLDVS 173

Query: 182 RSMESFF----DSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLE 237
            SM+  F    ++  +++++A KSI  MLE+ + +P+  NV ++G V F++ ++    L+
Sbjct: 174 SSMDDNFMKPEEAPCSRLEVAKKSIRKMLEDFRKVPNYANVFRTGSVGFNDMVQFPMPLK 233

Query: 238 WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDA-NYKKIIVFMTD 296
            G+  +   IK    FG STNS  G+KYA+ Q++         N +D  + KKI++F+TD
Sbjct: 234 RGLKRIYNDIKKYRAFG-STNSYVGMKYAWEQLYG--------NPQDTKDRKKIVIFLTD 284

Query: 297 GENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYD 356
           GEN+     ++++  CN+ KK+ A++Y+I + V  + E L+ C+S  + Y  ++  S+  
Sbjct: 285 GENMIINATRKTIELCNDMKKKKAVIYSIALAV-DNKEVLQGCSSSGNVYAADDAQSLVQ 343

Query: 357 AFSHIGKDIV 366
           A+S IGKD++
Sbjct: 344 AYSLIGKDVM 353