BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780934|ref|YP_003065347.1| hypothetical protein
CLIBASIA_04165 [Candidatus Liberibacter asiaticus str. psy62]
         (374 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780934|ref|YP_003065347.1| hypothetical protein CLIBASIA_04165 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040611|gb|ACT57407.1| hypothetical protein CLIBASIA_04165 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 374

 Score =  776 bits (2004), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/374 (100%), Positives = 374/374 (100%)

Query: 1   MFSLNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVH 60
           MFSLNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVH
Sbjct: 1   MFSLNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVH 60

Query: 61  AATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVV 120
           AATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVV
Sbjct: 61  AATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVV 120

Query: 121 VPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDV 180
           VPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDV
Sbjct: 121 VPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDV 180

Query: 181 SRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGV 240
           SRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGV
Sbjct: 181 SRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGV 240

Query: 241 SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENL 300
           SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENL
Sbjct: 241 SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENL 300

Query: 301 STKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSH 360
           STKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSH
Sbjct: 301 STKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSH 360

Query: 361 IGKDIVTKRIWYDK 374
           IGKDIVTKRIWYDK
Sbjct: 361 IGKDIVTKRIWYDK 374


>gi|254780833|ref|YP_003065246.1| hypothetical protein CLIBASIA_03630 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040510|gb|ACT57306.1| hypothetical protein CLIBASIA_03630 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 371

 Score =  408 bits (1048), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 203/370 (54%), Positives = 273/370 (73%), Gaps = 3/370 (0%)

Query: 6   LNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQI 65
           LNIRNFFYN KG ++ILTAI LP+IF+V+G++IE SH FF+K  LH ++D SL++ AT+I
Sbjct: 4   LNIRNFFYNCKGSISILTAILLPVIFIVMGLVIETSHKFFVKAKLHYILDHSLLYTATKI 63

Query: 66  MNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNE 125
           +N+ NGNN KK K       IKN W   FRNELR+NGF  DI++I RSTSL I++  Q++
Sbjct: 64  LNQENGNNGKKQKNDFSYRIIKNIWQTDFRNELRENGFAQDINNIERSTSLSIIIDDQHK 123

Query: 126 GYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSME 185
            Y++SA+SRY++P  FCTF PW  NS H  + ITSSVK++S++D  LDMM+VLDVS SM 
Sbjct: 124 DYNLSAVSRYEMPFIFCTF-PWCANSSHAPLLITSSVKISSKSDIGLDMMMVLDVSLSMN 182

Query: 186 SFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQR 245
             F   + K+ +A +SI  ML+ +K IPDVNNVV+SGLVTFS+KI + F L WGV H+Q 
Sbjct: 183 DHFGPGMDKLGVATRSIREMLDIIKSIPDVNNVVRSGLVTFSSKIVQTFPLAWGVQHIQE 242

Query: 246 KIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTK-E 304
           KI  L  FG +T STPGL+YAYN+IFD +   +H      +YKK I+F+TDGEN S   +
Sbjct: 243 KINRLI-FGSTTKSTPGLEYAYNKIFDAKEKLEHIAKGHDDYKKYIIFLTDGENSSPNID 301

Query: 305 DQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKD 364
           +++SL+YCNEAK+RGAIVYAIG++   + +FL+ CASP+ FY V+N   ++DAF  IGK+
Sbjct: 302 NKESLFYCNEAKRRGAIVYAIGVQAEAADQFLKNCASPDRFYSVQNSRKLHDAFLRIGKE 361

Query: 365 IVTKRIWYDK 374
           +V +RI Y+K
Sbjct: 362 MVKQRILYNK 371


>gi|315122347|ref|YP_004062836.1| hypothetical protein CKC_02995 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495749|gb|ADR52348.1| hypothetical protein CKC_02995 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 362

 Score =  206 bits (525), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 118/370 (31%), Positives = 215/370 (58%), Gaps = 29/370 (7%)

Query: 6   LNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQI 65
           + IRNFF N +G +TI +AI  P+I +++ ++ E+S+I+  K  L ++IDR+L+   T I
Sbjct: 4   IKIRNFFQNKRGIITITSAIIFPLIIILMAIVFEMSNIYLEKERLQAVIDRALLDTVTMI 63

Query: 66  MNEGNGNNRKKLKGGDILCR----IKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVV 121
                     KLK  + + +    +   W  + + EL  + F +D+ +++  TS+ +   
Sbjct: 64  ----------KLKNIEDVVKNVGPVNTIWTKNLKYELEHSDFSSDVQNVIDDTSMKLESD 113

Query: 122 PQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVS 181
              +  SI+AIS+YK+P K C        ++++ +P+ SS+K+     + +D+MIVLDVS
Sbjct: 114 SNFKTLSITAISQYKMPFKICNIHLLCPKNKYVTVPVLSSMKIGRNEGSDIDLMIVLDVS 173

Query: 182 RSMESFF----DSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLE 237
            SM+  F    ++  +++++A KSI  MLE+ + +P+  NV ++G V F++ ++    L+
Sbjct: 174 SSMDDNFMKPEEAPCSRLEVAKKSIRKMLEDFRKVPNYANVFRTGSVGFNDMVQFPMPLK 233

Query: 238 WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDA-NYKKIIVFMTD 296
            G+  +   IK    FG STNS  G+KYA+ Q++         N +D  + KKI++F+TD
Sbjct: 234 RGLKRIYNDIKKYRAFG-STNSYVGMKYAWEQLYG--------NPQDTKDRKKIVIFLTD 284

Query: 297 GENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYD 356
           GEN+     ++++  CN+ KK+ A++Y+I + V  + E L+ C+S  + Y  ++  S+  
Sbjct: 285 GENMIINATRKTIELCNDMKKKKAVIYSIALAV-DNKEVLQGCSSSGNVYAADDAQSLVQ 343

Query: 357 AFSHIGKDIV 366
           A+S IGKD++
Sbjct: 344 AYSLIGKDVM 353


>gi|163760496|ref|ZP_02167578.1| hypothetical protein HPDFL43_04296 [Hoeflea phototrophica DFL-43]
 gi|162282447|gb|EDQ32736.1| hypothetical protein HPDFL43_04296 [Hoeflea phototrophica DFL-43]
          Length = 363

 Score = 84.3 bits (207), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 77/367 (20%), Positives = 154/367 (41%), Gaps = 37/367 (10%)

Query: 8   IRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMN 67
           IR    N  G   ++ A  +P++F+   + ++ ++   MK  L + +D + +  A ++  
Sbjct: 10  IRKLLRNENGNFALIAAAAVPVLFMAGSLAVDTTNAMSMKVRLQNAVDSAALATAARLSE 69

Query: 68  EGNGNNRKKLKGGDILCRIKNTWNMSFRN-ELRD-----NGFVNDIDDIVRSTSLDIVVV 121
           E N           +       + + F N ++++     NGF      +  + ++D V  
Sbjct: 70  EEN-----------LTAAQAQAFALKFVNGQVKEDFGAFNGF-----SVTPTVNIDPV-- 111

Query: 122 PQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVS 181
            +  G ++  ++      +  T +        + + +    +   +      M +VLD S
Sbjct: 112 -ETGGRTVWKVAVSMEGSQSLTPMARIMGKDKLTVSVVGKSESAGEAQGAFSMALVLDRS 170

Query: 182 RSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVS 241
            SM+   +    KI++   ++  ++E+ +        V+ G  ++++K+     L W   
Sbjct: 171 GSMDWNLNGQ-KKINVLKTAVGGLIEQFEEADPERKYVRLGASSYNSKLTGSTKLRWNPG 229

Query: 242 HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY----KKIIVFMTDG 297
             +  +  L   G  T+ST    +AY  +      ++  NT DA      KK IVFMTDG
Sbjct: 230 KTKEFVDALPASG-GTDSTDAFDWAYTAVT----HKRENNTHDAKSGQVPKKFIVFMTDG 284

Query: 298 ENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI-RSHEFLRACASPNS-FYLVENPHSMY 355
           +N  +  D  + + C++AK  G  VY +      R  + L  CAS    F+  +N   + 
Sbjct: 285 DNNYSSADSSTKHLCDDAKDDGIEVYTVAFAAPNRGKQLLSYCASTEEHFFDAQNSAQLI 344

Query: 356 DAFSHIG 362
           +AF +IG
Sbjct: 345 EAFKNIG 351


>gi|254780388|ref|YP_003064801.1| hypothetical protein CLIBASIA_01365 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040065|gb|ACT56861.1| hypothetical protein CLIBASIA_01365 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 458

 Score = 81.3 bits (199), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 62/210 (29%), Positives = 100/210 (47%), Gaps = 21/210 (10%)

Query: 178 LDVSRSMESFFDSS-----ITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           LD S S E F DSS     I K  +   ++ +++  +K I +VN+ V+ G   F++++  
Sbjct: 249 LDPSLSEEHFVDSSSLRHVIKKKHLVRDALASVIRSIKKIDNVNDTVRMGATFFNDRVIS 308

Query: 233 FFLLEWGVSHLQRKIKYLSKFGVSTNS------TPGLKYAYNQIFDMQGMRQHCNTEDAN 286
                WGV  L R I  +  F +  N          ++ AY+ I        H    +  
Sbjct: 309 DPSFSWGVHKLIRTI--VKTFAIDENEMGSTAINDAMQTAYDTIISSNEDEVHRMKNNLE 366

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHE-----FLRACAS 341
            KK IV +TDGEN  T+++++ +  CN+AK +G  +  I   V ++ +     FL  CAS
Sbjct: 367 AKKYIVLLTDGEN--TQDNEEGIAICNKAKSQGIRIMTIAFSVNKTQQEKARYFLSNCAS 424

Query: 342 PNSFYLVENPHSMYDAF-SHIGKDIVTKRI 370
           PNSF+   + H +   F   IG +I  + I
Sbjct: 425 PNSFFEANSTHELNKIFRDRIGNEIFERVI 454



 Score = 38.1 bits (87), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 28/130 (21%), Positives = 58/130 (44%), Gaps = 23/130 (17%)

Query: 17  GGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKK 76
           G   I+TA+ +P++  V GM+++V    + +  L      +++ A+  ++          
Sbjct: 20  GHFFIITALLMPVMLGVGGMLVDVVRWSYYEHALKQAAQTAIITASVPLIQSLE------ 73

Query: 77  LKGGDILCRIKNTWNM-----------SFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNE 125
               ++  R KN++             +F N L+ N    ++ DIVR T++++   P+  
Sbjct: 74  ----EVSSRAKNSFTFPKQKIEEYLIRNFENNLKKNFTDREVRDIVRDTAVEM--NPRKS 127

Query: 126 GYSISAISRY 135
            Y +   SRY
Sbjct: 128 AYQVVLSSRY 137


>gi|241206334|ref|YP_002977430.1| hypothetical protein Rleg_3648 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860224|gb|ACS57891.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 400

 Score = 75.9 bits (185), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 88/174 (50%), Gaps = 7/174 (4%)

Query: 193 TKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSK 252
           TKI+    ++  +  E+  +      V++G V+++ ++++   L+WG +H+    KY++K
Sbjct: 218 TKIEALKLAVGTLTGELDAVDPEKEYVRTGAVSYNIEMQKAKALDWGTAHV---TKYVNK 274

Query: 253 FGVS--TNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLY 310
              +  T+S    K AYN++ D    + H +       K IVFMTDG+N  T  D ++  
Sbjct: 275 LTATDGTDSGEAFKTAYNKLADAAEDKAHVDKTGQVPTKYIVFMTDGDNNYTSADTETKT 334

Query: 311 YCNEAKKRGAIVYAIG-IRVIRSHEFLRACA-SPNSFYLVENPHSMYDAFSHIG 362
           +C++A+     VY I  +   R    L  CA +P +++   +  ++  AF  IG
Sbjct: 335 WCDKARDAKMQVYTIAFMAPARGQALLSYCATAPGNYFPAGDMTALLKAFKEIG 388


>gi|222087111|ref|YP_002545646.1| hypothetical protein Arad_3867 [Agrobacterium radiobacter K84]
 gi|221724559|gb|ACM27715.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 401

 Score = 71.6 bits (174), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 83/174 (47%), Gaps = 4/174 (2%)

Query: 192 ITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRK-IKYL 250
           I KI     ++  +L+++      +  V++  + +S++++    L WG +  +   I  L
Sbjct: 217 IKKIAALKTAVGTLLDQLDSADPKSQYVRTAAIAWSSEVDSSSALAWGTTTTRSNVISGL 276

Query: 251 SKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLY 310
           +  G + +S P +  AY  +             +  ++KIIV MTDGEN +T  D ++L 
Sbjct: 277 NANGGTESSAP-MALAYKNVSASSEATAQAAKGNTTFQKIIVLMTDGENNATSSDTKTLA 335

Query: 311 YCNEAKKRGAIVYAIGIRVI-RSHEFLRACA-SPNSFYLVENPHSMYDAFSHIG 362
            C  AK  G ++Y++      R    L+ CA SP++++  +    +  AF  IG
Sbjct: 336 TCKAAKDAGVLIYSVAFMAPDRGQTLLKNCASSPSNYFDAQQMSDLIAAFKTIG 389


>gi|150397936|ref|YP_001328403.1| von Willebrand factor type A [Sinorhizobium medicae WSM419]
 gi|150029451|gb|ABR61568.1| von Willebrand factor type A [Sinorhizobium medicae WSM419]
          Length = 419

 Score = 71.2 bits (173), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 86/407 (21%), Positives = 162/407 (39%), Gaps = 54/407 (13%)

Query: 5   NLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQ 64
            L+      +  G   ++TA+  P++  V G+ ++V+++   K  L    D + + AA+ 
Sbjct: 8   GLSFMRMLRDRGGNFGMMTALVAPLLLAVGGVSVDVANMLMTKNQLQDATDAAALAAASA 67

Query: 65  IMNEGNGNNRKKLKGGDILCR--IKNTWNMSFRNELRDNGFV-------NDIDDI----- 110
           ++++     R  ++    L R  +K     +  ++L D G         N  D++     
Sbjct: 68  LVSDA----RPDIEEAKDLARKFLKTQAAAATASDLPDEGPSIGARGGGNADDEVPATPR 123

Query: 111 ---VRSTSLDIVVVPQN-EGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNS 166
              V +T +DI   P   +G S       K  L+F   +        I +   S+ +  +
Sbjct: 124 WEDVNATEIDITATPNGAKGKSFQVTVANKHLLQF-NAMTRLLGPESIEIETRSTAESAT 182

Query: 167 QTDARLDMMIVLDVSRSM----------------------------ESFFDSSITKIDMA 198
           ++   L M +VLD S SM                            ++     +TKID  
Sbjct: 183 ESKNALSMYLVLDRSGSMAWKTNTINTGKAKCPNYTEANWSKYPDLKATGPCYVTKIDAL 242

Query: 199 IKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTN 258
             ++  +L ++      +  V++G +++++  +    L WG       +  L   G  T 
Sbjct: 243 KTAVGDLLAQLVTADPESAYVRTGAISYNSAQDAASSLSWGTRGAAGYVDALVAIG-GTA 301

Query: 259 STPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKR 318
           S    K A+ ++ +     +H         K IVFMTDGEN    +D  +  +C+ AK  
Sbjct: 302 SGNAFKTAFQKVTNAAEDSEHGAKNGQVPTKYIVFMTDGENNHANDDTVTRQWCDTAKAS 361

Query: 319 GAIVYAIGIRVI-RSHEFLRACASPNSFYL-VENPHSMYDAFSHIGK 363
              +Y++      R  + L++CAS +S Y   E    +  AF  IG+
Sbjct: 362 KVQIYSVAFMAPDRGQKLLKSCASSSSHYFEAEEASDLVAAFKAIGE 408


>gi|315122199|ref|YP_004062688.1| hypothetical protein CKC_02245 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495601|gb|ADR52200.1| hypothetical protein CKC_02245 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 463

 Score = 63.5 bits (153), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 86/180 (47%), Gaps = 10/180 (5%)

Query: 201 SINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIK--YLSKF-GVST 257
           ++   ++ V+ I ++ + ++   + F+ +I+ +F + WG+   ++++   Y  K    +T
Sbjct: 280 ALATFIKRVRKIDNLKDKLRMSFMYFNERIDHYFPMTWGIKEFKQEVSSHYKRKHENTAT 339

Query: 258 NSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDG-ENLSTKEDQQSLYYCNEAK 316
           +  P L+ AYN++       +H        KK IV +TDG +N         L  C+ AK
Sbjct: 340 DIHPILQEAYNKLHSKNEDDEHKKKNSVEVKKFIVLLTDGAQNEGVHSVDSVLKICDAAK 399

Query: 317 KRGAIVYAIGIRV-----IRSHEFLRACASPNSFYLVENPHSMYDAF-SHIGKDIVTKRI 370
           + G  ++ I   V      ++++FL  CASP+ F+   +   +   F  HIG  I  + +
Sbjct: 400 EEGIKIFTISYSVDSSERKKANDFLSRCASPDKFFEAYDADKLNMIFKEHIGDAIFERLV 459



 Score = 42.0 bits (97), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 46/201 (22%), Positives = 90/201 (44%), Gaps = 20/201 (9%)

Query: 3   SLNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAA 62
           SL  N +     Y G   +++A+ LP+IF+V+G++I++    +    L   ++ + + A+
Sbjct: 6   SLFFNFKRLKKCYNGSFFVISALLLPVIFMVIGLLIDLVRWGYYHNSLVQAVNTAALSAS 65

Query: 63  TQIMNEGNGNNRKK-----LKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLD 117
            Q++N     +++K     L   +I   + N   +S  N   +     D   I++ T ++
Sbjct: 66  VQLLNSVEDKSKEKALSSVLGENNIKQYLLNNLKISLYNNFGE----MDSQRIIQHTKVN 121

Query: 118 IVVVPQNEGYSISAISRYKIPLK-FCTFIPWYTNSRHIVMPITS------SVKVNSQTDA 170
           I    +   + I+  S Y +PL  F  F     N +    PIT+      + K N   + 
Sbjct: 122 I--YNRKGTHIINVYSHYNLPLNPFSLFFMNLINIKS--WPITTVGEAEVTSKKNYHKEE 177

Query: 171 RLDMMIVLDVSRSMESFFDSS 191
            + +  ++D S SM S  D +
Sbjct: 178 GVSVQWLIDDSGSMGSIIDRA 198


>gi|307945905|ref|ZP_07661241.1| putative von Willebrand factor type A [Roseibium sp. TrichSKD4]
 gi|307771778|gb|EFO31003.1| putative von Willebrand factor type A [Roseibium sp. TrichSKD4]
          Length = 432

 Score = 62.8 bits (151), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 77/376 (20%), Positives = 148/376 (39%), Gaps = 30/376 (7%)

Query: 7   NIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIM 66
            I N      G +  L  I + ++  V+ + I++S  F  +T L +  D + V     ++
Sbjct: 70  GIPNAHKERDGSILPLFGILIMLLLAVVTIGIDMSQTFGERTRLQTAADMAAVQTGRALL 129

Query: 67  NEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEG 126
            E     +      D   RI +   +S   +      +     +  +  +   V      
Sbjct: 130 AEEITIAQANAYAKDAFNRIAS--GLSASGDGSSGTSIFGTMTVKPAVQITETVDGNTTN 187

Query: 127 YSISAISRYKIPLKFCTFI--PWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSM 184
           Y +      KIP    +F+     T    I +   S     ++  A L M +VLD S SM
Sbjct: 188 YVVKVNGTAKIPASPLSFMFFDGETGKNTISLGFESETTAKAEAGASLSMALVLDRSGSM 247

Query: 185 ESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF----SNKIEEFFLLEWGV 240
                S ++++  A++S   +++E++ +   +   + G   +    + K E    L W  
Sbjct: 248 GWERPSRMSELKKAVRS---LIKELQTVDPDDQFTRLGAYAYHWYYAGKKE----LTWNK 300

Query: 241 SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDG--- 297
           + ++  +  L   G  T + P ++ A N +     +  H N  +      I++MTDG   
Sbjct: 301 NSVRSWVNSLPASG-GTRAAPAIQKAKNDLLTNSELNAHINKNEQEPDLFILYMTDGIDG 359

Query: 298 -ENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRS-HEFLRACASPNS-FYLVENPHSM 354
             N + +E       C  AK  G  +Y +  +   S    L+ACA+ ++ +Y  +N + +
Sbjct: 360 DPNWAKRE-------CTSAKNAGITIYTVAFKAPASGRNLLKACATSDAHYYDAKNANEL 412

Query: 355 YDAFSHIGKDIVTKRI 370
              F  I ++  TK I
Sbjct: 413 NKVFKDIARE-TTKSI 427


>gi|254781110|ref|YP_003065523.1| von Willebrand factor type A [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040787|gb|ACT57583.1| von Willebrand factor type A [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 420

 Score = 62.4 bits (150), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 86/400 (21%), Positives = 169/400 (42%), Gaps = 51/400 (12%)

Query: 16  KGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMN-------- 67
           K   +I+ A+ +    L++G +I V    + K  + S  + +++  A+++++        
Sbjct: 19  KANFSIIFALSVMSFLLLIGFLIYVLDWHYKKNSMESANNAAILAGASKMVSNLSRLGDR 78

Query: 68  -EGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVN-DIDDIVRSTSLDIVVVPQNE 125
            E   N+ K+    D    IKN    S         F N +I +IV S+ + +  +  N 
Sbjct: 79  FESISNHAKRALIDDAKRFIKNHIKESLSG--YSAVFYNTEIQNIVNSSRISMTHMANNR 136

Query: 126 --------GYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIV 177
                    Y++  ++ Y   L+F   +     ++ IV  I + +++         + +V
Sbjct: 137 LDSSNNTIFYNMDVMTSYDYRLQFIEHLLNQRYNQKIVSFIPALLRIEMGERPIFLIELV 196

Query: 178 LDVSRSMESFF--------------DSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGL 223
           +D+S SM                  D   TK+     ++   L+ + L+  V   V  GL
Sbjct: 197 VDLSGSMHCAMNSDPEDVNSAPICQDKKRTKMAALKNALLLFLDSIDLLSHVKEDVYMGL 256

Query: 224 VTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVS-----TNSTPGLKYAYN-------QIF 271
           + ++ ++E+     WG   ++   +Y+++   S     T+STP +K AY        + F
Sbjct: 257 IGYTTRVEKNIEPSWGTEKVR---QYVTRDMDSLILKPTDSTPAMKQAYQILTSDKKRSF 313

Query: 272 DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV-I 330
                RQ        ++K I+F+TDGEN + K +  ++  C++AK+    +  I I    
Sbjct: 314 FTNFFRQGVKIPSLPFQKFIIFLTDGENNNFKSNVNTIKICDKAKENFIKIVTISINASP 373

Query: 331 RSHEFLRAC-ASPNSFYLVENPHSMYDAFSHIGKDIVTKR 369
                L+ C +SP   Y V N  S+   F +I + +V ++
Sbjct: 374 NGQRLLKTCVSSPEYHYNVVNADSLIHVFQNISQLMVHRK 413


>gi|227823417|ref|YP_002827390.1| hypothetical protein NGR_c28930 [Sinorhizobium fredii NGR234]
 gi|227342419|gb|ACP26637.1| hypothetical protein NGR_c28930 [Sinorhizobium fredii NGR234]
          Length = 413

 Score = 62.4 bits (150), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 78/175 (44%), Gaps = 5/175 (2%)

Query: 192 ITKIDMAIKSINAMLEEVKLIPDVNNV-VQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYL 250
           +TKID    ++  +L ++ L+ D + + V++  +++++  +    L WG S     +  L
Sbjct: 230 VTKIDALKTAVTDLLAQL-LVADPDQIYVRTAAISYNSVQDTAGTLAWGTSGAAAYVNAL 288

Query: 251 SKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLY 310
              G  T S    K AY ++        H         K +VFMTDGEN    +D  +  
Sbjct: 289 VATG-GTASAGAFKTAYQKVIAATENTAHAAKNGQVPSKYMVFMTDGENNYANDDTVTKQ 347

Query: 311 YCNEAKKRGAIVYAIGIRVI-RSHEFLRACASPNSFYL-VENPHSMYDAFSHIGK 363
           +C+ AK     +Y++      R    L+ CAS +S Y   E    +  AF  IG+
Sbjct: 348 WCDTAKANKVEIYSVAFMAPERGQALLKYCASSSSHYFEAEEVTDLVAAFKAIGE 402


>gi|315122473|ref|YP_004062962.1| von Willebrand factor type A [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495875|gb|ADR52474.1| von Willebrand factor type A [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 403

 Score = 61.2 bits (147), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 81/404 (20%), Positives = 164/404 (40%), Gaps = 66/404 (16%)

Query: 11  FFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGN 70
           F  N  G   I++A  + +  + +  +I+++H+  MK  + S +D +++   + ++++  
Sbjct: 16  FSKNKSGVFHIMSASIIFVCLIFVSFVIDITHLLHMKNHIQSSLDNAIISGCSIVVSDPK 75

Query: 71  GNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSIS 130
            N+              N      R+ ++ N +VN + +     +  I+   +N   S S
Sbjct: 76  INDL-------------NPQEERIRDVIKKNAYVNMVQNFPAEHAAYII---ENANISFS 119

Query: 131 AISRYKIPLKFCTFIPWYTNSRHIV----MP--------ITSSVKVNSQTDARLDMMIVL 178
                K   K         + ++ +    MP        I++ +           + +VL
Sbjct: 120 KDLTNKYEYKITMEAKHQLSGKNFILGFLMPNVITHISSISTGIIQKPSDKKAFSVEMVL 179

Query: 179 DVSRSMESFFDSSITKIDM----------------------AIKS-----INAMLEEVKL 211
           D S SM    DS     D+                      A+K+     +N + E V+ 
Sbjct: 180 DCSGSM---LDSMQESCDLSSGRGGYYFYSKNNNKPKSKIYALKTASSDFVNLIQETVQT 236

Query: 212 IPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIF 271
            P ++   + GL+TF++ I +   L    + +++ I  +   G +    P +  AY  + 
Sbjct: 237 FPQIS--ARIGLITFNHYIMQDSKLSNNFNVIKKTISRMKPKGGTDTFLP-MNAAYEYLN 293

Query: 272 DMQG-MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI 330
           ++    + H  +++   K+ I+ MTDGEN     D +++  C+ A+K G I+Y+I +   
Sbjct: 294 NIPNETKAHNISDNVPLKRYIILMTDGENNHPSYDLKTINVCDNARKNGIIIYSIFLNYY 353

Query: 331 R---SHEFLRACASPNS-FYLVENPHSMYDAFSHIGKDIVTKRI 370
                +E  R CAS    F+   N  ++ D+F  I   I  K +
Sbjct: 354 EYTDGYELARKCASSEKHFFYANNTKALLDSFKSIAHAIQDKAV 397


>gi|254781108|ref|YP_003065521.1| von Willebrand factor type A [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040785|gb|ACT57581.1| von Willebrand factor type A [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 398

 Score = 61.2 bits (147), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 79/402 (19%), Positives = 171/402 (42%), Gaps = 63/402 (15%)

Query: 22  LTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGD 81
           +TAI + + FL +   I+++HI +++  + S +D +++     I+++    +    K   
Sbjct: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKD-- 58

Query: 82  ILCRIKNTWNMSFRNELRDNGFVND-IDDIVRSTSLDIVVVPQNE-GYSISAISRYKIPL 139
              +    +    +  L+   ++ +   DI +   ++I     N   Y   + ++Y+IP 
Sbjct: 59  ---QTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPT 115

Query: 140 K---FCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSME----------- 185
           +       IP      ++ +  T  ++ +S+  A + + +VLDVSRSME           
Sbjct: 116 ENLFLKGLIPSALT--NLSLRSTGIIERSSENLA-ISICMVLDVSRSMEDLYLQKHNDNN 172

Query: 186 ---------------SFFDSSITK-------------IDMAIKSINAMLEEV-KLIPDVN 216
                          SF+  + TK             ID+ I+S   ++  + K I +  
Sbjct: 173 NMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKK 232

Query: 217 NV-VQSGLVTFSNKI--EEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM 273
           N+ V+ G + ++  I   +   L   ++ ++ ++  L+ +  +TN+ P + +AY ++++ 
Sbjct: 233 NLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYE-NTNTYPAMHHAYRELYN- 290

Query: 274 QGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQ---QSLYYCNEAKKRGAIVYAIGIRV- 329
           +    H        KK ++F+TDGEN      Q    +L  C   +  G  +Y++ +   
Sbjct: 291 EKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAP 350

Query: 330 IRSHEFLRACA-SPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
               + LR C  S   F+ V +   + ++F  I   I  + +
Sbjct: 351 PEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392


>gi|315122479|ref|YP_004062968.1| von Willebrand factor type A [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495881|gb|ADR52480.1| von Willebrand factor type A [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 427

 Score = 58.9 bits (141), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 90/416 (21%), Positives = 171/416 (41%), Gaps = 67/416 (16%)

Query: 8   IRNFFYNYK-------GGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVH 60
           +R F +N+K          +IL ++ L  I L +G++I V   +  K  + +    +++ 
Sbjct: 4   LRTFLFNFKKIILSPKANFSILFSVILISILLFIGILIYVLDYYHKKNAMENANTSAILS 63

Query: 61  AATQIMNEGN--GNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDD---IVRSTS 115
            A++I++  +  G+N        I+  +        +  L  +  V DI +   I +++ 
Sbjct: 64  GASKIISRISYFGDNMSSHTHRAIVDDVTRFIKSYIKESLLMDSSVFDISEKNIISQNSK 123

Query: 116 LDIVVVP--------------QNEG--YSISAISRYKIPLKFCTFIPWYTNSRHIVMPIT 159
           + I   P              QN+   Y IS  + Y   +KF   +     +  I+  + 
Sbjct: 124 VSITREPHPNVFHEFNNQSILQNKKTFYHISVETFYDYHIKFFDNLLNKKINSKIISFVP 183

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSI---------------TKIDMAIKSINA 204
           + VK+++       + +V+D+S SM    +S                 +K+D   K++  
Sbjct: 184 ALVKIDTGEHPFFFVQLVVDLSASMSCLMNSDPEHATEFSVCGKSKKNSKMDALKKAVLL 243

Query: 205 MLEEV----KLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVS---- 256
            L+ V    K   D + +   GL  ++ ++E+     WG   +++ I  + +  V+    
Sbjct: 244 FLDSVDRGSKTQKDTHYI---GLTGYTTRVEKNIEPSWGTGKVRKYI--VEEIDVNMLGQ 298

Query: 257 TNSTPGLKYAYNQIFDMQGMR--------QHCNTEDANYKKIIVFMTDGENLSTKEDQQS 308
           T+STP +K AY QI      R        +        ++K ++F+TDGEN   K D ++
Sbjct: 299 TDSTPAMKKAY-QILTSDKKRNFIRNILHKRIKIPPLPFQKFLIFLTDGENNDPKSDVKT 357

Query: 309 LYYCNEAKKRGAIVYAIGIRV-IRSHEFLRACAS-PNSFYLVENPHSMYDAFSHIG 362
           +  C +AKK    +  I I         L+ C S P  +Y V +  S+   F  I 
Sbjct: 358 IKICEKAKKNSIKILTISINASANGKRLLKKCVSAPEYYYNVVDTGSLLRVFQDIS 413


>gi|15966595|ref|NP_386948.1| hypothetical protein SMc04059 [Sinorhizobium meliloti 1021]
 gi|307300370|ref|ZP_07580150.1| TadE family protein [Sinorhizobium meliloti BL225C]
 gi|307319653|ref|ZP_07599079.1| TadE family protein [Sinorhizobium meliloti AK83]
 gi|15075867|emb|CAC47421.1| Hypothetical protein SMc04059 [Sinorhizobium meliloti 1021]
 gi|306894775|gb|EFN25535.1| TadE family protein [Sinorhizobium meliloti AK83]
 gi|306904536|gb|EFN35120.1| TadE family protein [Sinorhizobium meliloti BL225C]
          Length = 410

 Score = 57.0 bits (136), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 72/167 (43%), Gaps = 14/167 (8%)

Query: 209 VKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYN 268
            K+ P  N  +++G  +++++ +    L WG  +    ++ L   G  T+S+     A  
Sbjct: 235 AKMDPG-NEYLRAGAASYNDRQDRASKLTWGTKNASAHVQGLDATG-GTDSSSAFAAAVE 292

Query: 269 QIFDMQGMRQHCNTEDANYKKIIVFMTDGENLS----------TKEDQQSLYYCNEAKKR 318
           ++        H        +K IVFMTDGEN S           K D  +   C  AK  
Sbjct: 293 ELLLDGENEAHLAKNGQTPEKYIVFMTDGENTSYNGKTSPRDLEKADSVTKAACTTAKNN 352

Query: 319 GAIVYAIG-IRVIRSHEFLRACA-SPNSFYLVENPHSMYDAFSHIGK 363
           G  ++ +  +   R  + L+ACA SP+ +   ++  ++   F  IG+
Sbjct: 353 GIAIFTVAFMAPQRGKDLLKACATSPDHYKEADDAAALVSEFEKIGQ 399


>gi|86359182|ref|YP_471074.1| hypothetical protein RHE_CH03592 [Rhizobium etli CFN 42]
 gi|86283284|gb|ABC92347.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 411

 Score = 57.0 bits (136), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 89/407 (21%), Positives = 154/407 (37%), Gaps = 69/407 (16%)

Query: 8   IRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMN 67
           +R  F +  G   I+TAI  P++    GM I+V  +   K  L    D + +  AT + N
Sbjct: 10  LRRMFSDRGGNFGIMTAILAPVLLGAAGMAIQVGDMLLSKQQLQEAADSAALATATALAN 69

Query: 68  EGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDI--VVVPQNE 125
                       G I       +  +F      N ++    DI  +TS+++      ++ 
Sbjct: 70  ------------GTIQTTEAEAFARNFVAGQMAN-YLQSGTDIKSTTSVNVQTTTSGKST 116

Query: 126 GYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSM- 184
            Y ++    Y + +        +T ++H+    T+ +  +SQT   + M + LD S SM 
Sbjct: 117 SYQVTVSPAYVLTVNPLMQAVGFT-TQHLSTSGTT-IGGHSQTQGSISMFLALDKSGSMG 174

Query: 185 ------------ESF-FDSSI----------------------TKIDMAIKSINAMLEEV 209
                       ES+ +D ++                      TKI+    +   +  ++
Sbjct: 175 EDTATVNEESPTESYTYDCNLHYNTKNNKWVYDKCTGSRTNYYTKIEALKMAAGNLFSQL 234

Query: 210 KLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQ 269
                    V++G V++         L WG++ +   +  L   G  TNS+  +  AY  
Sbjct: 235 NSADPNAQYVRTGAVSYDINQYAPSSLAWGITGVSSYVNALQANG-GTNSSGAMNTAYTS 293

Query: 270 IF-------DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKE-----DQQSLYYCNEAKK 317
           +        D++       T     KK IVFMTDG+N +        D  +   C++AK 
Sbjct: 294 LTAKNAAGNDVENSAHQQKTGQVP-KKYIVFMTDGDNNNDPSGGRSYDTATKKTCDDAKS 352

Query: 318 RGAIVYAIG-IRVIRSHEFLRACASPNSFYL-VENPHSMYDAFSHIG 362
           +G  +Y I  +        L  CAS +S Y   E    +  AF  IG
Sbjct: 353 KGIEIYTIAFMAPAGGQALLHYCASDDSHYFQAEKMEDLLAAFQAIG 399


>gi|190893432|ref|YP_001979974.1| hypothetical protein RHECIAT_CH0003859 [Rhizobium etli CIAT 652]
 gi|190698711|gb|ACE92796.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 410

 Score = 55.1 bits (131), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 91/410 (22%), Positives = 147/410 (35%), Gaps = 76/410 (18%)

Query: 8   IRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMN 67
           +R  F +  G   I+TAI  P++    GM I+V  +   K  L    D + +  AT + N
Sbjct: 10  LRRMFSDRGGNFGIMTAILAPVLLGAAGMAIQVGDMLISKQQLQEAADSAALATATALAN 69

Query: 68  EGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEG- 126
                             I+ +   +F          N +   V   S   V V  N   
Sbjct: 70  G----------------TIQTSQAEAFARNFVAGQMANYLQSGVDIKSATGVTVQTNTSG 113

Query: 127 ----YSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSR 182
               Y ++    Y + +        +T ++H+    T+ +  +SQT   + M + LD S 
Sbjct: 114 NSTSYQVTVSPSYDLTVNPLMQAVGFT-TQHLSTSGTT-IGGHSQTQGSISMYLALDKSG 171

Query: 183 SM-------------ESF---------------FDSSI-------TKIDMAIKSINAMLE 207
           SM             ES+               +D+         TKI+    +   +  
Sbjct: 172 SMGEDTATVNEEDPTESYTYDCNGHYNKKGKWIYDTCTGSRANYYTKIEALKMAAGNLFG 231

Query: 208 EVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAY 267
           ++         V++G V++         L WG S +   +  L + G  TNS+  +  AY
Sbjct: 232 QLSSADPNAQYVRTGAVSYDIVQYTPSALAWGTSGVSTYVNAL-QAGGGTNSSGAMSTAY 290

Query: 268 NQIFDMQGMRQHCNTEDANYK--------KIIVFMTDGENLSTKEDQQSL-----YYCNE 314
           + +          + EDA +K        K IVFMTDG+N       +S        C+ 
Sbjct: 291 SSLTAKNAAGN--DAEDAAHKLKTGQTPKKYIVFMTDGDNNDDSSGGRSYDTLTKATCDT 348

Query: 315 AKKRGAIVYAIGIRVIRSHE-FLRACASPNSFYL-VENPHSMYDAFSHIG 362
           AK +G  +Y I        +  L  CAS +S Y   E    +  AF  IG
Sbjct: 349 AKSKGIEIYTIAFMAPEGGQALLHYCASDDSHYFQAEKMEDLLAAFKAIG 398


>gi|327189644|gb|EGE56794.1| hypothetical protein RHECNPAF_570041 [Rhizobium etli CNPAF512]
          Length = 415

 Score = 53.1 bits (126), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 96/418 (22%), Positives = 158/418 (37%), Gaps = 87/418 (20%)

Query: 8   IRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMN 67
           +R  F +  G   I+TAI  P++    G+ I+V  +   K  L    + +   A      
Sbjct: 10  LRRMFSDRGGNFGIMTAILAPVLLGAAGLAIQVGDMLLSKQQLQ---EAADSAALATATA 66

Query: 68  EGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEG- 126
            GNG          I       +  +F      N   N +D I  +T++++     N G 
Sbjct: 67  LGNGT---------IQTSQAEAFARNFVAGQMANYLQNGVD-IKNATAVNVQT--SNSGK 114

Query: 127 ---YSISAISRYKI---PL-KFCTFIPWY--TNSRHIVMPITSSVKVNSQTDARLDMMIV 177
              Y ++    Y +   PL +   F   +  T+S  +  P   S    S +   + M + 
Sbjct: 115 SASYQVTVTPSYDLTVNPLMQAVGFSTQHLSTSSTTVSGP---SQTPGSNSQGSVSMFLA 171

Query: 178 LDVSRSM-------------ESF---------------FDSSI-------TKID-MAIKS 201
           LD S SM             E+F               +D+         TKI+ + + +
Sbjct: 172 LDKSGSMGDPTETVNKDQPTETFTYDCNPHLNKKGKWVYDTCTGSRTNYYTKIEALKMAA 231

Query: 202 INAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFF--LLEWGVSHLQRKIKYLSKFGVSTNS 259
            N   +     PD    V++G V++   I+++    L WG S +   +  L + G  TNS
Sbjct: 232 GNLFGQLTSADPDAQ-YVRTGAVSY--DIDQYTPSTLAWGTSGVSSYVNAL-QAGGGTNS 287

Query: 260 TPGLKYAYNQIFDMQGMRQHCNTEDANYK--------KIIVFMTDGENLSTKEDQQSL-- 309
           +  +  AY+ +          + EDA +K        K IVFMTDG+N +     +S   
Sbjct: 288 SGAMGTAYSSLTAKNAAGN--DAEDAAHKLKTGQIPKKYIVFMTDGDNNNDSSGGRSYDT 345

Query: 310 ---YYCNEAKKRGAIVYAIGIRVIRSHE-FLRACASPNSFYL-VENPHSMYDAFSHIG 362
                C+ AK +G  +Y I        +  L+ CAS  + Y   E    +  AF  IG
Sbjct: 346 LTKATCDTAKSKGIEIYTIAFMAPPGGQALLQYCASDAAHYFQAEQMEDLLAAFKAIG 403


>gi|154250683|ref|YP_001411507.1| von Willebrand factor type A [Parvibaculum lavamentivorans DS-1]
 gi|154154633|gb|ABS61850.1| von Willebrand factor type A [Parvibaculum lavamentivorans DS-1]
          Length = 436

 Score = 53.1 bits (126), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 64/139 (46%), Gaps = 13/139 (9%)

Query: 241 SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENL 300
           S L   I  ++  G +TN+T GL + +N +    G         AN  K+IVF+TDG+N 
Sbjct: 300 SALNSHIDAMASAG-NTNTTIGLAWGWN-MLTQGGPLSSAAAPAANLDKVIVFLTDGDNT 357

Query: 301 -------STKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFL-RACAS-PNSFYLVENP 351
                  S   + ++   CN  K  G  VY+  +RVI  +  L R CA+ P  +Y V   
Sbjct: 358 RNRWSNNSNTINARTTLICNNIKAAGIKVYS--VRVIEGNATLIRNCATEPGMYYSVTTA 415

Query: 352 HSMYDAFSHIGKDIVTKRI 370
             +   F+ I + +   RI
Sbjct: 416 SELTSVFASIAQSLSNLRI 434


>gi|301626452|ref|XP_002942405.1| PREDICTED: collagen alpha-6(VI) chain-like [Xenopus (Silurana)
            tropicalis]
          Length = 2615

 Score = 52.4 bits (124), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 56/201 (27%), Positives = 93/201 (46%), Gaps = 29/201 (14%)

Query: 171  RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFS-NK 229
            +LD++ ++D S S+ S   S+ T     +K I      V       N V+ G+  +S N 
Sbjct: 1401 QLDLVFLIDGSASITS---SNFTSAKTFMKEI------VDSFTISENRVRIGVAQYSANP 1451

Query: 230  IEEFFLLEW-GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
             +EFFL E+   S ++++I  +S+   +T +  GL++   Q FD        N    N  
Sbjct: 1452 KKEFFLNEYYSSSDMKKQIDSISQLKATTYTGKGLRFV-KQFFD------PANGGRKNVP 1504

Query: 289  KIIVFMTDG-ENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYL 347
            + ++ MTDG  N S  ED  +L      +  G  +++IGI +  S E +    SP + Y 
Sbjct: 1505 QYLIVMTDGMSNDSVNEDAAAL------RSSGVKIFSIGIGLRNSFELVMIAGSPKNVYE 1558

Query: 348  VENPHSMYDAFSHIGKDIVTK 368
            VE     + A   I + IV +
Sbjct: 1559 VET----FQALDSIKRQIVAQ 1575



 Score = 39.7 bits (91), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 76/168 (45%), Gaps = 23/168 (13%)

Query: 202  INAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNS 259
            + +M+++ ++ PD    VQ GL+ FS++ +E F L        +Q  I+ + +    T  
Sbjct: 1048 MESMVKQAEIGPDR---VQIGLIQFSSETKEEFPLNRYKRKDEIQSAIRGIQQLSQGTLM 1104

Query: 260  TPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEA-KKR 318
               LKY        +G R        N K+ ++ +TDGE       Q ++    +A +  
Sbjct: 1105 GEALKYTLPYFSASKGGR-------VNTKQYLIVITDGEA------QDAVGNPAKAIRDH 1151

Query: 319  GAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIV 366
            G I+YAIG++   + + L         Y  ++    +D+ + + K+I+
Sbjct: 1152 GVIIYAIGVQQANNTQLLEIAGKQEQVYYEDS----FDSLAFLNKNIM 1195


>gi|332716587|ref|YP_004444053.1| hypothetical protein AGROH133_12352 [Agrobacterium sp. H13-3]
 gi|325063272|gb|ADY66962.1| hypothetical protein AGROH133_12352 [Agrobacterium sp. H13-3]
          Length = 412

 Score = 51.6 bits (122), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 84/408 (20%), Positives = 159/408 (38%), Gaps = 70/408 (17%)

Query: 9   RNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQI-MN 67
           R F  +  G   ++TAI LP++    G  +E++++  +K  L +  D + + AAT+  + 
Sbjct: 11  RRFLADTGGNFGMMTAILLPVLLGFAGAGMELANVMQVKADLQNTADSAALAAATEARLK 70

Query: 68  EGNGNNR--KKLKGGDILCRIKNTWNMSFRNELRDNGFVN--DIDDIVRSTSLDIVVVPQ 123
           EG   +   K++    I  +++ T     +  L  N  VN    DD    T         
Sbjct: 71  EGALTDEQIKEIAKAFIASQMEKTLTEEEKKALEKNSPVNIGTTDDARGKT--------- 121

Query: 124 NEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRS 183
              Y+I     Y++ L     +  +  ++ + +  T +        A + M +VLD S S
Sbjct: 122 ---YTIQTTINYQMQLNP---LLGFFGAKTLDLAATGTAVSTVNKGAPISMYLVLDRSGS 175

Query: 184 MESFFDS-------------------------------SITKIDMAIKSINAMLEEVKLI 212
           M    D+                                 T +  A+  + A L +    
Sbjct: 176 MSFKTDTLNTKKTSCQNYTVDNWGSYPNLKNTSPCYVNKATSLKTAVGYLVATLNKADPT 235

Query: 213 PDVNN---VVQSGLVTFSNKIEEFFLLEWGVS----HLQRKIKYLSKFGVSTNSTPGLKY 265
              N    +V++G   ++++      + WG S    ++ ++I      G    S+  L  
Sbjct: 236 YTANGGSELVRTGASVYTHETYAAQPITWGTSSVATYVDKQIPEFPSGGTDARSS--LNA 293

Query: 266 AYNQIFDMQGM--RQHCNTEDANYKKIIVFMTDGENLSTKE------DQQSLYYCNEAKK 317
           AYN +     +  ++H + +  ++++ IV MTDGE            DQ     C+ AKK
Sbjct: 294 AYNALKKANTVEAKEHKDKKSESFERYIVLMTDGEMTGNSSSWSSSIDQTVRNTCDTAKK 353

Query: 318 RGAIVYAIGIRVI-RSHEFLRACASP-NSFYLVENPHSMYDAFSHIGK 363
            G  ++++      +    L+ CAS  +++Y  EN   +  AF  I +
Sbjct: 354 DGIKIFSVAFMAPDKGKSLLQHCASSLDNYYAPENMEQIVTAFGEIAR 401


>gi|306823858|ref|ZP_07457232.1| conserved hypothetical protein [Bifidobacterium dentium ATCC 27679]
 gi|309802423|ref|ZP_07696530.1| conserved repeat protein [Bifidobacterium dentium JCVIHMP022]
 gi|304552856|gb|EFM40769.1| conserved hypothetical protein [Bifidobacterium dentium ATCC 27679]
 gi|308221023|gb|EFO77328.1| conserved repeat protein [Bifidobacterium dentium JCVIHMP022]
          Length = 1136

 Score = 50.8 bits (120), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 66/249 (26%), Positives = 104/249 (41%), Gaps = 32/249 (12%)

Query: 103 FVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSV 162
           F N        T  +IV  P+    +I AI     P K         N+  + + +T + 
Sbjct: 532 FTNTATATGTDTDGNIVNSPE-ASVTIKAIKPLGAPEKHKRIKKNADNTYTVNVDVTGAA 590

Query: 163 KVNSQTDAR-LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLI----PDVNN 217
             ++ T  + +D  +VLDVS SM      S+TK+     ++N  L+E   I       + 
Sbjct: 591 SSSTITTTQPVDFTLVLDVSGSMRENM-GSVTKLQALQSAVNNFLDEAAKINKGAQSGSE 649

Query: 218 VVQSGLVTF----SNKI-EEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFD 272
            V+ GLV F    + KI  + +  +W   +  + +K L      T  T GLK   N++  
Sbjct: 650 PVRVGLVKFAGNATKKIGNKTYQDKWNTYNYSQIVKKL------TADTDGLKNEVNKLTA 703

Query: 273 MQGMR-----QHCNT----EDANYKKIIVFMTDGENLSTKE-----DQQSLYYCNEAKKR 318
               R     QH  T         KK+++F TDG+  S K         ++ Y  + K  
Sbjct: 704 GGATRADYGFQHAFTVMSEARTEAKKVVIFFTDGKPTSEKTFDGKVANDAVEYAKQLKDS 763

Query: 319 GAIVYAIGI 327
           GAIVY+IG+
Sbjct: 764 GAIVYSIGV 772


>gi|209550922|ref|YP_002282839.1| von Willebrand factor type A [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209536678|gb|ACI56613.1| von Willebrand factor type A [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 411

 Score = 50.8 bits (120), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 92/413 (22%), Positives = 154/413 (37%), Gaps = 81/413 (19%)

Query: 8   IRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMN 67
           +R  F +  G   I+TAI  P++  V G+ I+V  +   K  L    D + +  AT + N
Sbjct: 10  LRRMFSDRGGNFGIMTAIMAPVLLGVAGVAIQVGDMMLSKQQLQEAADSAALATATALAN 69

Query: 68  EGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDI--VVVPQNE 125
                       G I       +  +F      N +V    D    TS+++      ++ 
Sbjct: 70  ------------GTIQTSQAEAFAQNFVAGQMAN-YVQSGVDFKSGTSVNVQTSTSGKST 116

Query: 126 GYSISAISRYKI---PLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSR 182
            Y ++    Y +   PL           ++H+    T+ V  +SQT   + M + LD S 
Sbjct: 117 SYQVTVSPSYDLTVNPLMQAVGF----KTQHLSTSGTT-VGGHSQTQGSISMFLALDKSG 171

Query: 183 SM-------------ESF-FDSSI----------------------TKIDMAIKSINAML 206
           SM             ES+ +D ++                      TKI+    +   + 
Sbjct: 172 SMGEATATVNADDPTESYTYDCNLHYNSKNNKWVYDKCTGSRTNYYTKIEALKIAAGNLF 231

Query: 207 EEVKLIPDVNNVVQSGLVTFSNKIEEFFL--LEWGVSHLQRKIKYLSKFGVSTNSTPGLK 264
            ++         V++G V++   I ++    L WG + +   +  L   G  TNS+  + 
Sbjct: 232 GQLNSADPNAEYVRTGAVSY--DINQYTPSNLAWGTAGVTSYVNALQANG-GTNSSGAMS 288

Query: 265 YAYNQIFDMQGMRQHCNTEDANYK--------KIIVFMTDGENLSTKEDQQSL-----YY 311
            AY+ +          + ED+ +K        K IVFMTDG+N       +S        
Sbjct: 289 TAYSSLTAKNAAGN--DAEDSAHKLKTGQTPKKYIVFMTDGDNNDDSSGGRSYDTLTKAT 346

Query: 312 CNEAKKRGAIVYAIG-IRVIRSHEFLRACASPNSFYL-VENPHSMYDAFSHIG 362
           C+ AK +G  +Y I  +        L  CAS +S Y   E    +  AF  IG
Sbjct: 347 CDTAKSKGIEIYTIAFMAPAGGQTLLHYCASDDSHYFQAEKMEDLLAAFKAIG 399


>gi|91203253|emb|CAJ72892.1| hypothetical protein kustd2147 [Candidatus Kuenenia
           stuttgartiensis]
          Length = 701

 Score = 49.7 bits (117), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 55/207 (26%), Positives = 96/207 (46%), Gaps = 27/207 (13%)

Query: 166 SQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVT 225
           +Q D +L +MIVLD S SM    +  IT++ ++ K          LI  +N+  Q G+V 
Sbjct: 318 TQDDFQLQVMIVLDYSASMYEK-NGDITRMALSAKD---------LIESLNDTHQVGVVE 367

Query: 226 FSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFD--MQGMRQHCNTE 283
           F    E   +L+   ++    I+ +S+F     S+  +   ++  +D  ++G++Q     
Sbjct: 368 FHRPDEPPAILQDFTTYKNAAIEAVSQF-----SSGKIYRDFSSCWDAVLKGLKQFPEKP 422

Query: 284 DANYKKIIVFMTDG---ENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR--A 338
           D +  K +VF++DG    + ST  +  SL     AK+R   +Y +GI      E L+  A
Sbjct: 423 DPDIFKTLVFLSDGFDNSSFSTPGNVISL-----AKERDVHIYILGIGRGSEEEVLKNIA 477

Query: 339 CASPNSFYLVENPHSMYDAFSHIGKDI 365
             +  ++   EN     + F    KDI
Sbjct: 478 LETGGTYVHAENIAVFRERFKQTIKDI 504


>gi|149410544|ref|XP_001506183.1| PREDICTED: similar to protocadherin 9, partial [Ornithorhynchus
           anatinus]
          Length = 588

 Score = 49.7 bits (117), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 80/160 (50%), Gaps = 21/160 (13%)

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
           RLD++ V+D SRS+         K+   I +I   L+ + + PDV  V   GL+ + + +
Sbjct: 9   RLDLIFVIDSSRSVRPH---DFEKVKEFIVTI---LQFLDVAPDVTRV---GLIQYGSTV 59

Query: 231 E-EFFLLEWG-VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIF-DMQGMRQHCNTEDANY 287
           + EF L  +G  S ++R +K + + G  T +   ++YA N  F + +G R        N 
Sbjct: 60  KNEFSLKTYGRKSEVERAVKVMKRLGTGTMTGLAIQYAVNIAFSESEGAR----PLRENV 115

Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGI 327
            +II+ +TDG       +  +     +A+  G +++AIG+
Sbjct: 116 PRIIMIVTDGRPQDPVAEVAA-----KARNSGILIFAIGV 150


>gi|147906540|ref|NP_001087052.1| von Willebrand factor A domain-containing protein 2 precursor
           [Xenopus laevis]
 gi|82235697|sp|Q6DCQ6|VWA2_XENLA RecName: Full=von Willebrand factor A domain-containing protein 2;
           AltName: Full=A domain-containing protein similar to
           matrilin and collagen; Short=AMACO; Flags: Precursor
 gi|50415038|gb|AAH77945.1| MGC80919 protein [Xenopus laevis]
          Length = 790

 Score = 49.3 bits (116), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 62/220 (28%), Positives = 94/220 (42%), Gaps = 37/220 (16%)

Query: 161 SVKVNSQTDARLDMMIVLDVSRSM--ESFFDSSITKIDMAIKSINAMLEEVKLIPDVN-N 217
           S+ V       LD+  VLD S ++  E F              +   +  V L  D+N +
Sbjct: 520 SIDVQGCQAQPLDLAFVLDASTAVGQEKF------------NRLKNFVTMVSLQFDINRD 567

Query: 218 VVQSGLVTFSNKIEEFFLLEW---GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQ 274
           V Q GLVT+S++ E  F L+    G S LQ  I   S  G S ++   L   YN +  +Q
Sbjct: 568 VTQIGLVTYSSRPETVFGLDTHDSGSSLLQ-GIGRASYMGGSASTGSALLRVYNDVMTVQ 626

Query: 275 -GMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSH 333
            G R   N       K +V +TDG        + +     + +  G +VY IGI  I+ +
Sbjct: 627 KGARPGVN-------KAVVVITDGRGA-----EDAAVPAQKLRDNGIMVYVIGIGNIQRN 674

Query: 334 EFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
             LR   S    +L+  P   Y++  H  +D V +R+  D
Sbjct: 675 SLLRLAGSEK--FLISVPS--YESLGHY-EDSVVQRVCED 709


>gi|297482040|ref|XP_002692521.1| PREDICTED: matrilin 4 [Bos taurus]
 gi|296480952|gb|DAA23067.1| matrilin 4 [Bos taurus]
          Length = 584

 Score = 48.9 bits (115), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 53/234 (22%), Positives = 100/234 (42%), Gaps = 38/234 (16%)

Query: 146 PWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAM 205
           PW T    +  P  SS          LD++ V+D SRS+  F      + +   + +  +
Sbjct: 18  PWETQL-QLAGPRCSS--------GPLDLVFVIDSSRSVRPF------EFETMRQFLVGL 62

Query: 206 LEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGL 263
           L  + + P+   V   G++ +S++++  F L        ++R I+ +      T +   +
Sbjct: 63  LRSLDVGPNATRV---GVIQYSSQVQSVFPLRAFSRREDMERAIRAVVPLAQGTMTGLAI 119

Query: 264 KYAYNQIFDM-QGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIV 322
           +YA N  F + +G R      +A+  ++ V +TDG     +   +      +A+ RG  +
Sbjct: 120 QYAMNVAFSVAEGAR----PPEAHVPRVAVIVTDG-----RPQDRVAEVAAQARARGIEI 170

Query: 323 YAIGIRVIRSHEFLRACASP---NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
           YA+G++       LRA ASP      +LVE+    +D     G+    +    D
Sbjct: 171 YAVGVQRADVGS-LRAMASPPLNEHVFLVES----FDLIQEFGRQFQGRLCTLD 219



 Score = 36.6 bits (83), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 42/212 (19%), Positives = 97/212 (45%), Gaps = 32/212 (15%)

Query: 151 SRHIVMPITSSVKVNSQTDAR-----LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAM 205
           S   V P    ++ + ++ +R     +D+++++D S+S+           ++  + +N +
Sbjct: 320 SYRCVCPEGRQLQADGKSCSRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQI 373

Query: 206 LEEVKLIPDVNNVVQSGLVTFSNKIE-EFFLLEWGVSHLQRK----IKYLSKFGVSTNST 260
           ++ + + P+   V   GLV FS+++  EF L  +G +   ++    ++Y+ +    T + 
Sbjct: 374 VDFLDVSPEGTRV---GLVQFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMER---GTMTG 427

Query: 261 PGLKYAYNQIF-DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRG 319
             L++     F + QG R        N  ++ +  TDG +    +D  S++    AK+ G
Sbjct: 428 LALRHMVEHSFSEAQGAR----PRALNVPRVGLVFTDGRS----QDNISVWA-ARAKEEG 478

Query: 320 AIVYAIGIRVIRSHEFLRACASPNSFYLVENP 351
            ++YA+G+      E     + P   ++  +P
Sbjct: 479 IVMYAVGVGKAVEEELREIASEPAELHVSYSP 510


>gi|300796915|ref|NP_001178240.1| matrilin-4 [Bos taurus]
          Length = 584

 Score = 48.9 bits (115), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 53/234 (22%), Positives = 100/234 (42%), Gaps = 38/234 (16%)

Query: 146 PWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAM 205
           PW T    +  P  SS          LD++ V+D SRS+  F      + +   + +  +
Sbjct: 18  PWETQL-QLAGPRCSS--------GPLDLVFVIDSSRSVRPF------EFETMRQFLVGL 62

Query: 206 LEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGL 263
           L  + + P+   V   G++ +S++++  F L        ++R I+ +      T +   +
Sbjct: 63  LRSLDVGPNATRV---GVIQYSSQVQSVFPLRAFSRREDMERAIRAVVPLAQGTMTGLAI 119

Query: 264 KYAYNQIFDM-QGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIV 322
           +YA N  F + +G R      +A+  ++ V +TDG     +   +      +A+ RG  +
Sbjct: 120 QYAMNVAFSVAEGAR----PPEAHVPRVAVIVTDG-----RPQDRVAEVAAQARARGIEI 170

Query: 323 YAIGIRVIRSHEFLRACASP---NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
           YA+G++       LRA ASP      +LVE+    +D     G+    +    D
Sbjct: 171 YAVGVQRADVGS-LRAMASPPLNEHVFLVES----FDLIQEFGRQFQGRLCTLD 219



 Score = 36.6 bits (83), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 42/212 (19%), Positives = 97/212 (45%), Gaps = 32/212 (15%)

Query: 151 SRHIVMPITSSVKVNSQTDAR-----LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAM 205
           S   V P    ++ + ++ +R     +D+++++D S+S+           ++  + +N +
Sbjct: 320 SYRCVCPEGRQLQADGKSCSRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQI 373

Query: 206 LEEVKLIPDVNNVVQSGLVTFSNKIE-EFFLLEWGVSHLQRK----IKYLSKFGVSTNST 260
           ++ + + P+   V   GLV FS+++  EF L  +G +   ++    ++Y+ +    T + 
Sbjct: 374 VDFLDVSPEGTRV---GLVQFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMER---GTMTG 427

Query: 261 PGLKYAYNQIF-DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRG 319
             L++     F + QG R        N  ++ +  TDG +    +D  S++    AK+ G
Sbjct: 428 LALRHMVEHSFSEAQGAR----PRALNVPRVGLVFTDGRS----QDNISVWA-ARAKEEG 478

Query: 320 AIVYAIGIRVIRSHEFLRACASPNSFYLVENP 351
            ++YA+G+      E     + P   ++  +P
Sbjct: 479 IVMYAVGVGKAVEEELREIASEPAELHVSYSP 510


>gi|15891094|ref|NP_356766.1| hypothetical protein Atu3868 [Agrobacterium tumefaciens str. C58]
 gi|15159433|gb|AAK89551.1| hypothetical protein Atu3868 [Agrobacterium tumefaciens str. C58]
          Length = 412

 Score = 48.5 bits (114), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 83/408 (20%), Positives = 160/408 (39%), Gaps = 70/408 (17%)

Query: 9   RNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQI-MN 67
           R F  +  G   ++TAI LP++  V G  +E++++  +K  + +  D + + AAT+  + 
Sbjct: 11  RRFLADTSGNFGMMTAILLPVLLGVAGAGMELANVMQVKADMQNTADSAALAAATEARLR 70

Query: 68  EGNGNNR--KKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNE 125
           EG  ++   K++    I  +++       + EL  N            T +      + +
Sbjct: 71  EGKLSDEQIKEIAKNFIAAQMEKNLTAEEKIELEKN----------SPTRVTTTENARGK 120

Query: 126 GYSISAISRYKIPL-KFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSM 184
            Y++    +++I L     FI     ++ + + +T + K      A + M + LD S SM
Sbjct: 121 TYAVETTIKHQIQLNPMLGFI----GAKTLDLSVTGTAKSTINKGAPISMYLALDRSGSM 176

Query: 185 ESF--------------------------------FDSSITKIDMAIKSINAMLEEVKLI 212
            SF                                + +    +  A+  + A L +    
Sbjct: 177 -SFKTDTVDTTKTSCQNYTSDNWSKYPNLAKTSPCYVNKAASLKTAVGFLVATLNKADPT 235

Query: 213 PDVNN---VVQSGLVTFSNKIEEFFLLEWGVS----HLQRKIKYLSKFGVSTNSTPGLKY 265
             VN    +V++G   ++++      + WG S    ++ ++I      G    S+  L  
Sbjct: 236 YTVNGGSELVRTGASVYTHETYVAQSIGWGTSGVTSYVDKQIPEFPSGGTDARSS--LNA 293

Query: 266 AYNQI--FDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKE------DQQSLYYCNEAKK 317
           AYN +   +    R H      ++++ IV MTDGE            DQ     C  AKK
Sbjct: 294 AYNALKKANPDEARYHKEKGSESFERYIVLMTDGEMTGNSAAWNSSIDQSVRTTCETAKK 353

Query: 318 RGAIVYAIGIRVI-RSHEFLRACA-SPNSFYLVENPHSMYDAFSHIGK 363
            G  ++++      +    L+ CA S +++Y  EN   +  AF  I +
Sbjct: 354 DGIKIFSVAFMAPDKGKSLLQYCASSADNYYAPENMEQIVTAFGEIAR 401


>gi|327274976|ref|XP_003222250.1| PREDICTED: collagen alpha-6(VI) chain-like [Anolis carolinensis]
          Length = 2088

 Score = 48.1 bits (113), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/208 (24%), Positives = 88/208 (42%), Gaps = 37/208 (17%)

Query: 171 RLDMMIVLDVSRS--------MESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSG 222
           RLD++ V+D S S        M+ F  S + K D++                 ++ VQ G
Sbjct: 798 RLDIVFVIDGSGSIDPKEYDIMKEFMISLVKKSDVS-----------------HDRVQFG 840

Query: 223 LVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHC 280
            V +S + E FF L      S + R I+     G +T +   L+++     +  G R+H 
Sbjct: 841 AVKYSAEPETFFYLNRYTTKSAIIRAIQNDKSIGETTYTAKALRHSEGLFSEEHGSRKH- 899

Query: 281 NTEDANYKKIIVFMTDGENLSTKE-DQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRAC 339
                   ++++ +TDG++    E D+ S     + +  G I+YAIGI   R  E L   
Sbjct: 900 ----RGVPQVLIVITDGDSHDAAELDEVS----KKLRANGIIIYAIGIERARPDELLTMA 951

Query: 340 ASPNSFYLVENPHSMYDAFSHIGKDIVT 367
            S + ++ V     +   +  I + I +
Sbjct: 952 GSEDKYFYVNTFEGLKHLYPRISEKICS 979



 Score = 45.4 bits (106), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 51/235 (21%), Positives = 101/235 (42%), Gaps = 46/235 (19%)

Query: 144 FIPWYTNSRHIVMPITSSV-KVNSQTDARLDMMIVLDVSRS--------MESFFDSSITK 194
           F+  + + +HI   +   +  V +  + + D++ ++D SRS        M+ F    + K
Sbjct: 583 FVNDFASLKHIRNEVVRDICAVEACKEKKSDILFLVDSSRSISPDNFLKMKDFMSELVNK 642

Query: 195 IDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK-IEEFFLLEWGV-SHLQRKIKYLSK 252
            D+ +  ++                  G + FS++  EEF L ++   S + R I  +S 
Sbjct: 643 SDIGLDRMHV-----------------GAIQFSSRNKEEFRLSQYATKSDIIRAIGRMSL 685

Query: 253 FGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYC 312
            G ST +   L++  +    ++G R +        KKI++ +TDGE       Q  +   
Sbjct: 686 MGQSTLTGGALQFVLDYFRPIKGSRPYV-------KKILILITDGEA------QDDVKTP 732

Query: 313 NEA-KKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIV 366
            EA ++ G IVY++G+      + +     P   + VE+    +D   H+  +I+
Sbjct: 733 AEALRQEGIIVYSVGVFNANRTQLVEISGKPEMVFYVED----FDILKHLENEIL 783


>gi|32394600|gb|AAM93998.1| proximal thread matrix protein 1 [Griffithsia japonica]
          Length = 218

 Score = 47.8 bits (112), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 52/118 (44%), Gaps = 11/118 (9%)

Query: 239 GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGE 298
           GV  +Q   + LS F  + N+   L    N    ++G  Q   T+     ++++ +TDG 
Sbjct: 79  GVKLIQAPTQSLSTFNTAVNTVSPLNGGTNIFRGLRGCYQQLKTKPMT-DRVLILVTDGF 137

Query: 299 NLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYL----VENPH 352
                   Q + YCN  K +G ++  +GI    +  FL+ CA+   FY+       PH
Sbjct: 138 G------GQPINYCNFIKSKGILLVTVGIGTSINQNFLKNCATSEEFYINVKDTGRPH 189


>gi|114682171|ref|XP_001153893.1| PREDICTED: matrilin 4 isoform 2 [Pan troglodytes]
 gi|114682181|ref|XP_001153957.1| PREDICTED: matrilin-4 isoform 3 [Pan troglodytes]
          Length = 499

 Score = 47.8 bits (112), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 85/188 (45%), Gaps = 31/188 (16%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVN---NVVQSGLVTFSN 228
           LD++ V+D SRS+  F   ++ +  M             L+P +N   N  + G++ +S+
Sbjct: 33  LDLVFVIDSSRSVRPFEFETMRQFLMG------------LLPGLNVGPNATRVGVIQYSS 80

Query: 229 KIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM-QGMRQHCNTEDA 285
           +++  F L        ++R I+ L      T +   ++YA N  F + +G R      + 
Sbjct: 81  QVQSVFPLRAFSRREDMERAIRDLVPLAQGTMTGLAIQYAMNVAFSVAEGAR----PPEE 136

Query: 286 NYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP--- 342
              ++ V +TDG     +   +      +A+ RG  +YA+G++       LRA ASP   
Sbjct: 137 RVPRVAVIVTDG-----RPQDRVAEVAAQARARGIEIYAVGVQRADVGS-LRAMASPPLD 190

Query: 343 NSFYLVEN 350
              +LVE+
Sbjct: 191 EHVFLVES 198



 Score = 37.4 bits (85), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 40/193 (20%), Positives = 88/193 (45%), Gaps = 27/193 (13%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           N   +  +D+++++D S+S+           ++  + +N +++ + + P+   V   GLV
Sbjct: 255 NRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQIVDFLDVSPEGTRV---GLV 305

Query: 225 TFSNKIE-EFFLLEWGVSHLQRK----IKYLSKFGVSTNSTPGLKYAYNQIF-DMQGMRQ 278
            FS+++  EF L  +G +   ++    ++Y+ +    T +   L++     F + QG R 
Sbjct: 306 QFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMER---GTMTGLALRHMVEHSFSEAQGARP 362

Query: 279 HCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRA 338
                  N  ++ +  TDG +    +D  S++    AK+ G +VYA+G+      E    
Sbjct: 363 RA----LNVPRVGLVFTDGRS----QDDISVWAAR-AKEEGIVVYAVGVGKAVEAELREI 413

Query: 339 CASPNSFYLVENP 351
            + P   ++   P
Sbjct: 414 ASEPAELHVSYAP 426


>gi|73992503|ref|XP_543015.2| PREDICTED: similar to Matrilin-4 precursor [Canis familiaris]
          Length = 624

 Score = 47.4 bits (111), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 87/187 (46%), Gaps = 29/187 (15%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ V+D SRS+  F      + +   + +  +L  + + P+   V   G++ +S++++
Sbjct: 35  LDLVFVIDSSRSVRPF------EFETMRQFLVGLLRGLDVGPNATRV---GVIQYSSQVQ 85

Query: 232 EFFLLEWGV----SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM-QGMRQHCNTEDAN 286
             F L  G       ++R I+ L      T +   ++YA N  F + +G R      +A 
Sbjct: 86  SVFPL--GAFSRREDMERAIRALVPLAQGTMTGLAIQYAMNVAFSVAEGAR----PPEAR 139

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---N 343
             +I V +TDG     +   +      +A+ RG  +YA+G++       LRA ASP    
Sbjct: 140 VPRIAVIVTDG-----RPQDRVAEVAAQARARGIEIYAVGVQRADVGS-LRAMASPPLDE 193

Query: 344 SFYLVEN 350
             +LVE+
Sbjct: 194 HVFLVES 200



 Score = 38.5 bits (88), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 39/194 (20%), Positives = 90/194 (46%), Gaps = 27/194 (13%)

Query: 164 VNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGL 223
            N   +  +D+++++D S+S+           ++  + +N +++ + + P+   V   GL
Sbjct: 379 CNRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQIVDFLDVSPEGTRV---GL 429

Query: 224 VTFSNKIE-EFFLLEWGVSHLQRK----IKYLSKFGVSTNSTPGLKYAYNQIF-DMQGMR 277
           V FS+++  EF L  +G +   ++    ++Y+ +    T +   L++     F + QG R
Sbjct: 430 VQFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMER---GTMTGLALRHMVEHSFSEAQGAR 486

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                   N  ++ +  TDG +    +D  S++    AK+ G ++YA+G+      E  +
Sbjct: 487 ----PRALNVPRVGLVFTDGRS----QDDISVWA-RRAKEEGIVMYAVGVGKAVEEELRQ 537

Query: 338 ACASPNSFYLVENP 351
             + P   ++  +P
Sbjct: 538 IASEPAELHVSYSP 551


>gi|114682169|ref|XP_001154082.1| PREDICTED: matrilin 4 isoform 5 [Pan troglodytes]
 gi|114682179|ref|XP_001154207.1| PREDICTED: matrilin-4 isoform 6 [Pan troglodytes]
          Length = 540

 Score = 47.4 bits (111), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 85/188 (45%), Gaps = 31/188 (16%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVN---NVVQSGLVTFSN 228
           LD++ V+D SRS+  F   ++ +  M             L+P +N   N  + G++ +S+
Sbjct: 33  LDLVFVIDSSRSVRPFEFETMRQFLMG------------LLPGLNVGPNATRVGVIQYSS 80

Query: 229 KIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM-QGMRQHCNTEDA 285
           +++  F L        ++R I+ L      T +   ++YA N  F + +G R      + 
Sbjct: 81  QVQSVFPLRAFSRREDMERAIRDLVPLAQGTMTGLAIQYAMNVAFSVAEGAR----PPEE 136

Query: 286 NYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP--- 342
              ++ V +TDG     +   +      +A+ RG  +YA+G++       LRA ASP   
Sbjct: 137 RVPRVAVIVTDG-----RPQDRVAEVAAQARARGIEIYAVGVQRADVGS-LRAMASPPLD 190

Query: 343 NSFYLVEN 350
              +LVE+
Sbjct: 191 EHVFLVES 198



 Score = 37.0 bits (84), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 40/194 (20%), Positives = 88/194 (45%), Gaps = 27/194 (13%)

Query: 164 VNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGL 223
            N   +  +D+++++D S+S+           ++  + +N +++ + + P+   V   GL
Sbjct: 295 CNRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQIVDFLDVSPEGTRV---GL 345

Query: 224 VTFSNKIE-EFFLLEWGVSHLQRK----IKYLSKFGVSTNSTPGLKYAYNQIF-DMQGMR 277
           V FS+++  EF L  +G +   ++    ++Y+ +    T +   L++     F + QG R
Sbjct: 346 VQFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMER---GTMTGLALRHMVEHSFSEAQGAR 402

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                   N  ++ +  TDG +    +D  S++    AK+ G +VYA+G+      E   
Sbjct: 403 ----PRALNVPRVGLVFTDGRS----QDDISVWAAR-AKEEGIVVYAVGVGKAVEAELRE 453

Query: 338 ACASPNSFYLVENP 351
             + P   ++   P
Sbjct: 454 IASEPAELHVSYAP 467


>gi|26349121|dbj|BAC38200.1| unnamed protein product [Mus musculus]
          Length = 280

 Score = 47.4 bits (111), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 41/184 (22%), Positives = 88/184 (47%), Gaps = 21/184 (11%)

Query: 147 WYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAML 206
           + +  RH+ M   +++  +S  + R D+  ++D SRS+ ++  + + +  + I      L
Sbjct: 31  FPSRGRHVRMYPQTALLESSCENKRADLAFIIDSSRSVNTYHYAKVKEFILDI------L 84

Query: 207 EEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLK 264
           + + + PDV  V   GL+ + + ++  F L+     S ++R +K +      T +   ++
Sbjct: 85  QFLDIGPDVTRV---GLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQ 141

Query: 265 YAYNQIF-DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVY 323
           YA N  F + +G R        N  +II+ +TDG    +  +        +A+  G +++
Sbjct: 142 YALNIAFSEAEGAR----PLRENVPRIIMIVTDGRPQDSVAE-----VAAKARNTGILIF 192

Query: 324 AIGI 327
           AIG+
Sbjct: 193 AIGV 196


>gi|218515283|ref|ZP_03512123.1| hypothetical protein Retl8_17130 [Rhizobium etli 8C-3]
          Length = 329

 Score = 47.0 bits (110), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 59/142 (41%), Gaps = 18/142 (12%)

Query: 236 LEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK------- 288
           L WG S +   +  L + G  TNS+  +  AY+ +          + EDA +K       
Sbjct: 179 LAWGTSGVSTYVNAL-QAGGGTNSSGAMSTAYSSLTAKNAAGN--DAEDAAHKLKTGQTP 235

Query: 289 -KIIVFMTDGENLSTKEDQQSL-----YYCNEAKKRGAIVYAIGIRVIRSHE-FLRACAS 341
            K IVFMTDG+N       +S        C+ AK +G  +Y I        +  L  CAS
Sbjct: 236 KKYIVFMTDGDNNDDSSGGRSYDTLTKATCDTAKSKGIEIYTIAFMAPEGGQALLHYCAS 295

Query: 342 PNSFYL-VENPHSMYDAFSHIG 362
            +S Y   E    +  AF  IG
Sbjct: 296 DDSHYFQAEKMEDLLAAFKAIG 317


>gi|194224466|ref|XP_001500626.2| PREDICTED: matrilin 4 [Equus caballus]
          Length = 542

 Score = 47.0 bits (110), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 81/174 (46%), Gaps = 22/174 (12%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ V+D SRS+  F      + +   + +  +L  + + P+   V   G++ +S++++
Sbjct: 35  LDLVFVIDSSRSVRPF------EFETMRQFLVGLLRSLDVGPNATRV---GVIQYSSQVQ 85

Query: 232 EFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM-QGMRQHCNTEDANYK 288
             F L        ++R I+ L      T +   ++YA N  F + +G R      +A   
Sbjct: 86  SVFPLSAFSRREDMERAIRALVPLAQGTMTGLAIQYAMNVAFSVAEGAR----PPEARVP 141

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
           ++ V +TDG     +   +      +A+ RG  +YA+G++       LRA ASP
Sbjct: 142 RVAVIVTDG-----RPQDRVAEVAAQARARGIEIYAVGVQRADVGS-LRAMASP 189



 Score = 38.1 bits (87), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 42/212 (19%), Positives = 95/212 (44%), Gaps = 32/212 (15%)

Query: 151 SRHIVMP-----ITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAM 205
           S H + P     +      N   +  +D+++++D S+S+           ++  + +N +
Sbjct: 279 SYHCLCPEGRQLLADGKSCNRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQI 332

Query: 206 LEEVKLIPDVNNVVQSGLVTFSNKIE-EFFLLEWGVSHLQRK----IKYLSKFGVSTNST 260
           ++ + + P+   V   GLV FS+++  EF L  +G +   ++    ++Y+ +    T + 
Sbjct: 333 VDFLDVSPEGTRV---GLVQFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMER---GTMTG 386

Query: 261 PGLKYAYNQIF-DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRG 319
             L++     F + QG R        N  ++ +  TDG +    +D  S++    AK+ G
Sbjct: 387 LALRHMVEHSFSEAQGAR----PRALNVPRVGLVFTDGRS----QDDISVWAAR-AKEEG 437

Query: 320 AIVYAIGIRVIRSHEFLRACASPNSFYLVENP 351
            ++YA+G+      E  +  + P   ++  +P
Sbjct: 438 IVMYAVGVGKAVEEELRKIASEPAELHVSYSP 469


>gi|114682165|ref|XP_001154021.1| PREDICTED: matrilin 4 isoform 4 [Pan troglodytes]
 gi|114682167|ref|XP_001154256.1| PREDICTED: matrilin 4 isoform 7 [Pan troglodytes]
 gi|114682175|ref|XP_514674.2| PREDICTED: matrilin 4 isoform 9 [Pan troglodytes]
 gi|114682177|ref|XP_001154315.1| PREDICTED: matrilin-4 isoform 8 [Pan troglodytes]
          Length = 581

 Score = 47.0 bits (110), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 85/188 (45%), Gaps = 31/188 (16%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVN---NVVQSGLVTFSN 228
           LD++ V+D SRS+  F   ++ +  M             L+P +N   N  + G++ +S+
Sbjct: 33  LDLVFVIDSSRSVRPFEFETMRQFLMG------------LLPGLNVGPNATRVGVIQYSS 80

Query: 229 KIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM-QGMRQHCNTEDA 285
           +++  F L        ++R I+ L      T +   ++YA N  F + +G R      + 
Sbjct: 81  QVQSVFPLRAFSRREDMERAIRDLVPLAQGTMTGLAIQYAMNVAFSVAEGAR----PPEE 136

Query: 286 NYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP--- 342
              ++ V +TDG     +   +      +A+ RG  +YA+G++       LRA ASP   
Sbjct: 137 RVPRVAVIVTDG-----RPQDRVAEVAAQARARGIEIYAVGVQRADVGS-LRAMASPPLD 190

Query: 343 NSFYLVEN 350
              +LVE+
Sbjct: 191 EHVFLVES 198



 Score = 37.4 bits (85), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 40/194 (20%), Positives = 88/194 (45%), Gaps = 27/194 (13%)

Query: 164 VNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGL 223
            N   +  +D+++++D S+S+           ++  + +N +++ + + P+   V   GL
Sbjct: 336 CNRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQIVDFLDVSPEGTRV---GL 386

Query: 224 VTFSNKIE-EFFLLEWGVSHLQRK----IKYLSKFGVSTNSTPGLKYAYNQIF-DMQGMR 277
           V FS+++  EF L  +G +   ++    ++Y+ +    T +   L++     F + QG R
Sbjct: 387 VQFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMER---GTMTGLALRHMVEHSFSEAQGAR 443

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                   N  ++ +  TDG +    +D  S++    AK+ G +VYA+G+      E   
Sbjct: 444 ----PRALNVPRVGLVFTDGRS----QDDISVWA-ARAKEEGIVVYAVGVGKAVEAELRE 494

Query: 338 ACASPNSFYLVENP 351
             + P   ++   P
Sbjct: 495 IASEPAELHVSYAP 508


>gi|26350291|dbj|BAC38785.1| unnamed protein product [Mus musculus]
          Length = 810

 Score = 46.2 bits (108), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 41/182 (22%), Positives = 89/182 (48%), Gaps = 21/182 (11%)

Query: 149 TNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEE 208
           +  RH+ M   +++  +S  + R D++ ++D SRS+ ++  + + +  + I      L+ 
Sbjct: 33  SRGRHVRMYPQTALLESSCENKRADLVFIIDSSRSVNTYDYAKVKEFILDI------LQF 86

Query: 209 VKLIPDVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYA 266
           + + PDV  V   GL+ + + ++  F L+     S ++R +K +      T +   ++YA
Sbjct: 87  LDIGPDVTRV---GLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYA 143

Query: 267 YNQIF-DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAI 325
            N  F + +G R        N  +II+ +TDG    +  +  +     +A+  G +++AI
Sbjct: 144 LNIAFSEAEGAR----PLRENVPRIIMIVTDGRPQDSVAEVAA-----KARNTGILIFAI 194

Query: 326 GI 327
           G+
Sbjct: 195 GV 196


>gi|148676905|gb|EDL08852.1| matrilin 2, isoform CRA_a [Mus musculus]
          Length = 836

 Score = 46.2 bits (108), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 41/182 (22%), Positives = 89/182 (48%), Gaps = 21/182 (11%)

Query: 149 TNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEE 208
           +  RH+ M   +++  +S  + R D++ ++D SRS+ ++  + + +  + I      L+ 
Sbjct: 59  SRGRHVRMYPQTALLESSCENKRADLVFIIDSSRSVNTYDYAKVKEFILDI------LQF 112

Query: 209 VKLIPDVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYA 266
           + + PDV  V   GL+ + + ++  F L+     S ++R +K +      T +   ++YA
Sbjct: 113 LDIGPDVTRV---GLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYA 169

Query: 267 YNQIF-DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAI 325
            N  F + +G R        N  +II+ +TDG    +  +  +     +A+  G +++AI
Sbjct: 170 LNIAFSEAEGAR----PLRENVPRIIMIVTDGRPQDSVAEVAA-----KARNTGILIFAI 220

Query: 326 GI 327
           G+
Sbjct: 221 GV 222


>gi|295092462|emb|CBK78569.1| von Willebrand factor type A domain. [Clostridium cf. saccharolyticum
            K10]
          Length = 2061

 Score = 46.2 bits (108), Expect = 0.008,   Method: Composition-based stats.
 Identities = 53/212 (25%), Positives = 91/212 (42%), Gaps = 25/212 (11%)

Query: 172  LDMMIVLDVSRSMESFFDSSITK-----IDMAIKSINAMLEEVKLIPDVNNV---VQSGL 223
            +D++ V+D S SM+   D    K      +     +N  L+E+  IPD+ +    +Q   
Sbjct: 1524 VDLVFVIDKSLSMDYDIDGDEIKWWEDETESRKDIVNDALDEI--IPDLCSQQYDIQIAG 1581

Query: 224  VTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
              FS       +L+W     Q+ +  L     S N+ P    A     DM       +  
Sbjct: 1582 YQFSGSSTR--VLDWSREE-QQVLNNLKISNTSYNTEPSQALA--DALDMLKTGSQAHQN 1636

Query: 284  DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFL---RACA 340
             +N KK ++FMTDGE   T+ ++ S Y  ++    GA +Y IG+    S + +   R+ A
Sbjct: 1637 QSNVKKYLIFMTDGE--PTESEELSYYAISKNPVPGASIYTIGVSSDASTDLMEGIRSTA 1694

Query: 341  SPNSF-----YLVENPHSMYDAFSHIGKDIVT 367
              N       +   +   + DAF+ I  +I++
Sbjct: 1695 EGNGMTAPATFKGTSAQLIKDAFTQIKDEIIS 1726



 Score = 38.5 bits (88), Expect = 1.9,   Method: Composition-based stats.
 Identities = 46/186 (24%), Positives = 78/186 (41%), Gaps = 22/186 (11%)

Query: 174  MMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEV-KLIPDVNNVVQSGLVTFSNKIEE 232
            +M V+D S SM+  F S  +  D   + +N+ LE     + D +  +Q G   FS+  E 
Sbjct: 1106 VMFVIDKSGSMDQSFGSGNS--DARREVVNSALELFFNQLSDGDYNIQFGGYKFSDSGER 1163

Query: 233  FFLLEWGVSHLQRKIKY--------LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
                +WG        KY        LS   +++  T G  Y    +       ++    +
Sbjct: 1164 VNFNDWGWQD-----KYWETDTSNALSHLKLTSWETDGSTYPSQTLRSAISALENVELGE 1218

Query: 285  ANYKKIIVFMTDGENLS-----TKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRAC 339
             N K+ ++F+TDGE        +KE+ ++ Y   +    G   YAI +    SH F+ + 
Sbjct: 1219 -NGKRYLIFLTDGEPGQNSYSFSKEEAENCYSAIKNLDSGTTFYAIQVANSDSHGFMESM 1277

Query: 340  ASPNSF 345
             S  +F
Sbjct: 1278 VSNANF 1283


>gi|134093095|gb|ABO52955.1| matrilin 4 isoform 1 precursor [Gorilla gorilla gorilla]
          Length = 581

 Score = 46.2 bits (108), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 85/185 (45%), Gaps = 25/185 (13%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ V+D SRS+  F   ++ +  M       +L  + + P+   V   G++ +S++++
Sbjct: 33  LDLVFVIDSSRSVRPFEFETVRQFLM------GLLRGLNVGPNATRV---GVIQYSSQVQ 83

Query: 232 EFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM-QGMRQHCNTEDANYK 288
             F L        ++R I+ L      T +   ++YA N  F + +G R      +    
Sbjct: 84  SVFPLRAFSRREDMERAIRDLVPLAQGTMTGLAIQYAMNVAFSVAEGAR----PPEERVP 139

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NSF 345
           ++ V +TDG     +   +      +A+ RG  +YA+G++       LRA ASP      
Sbjct: 140 RVAVIVTDG-----RPQDRVAEVAAQARARGIEIYAVGVQRADVGS-LRAMASPPLDEHV 193

Query: 346 YLVEN 350
           +LVE+
Sbjct: 194 FLVES 198


>gi|99081991|ref|YP_614145.1| hypothetical protein TM1040_2151 [Ruegeria sp. TM1040]
 gi|99038271|gb|ABF64883.1| hypothetical protein TM1040_2151 [Ruegeria sp. TM1040]
          Length = 582

 Score = 46.2 bits (108), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 37/71 (52%), Gaps = 1/71 (1%)

Query: 301 STKEDQQSLYYCNEAKKRGAIVYAIGIRVI-RSHEFLRACASPNSFYLVENPHSMYDAFS 359
           ST +D ++L  C  AK +G +V+ IG     R  E L+ACAS  S Y   +   + DAF+
Sbjct: 510 STTKDARTLDICEAAKAKGVVVFTIGFEAPSRGQEVLQACASSASHYYDVDGLEISDAFA 569

Query: 360 HIGKDIVTKRI 370
            I   I   R+
Sbjct: 570 SIASAIRQLRL 580


>gi|126273404|ref|XP_001377627.1| PREDICTED: similar to AMACO [Monodelphis domestica]
          Length = 784

 Score = 45.8 bits (107), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 96/203 (47%), Gaps = 39/203 (19%)

Query: 162 VKVNS-----QTDARLDMMIVLDVSRSM-ESFFDSSITKIDMAIKSINAMLEEVKLIPDV 215
           VK++S     Q  A LD++  LD S S+ +  F+ S      AIK    M + + + PD 
Sbjct: 35  VKISSASQLMQCSAALDVLFALDGSHSIGKGSFERSKY---FAIK----MCDALAIYPDR 87

Query: 216 NNVVQSGLVTFSN------KIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQ 269
              V+ G++ FS+       ++ FF  E     ++ KIK +   G ST +   LKY  ++
Sbjct: 88  ---VRVGVLQFSSVPQLEFPLDSFFTRE----EVKEKIKKIVFKGGSTETGLALKYLLHK 140

Query: 270 IFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV 329
            F   G R      +++  ++++ +TDG++    +        N+ K+RG +V+A+G+R 
Sbjct: 141 GFP--GGR------NSSVPQLLIIVTDGKSQGNID-----LPANQLKERGVMVFAVGVRF 187

Query: 330 IRSHEFLRACASPNSFYLVENPH 352
            R  E     + P   Y++   H
Sbjct: 188 PRWTELHTLASEPKDQYVLFAEH 210


>gi|13699836|ref|NP_085095.1| matrilin-4 isoform 3 precursor [Homo sapiens]
          Length = 499

 Score = 45.8 bits (107), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 85/185 (45%), Gaps = 25/185 (13%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ V+D SRS+  F   ++ +  M       +L  + + P+   V   G++ +S++++
Sbjct: 33  LDLVFVIDSSRSVRPFEFETMRQFLM------GLLRGLNVGPNATRV---GVIQYSSQVQ 83

Query: 232 EFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM-QGMRQHCNTEDANYK 288
             F L        ++R I+ L      T +   ++YA N  F + +G R      +    
Sbjct: 84  SVFPLRAFSRREDMERAIRDLVPLAQGTMTGLAIQYAMNVAFSVAEGAR----PPEERVP 139

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NSF 345
           ++ V +TDG     +   +      +A+ RG  +YA+G++       LRA ASP      
Sbjct: 140 RVAVIVTDG-----RPQDRVAEVAAQARARGIEIYAVGVQRADVGS-LRAMASPPLDEHV 193

Query: 346 YLVEN 350
           +LVE+
Sbjct: 194 FLVES 198


>gi|148676906|gb|EDL08853.1| matrilin 2, isoform CRA_b [Mus musculus]
          Length = 941

 Score = 45.8 bits (107), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 41/182 (22%), Positives = 89/182 (48%), Gaps = 21/182 (11%)

Query: 149 TNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEE 208
           +  RH+ M   +++  +S  + R D++ ++D SRS+ ++  + + +  + I      L+ 
Sbjct: 33  SRGRHVRMYPQTALLESSCENKRADLVFIIDSSRSVNTYDYAKVKEFILDI------LQF 86

Query: 209 VKLIPDVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYA 266
           + + PDV  V   GL+ + + ++  F L+     S ++R +K +      T +   ++YA
Sbjct: 87  LDIGPDVTRV---GLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYA 143

Query: 267 YNQIF-DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAI 325
            N  F + +G R        N  +II+ +TDG    +  +  +     +A+  G +++AI
Sbjct: 144 LNIAFSEAEGAR----PLRENVPRIIMIVTDGRPQDSVAEVAA-----KARNTGILIFAI 194

Query: 326 GI 327
           G+
Sbjct: 195 GV 196


>gi|13699834|ref|NP_085080.1| matrilin-4 isoform 2 precursor [Homo sapiens]
 gi|119596274|gb|EAW75868.1| matrilin 4, isoform CRA_c [Homo sapiens]
          Length = 540

 Score = 45.8 bits (107), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 85/185 (45%), Gaps = 25/185 (13%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ V+D SRS+  F   ++ +  M       +L  + + P+   V   G++ +S++++
Sbjct: 33  LDLVFVIDSSRSVRPFEFETMRQFLM------GLLRGLNVGPNATRV---GVIQYSSQVQ 83

Query: 232 EFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM-QGMRQHCNTEDANYK 288
             F L        ++R I+ L      T +   ++YA N  F + +G R      +    
Sbjct: 84  SVFPLRAFSRREDMERAIRDLVPLAQGTMTGLAIQYAMNVAFSVAEGAR----PPEERVP 139

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NSF 345
           ++ V +TDG     +   +      +A+ RG  +YA+G++       LRA ASP      
Sbjct: 140 RVAVIVTDG-----RPQDRVAEVAAQARARGIEIYAVGVQRADVGS-LRAMASPPLDEHV 193

Query: 346 YLVEN 350
           +LVE+
Sbjct: 194 FLVES 198


>gi|116253849|ref|YP_769687.1| hypothetical protein RL4112 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115258497|emb|CAK09601.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 398

 Score = 45.8 bits (107), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 85/400 (21%), Positives = 161/400 (40%), Gaps = 53/400 (13%)

Query: 8   IRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMN 67
           +R    +  G   I+TAI +P++    G+ I+ S++   K  L    D + + AAT + +
Sbjct: 10  LRRMLGDRGGNFGIMTAIMMPVLLGAAGLAIDYSNMALSKRELQEATDSAALAAATALAS 69

Query: 68  EGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVV--VPQNE 125
                        D     K+  +    N +      + I  I   TS+DI V     ++
Sbjct: 70  GAASTT------ADAEAIAKDFVSGQMANYVD----TDAISSIKAGTSVDIDVSATATSK 119

Query: 126 GYSISAISRYKIPLK-FCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSM 184
            Y ++  + Y I    F + + + T +   +   TS+    S T   L M +VLD S SM
Sbjct: 120 SYKVTVATSYGIAATPFMSVLGYKTLN---IGASTSTSSGTSDTKTALSMELVLDQSGSM 176

Query: 185 ESFFDSS-----------ITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN----- 228
                +            +TKID   K+ +A+ + +      +++V++G  +++N     
Sbjct: 177 GEKTTTCATYNGKNCKTYVTKIDALKKAADALFDALDTADPDHSLVRTGAYSYNNGLIYN 236

Query: 229 ----KIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIF------DMQGMRQ 278
               +I+    + WG +     +  ++  G  T++T  ++ A   I       D++  + 
Sbjct: 237 SQKTQIKSMSGMAWGTATTATYVSGITASG-GTDATEPMRQATLSIAKASDGSDVE-TQA 294

Query: 279 HCNTEDANYKKIIVFMTDGENLSTKE------DQQSLYYCNEAKKRGAIVYAIGIRVI-R 331
           H    +    + I+ MTDGE            DQ     C+  K  G  ++ +      +
Sbjct: 295 HAVKGNTIVSRYIILMTDGEMTGNTGVWQSSFDQNVRNQCDATKTAGIKIFTVAFMAPDK 354

Query: 332 SHEFLRACASPNS-FYLVENPHSMYDAFSHIGKDIVTKRI 370
             + L+ CASP   +Y  E    +  +F+ I K+  TK +
Sbjct: 355 GKQLLQYCASPGGNYYEAETMEKLVASFTSIAKE-ATKAV 393


>gi|301764008|ref|XP_002917404.1| PREDICTED: matrilin-4-like [Ailuropoda melanoleuca]
          Length = 594

 Score = 45.4 bits (106), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 50/222 (22%), Positives = 96/222 (43%), Gaps = 34/222 (15%)

Query: 135 YKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITK 194
           + +P+      PW T  + +  P   +          LD++ V+D SRS+  F      +
Sbjct: 7   WPLPMLLFLLQPWETQLQ-LAGPRCRT--------GPLDLVFVIDSSRSVRPF------E 51

Query: 195 IDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSH--LQRKIKYLSK 252
            +   + +  +L  + + P+   V   G++ +S++++  F L        ++  I+ L  
Sbjct: 52  FETMRQFLVGLLRGLDVGPNATRV---GVIQYSSQVQSVFPLGAFARREDMEHAIRALVP 108

Query: 253 FGVSTNSTPGLKYAYNQIFDM-QGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYY 311
               T +   ++YA N  F + +G R      +A   +I V +TDG     +   +    
Sbjct: 109 LAQGTMTGLAIQYAMNVAFSVAEGAR----PPEARVPRIAVIVTDG-----RPQDRVAEV 159

Query: 312 CNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NSFYLVEN 350
             +A+ RG  +YA+G++       LRA ASP      +LVE+
Sbjct: 160 AAQARARGIEIYAVGVQRADVGS-LRAMASPPLDEHVFLVES 200



 Score = 37.7 bits (86), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 39/194 (20%), Positives = 90/194 (46%), Gaps = 27/194 (13%)

Query: 164 VNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGL 223
            N   +  +D+++++D S+S+           ++  + +N +++ + + P+   V   GL
Sbjct: 338 CNRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQIVDFLDVSPEGTRV---GL 388

Query: 224 VTFSNKIE-EFFLLEWGVSHLQRK----IKYLSKFGVSTNSTPGLKYAYNQIF-DMQGMR 277
           V FS+++  EF L  +G +   ++    ++Y+ +    T +   L++     F + QG R
Sbjct: 389 VQFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMER---GTMTGLALRHMVEHSFSEAQGAR 445

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                   N  ++ +  TDG +    +D  S++    AK+ G ++YA+G+      E  +
Sbjct: 446 ----PRALNVPRVGLVFTDGRS----QDDISVWA-ARAKEEGIVMYAVGVGKAVEEELRQ 496

Query: 338 ACASPNSFYLVENP 351
             + P   ++  +P
Sbjct: 497 IASEPAELHVSYSP 510


>gi|281182610|ref|NP_001162037.1| matrilin-4 [Pongo abelii]
 gi|134093133|gb|ABO52993.1| matrilin 4 isoform 1 precursor [Pongo abelii]
          Length = 581

 Score = 45.4 bits (106), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 85/185 (45%), Gaps = 25/185 (13%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ V+D SRS+  F   ++ +  M       +L  + + P+   V   G++ +S++++
Sbjct: 33  LDLVFVIDSSRSVRPFEFETMRQFLM------GLLRGLNVGPNATRV---GVIQYSSQVQ 83

Query: 232 EFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM-QGMRQHCNTEDANYK 288
             F L        ++R I+ L      T +   ++YA N  F + +G R      +    
Sbjct: 84  SVFPLRAFSRSEDMERAIRDLVPLAQGTMTGLAIQYAMNVAFSVAEGAR----PPEERVP 139

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NSF 345
           ++ V +TDG     +   +      +A+ RG  +YA+G++       LRA ASP      
Sbjct: 140 RVAVIVTDG-----RPQDRVAEVAAQARARGIEIYAVGVQRADVGS-LRAMASPPLDEHV 193

Query: 346 YLVEN 350
           +LVE+
Sbjct: 194 FLVES 198


>gi|74202868|dbj|BAE37504.1| unnamed protein product [Mus musculus]
          Length = 928

 Score = 45.4 bits (106), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 41/182 (22%), Positives = 89/182 (48%), Gaps = 21/182 (11%)

Query: 149 TNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEE 208
           +  RH+ M   +++  +S  + R D++ ++D SRS+ ++  + + +  + I      L+ 
Sbjct: 33  SRGRHVRMYPQTALLESSCENKRADLVFIIDSSRSVNTYDYAKVKEFILDI------LQF 86

Query: 209 VKLIPDVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYA 266
           + + PDV  V   GL+ + + ++  F L+     S ++R +K +      T +   ++YA
Sbjct: 87  LDIGPDVTRV---GLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYA 143

Query: 267 YNQIF-DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAI 325
            N  F + +G R        N  +II+ +TDG    +  +  +     +A+  G +++AI
Sbjct: 144 LNIAFSEAEGAR----PLRENVPRIIMIVTDGRPQDSVAEVAA-----KARNTGILIFAI 194

Query: 326 GI 327
           G+
Sbjct: 195 GV 196


>gi|7387906|sp|O08746|MATN2_MOUSE RecName: Full=Matrilin-2; Flags: Precursor
 gi|2072792|gb|AAC53163.1| matrilin-2 precursor [Mus musculus]
          Length = 956

 Score = 45.4 bits (106), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 41/182 (22%), Positives = 89/182 (48%), Gaps = 21/182 (11%)

Query: 149 TNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEE 208
           +  RH+ M   +++  +S  + R D++ ++D SRS+ ++  + + +  + I      L+ 
Sbjct: 33  SRGRHVRMYPQTALLESSCENKRADLVFIIDSSRSVNTYDYAKVKEFILDI------LQF 86

Query: 209 VKLIPDVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYA 266
           + + PDV  V   GL+ + + ++  F L+     S ++R +K +      T +   ++YA
Sbjct: 87  LDIGPDVTRV---GLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYA 143

Query: 267 YNQIF-DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAI 325
            N  F + +G R        N  +II+ +TDG    +  +  +     +A+  G +++AI
Sbjct: 144 LNIAFSEAEGAR----PLRENVPRIIMIVTDGRPQDSVAEVAA-----KARNTGILIFAI 194

Query: 326 GI 327
           G+
Sbjct: 195 GV 196


>gi|62185620|gb|AAH92298.1| Matrilin 2 [Mus musculus]
          Length = 937

 Score = 45.4 bits (106), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 41/182 (22%), Positives = 89/182 (48%), Gaps = 21/182 (11%)

Query: 149 TNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEE 208
           +  RH+ M   +++  +S  + R D++ ++D SRS+ ++  + + +  + I      L+ 
Sbjct: 33  SRGRHVRMYPQTALLESSCENKRADLVFIIDSSRSVNTYDYAKVKEFILDI------LQF 86

Query: 209 VKLIPDVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYA 266
           + + PDV  V   GL+ + + ++  F L+     S ++R +K +      T +   ++YA
Sbjct: 87  LDIGPDVTRV---GLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYA 143

Query: 267 YNQIF-DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAI 325
            N  F + +G R        N  +II+ +TDG    +  +  +     +A+  G +++AI
Sbjct: 144 LNIAFSEAEGAR----PLRENVPRIIMIVTDGRPQDSVAEVAA-----KARNTGILIFAI 194

Query: 326 GI 327
           G+
Sbjct: 195 GV 196


>gi|20136122|gb|AAM11539.1| matrilin-2 [Mus musculus]
          Length = 956

 Score = 45.4 bits (106), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 41/182 (22%), Positives = 89/182 (48%), Gaps = 21/182 (11%)

Query: 149 TNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEE 208
           +  RH+ M   +++  +S  + R D++ ++D SRS+ ++  + + +  + I      L+ 
Sbjct: 33  SRGRHVRMYPQTALLESSCENKRADLVFIIDSSRSVNTYDYAKVKEFILDI------LQF 86

Query: 209 VKLIPDVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYA 266
           + + PDV  V   GL+ + + ++  F L+     S ++R +K +      T +   ++YA
Sbjct: 87  LDIGPDVTRV---GLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYA 143

Query: 267 YNQIF-DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAI 325
            N  F + +G R        N  +II+ +TDG    +  +  +     +A+  G +++AI
Sbjct: 144 LNIAFSEAEGAR----PLRENVPRIIMIVTDGRPQDSVAEVAA-----KARNTGILIFAI 194

Query: 326 GI 327
           G+
Sbjct: 195 GV 196


>gi|193786651|dbj|BAG51974.1| unnamed protein product [Homo sapiens]
          Length = 581

 Score = 45.4 bits (106), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 85/185 (45%), Gaps = 25/185 (13%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ V+D SRS+  F   ++ +  M       +L  + + P+   V   G++ +S++++
Sbjct: 33  LDLVFVIDSSRSVRPFEFETMRQFLM------GLLRGLNVGPNATRV---GVIQYSSQVQ 83

Query: 232 EFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM-QGMRQHCNTEDANYK 288
             F L        ++R I+ L      T +   ++YA N  F + +G R      +    
Sbjct: 84  SVFPLRAFSRREDMERAIRDLVPLAQGTMTGLAIQYAMNVAFSVAEGAR----PPEERVP 139

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NSF 345
           ++ V +TDG     +   +      +A+ RG  +YA+G++       LRA ASP      
Sbjct: 140 RVAVIVTDG-----RPQDRVAEVAAQARARGIEIYAVGVQRADVGS-LRAMASPPLDEHV 193

Query: 346 YLVEN 350
           +LVE+
Sbjct: 194 FLVES 198


>gi|120407045|ref|NP_058042.2| matrilin-2 [Mus musculus]
          Length = 937

 Score = 45.4 bits (106), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 41/182 (22%), Positives = 89/182 (48%), Gaps = 21/182 (11%)

Query: 149 TNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEE 208
           +  RH+ M   +++  +S  + R D++ ++D SRS+ ++  + + +  + I      L+ 
Sbjct: 33  SRGRHVRMYPQTALLESSCENKRADLVFIIDSSRSVNTYDYAKVKEFILDI------LQF 86

Query: 209 VKLIPDVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYA 266
           + + PDV  V   GL+ + + ++  F L+     S ++R +K +      T +   ++YA
Sbjct: 87  LDIGPDVTRV---GLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYA 143

Query: 267 YNQIF-DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAI 325
            N  F + +G R        N  +II+ +TDG    +  +  +     +A+  G +++AI
Sbjct: 144 LNIAFSEAEGAR----PLRENVPRIIMIVTDGRPQDSVAEVAA-----KARNTGILIFAI 194

Query: 326 GI 327
           G+
Sbjct: 195 GV 196


>gi|13699830|ref|NP_003824.2| matrilin-4 isoform 1 precursor [Homo sapiens]
 gi|4499937|emb|CAB39280.1| matrilin 4 [Homo sapiens]
          Length = 581

 Score = 45.4 bits (106), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 85/185 (45%), Gaps = 25/185 (13%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ V+D SRS+  F   ++ +  M       +L  + + P+   V   G++ +S++++
Sbjct: 33  LDLVFVIDSSRSVRPFEFETMRQFLM------GLLRGLNVGPNATRV---GVIQYSSQVQ 83

Query: 232 EFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM-QGMRQHCNTEDANYK 288
             F L        ++R I+ L      T +   ++YA N  F + +G R      +    
Sbjct: 84  SVFPLRAFSRREDMERAIRDLVPLAQGTMTGLAIQYAMNVAFSVAEGAR----PPEERVP 139

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NSF 345
           ++ V +TDG     +   +      +A+ RG  +YA+G++       LRA ASP      
Sbjct: 140 RVAVIVTDG-----RPQDRVAEVAAQARARGIEIYAVGVQRADVGS-LRAMASPPLDEHV 193

Query: 346 YLVEN 350
           +LVE+
Sbjct: 194 FLVES 198


>gi|22760140|dbj|BAC11083.1| unnamed protein product [Homo sapiens]
          Length = 540

 Score = 45.4 bits (106), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 85/185 (45%), Gaps = 25/185 (13%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ V+D SRS+  F   ++ +  M       +L  + + P+   V   G++ +S++++
Sbjct: 33  LDLVFVIDSSRSVRPFEFETMRQFLM------GLLRGLNVGPNATRV---GVIQYSSQVQ 83

Query: 232 EFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM-QGMRQHCNTEDANYK 288
             F L        ++R I+ L      T +   ++YA N  F + +G R      +    
Sbjct: 84  SVFPLRAFSRREDMERAIRDLVPLAQGTMTGLAIQYAMNVAFSVAEGAR----PPEERVP 139

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NSF 345
           ++ V +TDG     +   +      +A+ RG  +YA+G++       LRA ASP      
Sbjct: 140 RVAVIVTDG-----RPQDRVAEVAAQARARGIEIYAVGLQRADVGS-LRAMASPPLDEHV 193

Query: 346 YLVEN 350
           +LVE+
Sbjct: 194 FLVES 198


>gi|332208765|ref|XP_003253479.1| PREDICTED: LOW QUALITY PROTEIN: matrilin-4-like [Nomascus
           leucogenys]
          Length = 448

 Score = 45.1 bits (105), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 85/185 (45%), Gaps = 25/185 (13%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ V+D SRS+  F   ++ +  M       +L  + + P+   V   G++ +S++++
Sbjct: 33  LDLVFVIDSSRSVRPFEFETMRQFLM------GLLRGLNVGPNATRV---GVIQYSSQVQ 83

Query: 232 EFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM-QGMRQHCNTEDANYK 288
             F L        ++R I+ L      T +   ++YA N  F + +G R      +    
Sbjct: 84  SVFPLRAFSRREDMERAIRDLVPLAQGTMTGLAIQYAMNVAFSVAEGAR----PPEERVP 139

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NSF 345
           ++ V +TDG     +   +      +A+ RG  +YA+G++       LRA ASP      
Sbjct: 140 RVAVIVTDG-----RPQDRVAEVAAQARARGIEIYAVGVQRADVGS-LRAMASPPLDEHV 193

Query: 346 YLVEN 350
           +LVE+
Sbjct: 194 FLVES 198


>gi|119596273|gb|EAW75867.1| matrilin 4, isoform CRA_b [Homo sapiens]
          Length = 620

 Score = 45.1 bits (105), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 85/185 (45%), Gaps = 25/185 (13%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ V+D SRS+  F   ++ +  M       +L  + + P+   V   G++ +S++++
Sbjct: 33  LDLVFVIDSSRSVRPFEFETMRQFLM------GLLRGLNVGPNATRV---GVIQYSSQVQ 83

Query: 232 EFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM-QGMRQHCNTEDANYK 288
             F L        ++R I+ L      T +   ++YA N  F + +G R      +    
Sbjct: 84  SVFPLRAFSRREDMERAIRDLVPLAQGTMTGLAIQYAMNVAFSVAEGAR----PPEERVP 139

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NSF 345
           ++ V +TDG     +   +      +A+ RG  +YA+G++       LRA ASP      
Sbjct: 140 RVAVIVTDG-----RPQDRVAEVAAQARARGIEIYAVGVQRADVGS-LRAMASPPLDEHV 193

Query: 346 YLVEN 350
           +LVE+
Sbjct: 194 FLVES 198


>gi|73920229|sp|O95460|MATN4_HUMAN RecName: Full=Matrilin-4; Flags: Precursor
 gi|5419632|emb|CAB46380.1| matrilin 4 [Homo sapiens]
          Length = 622

 Score = 45.1 bits (105), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 85/185 (45%), Gaps = 25/185 (13%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ V+D SRS+  F   ++ +  M       +L  + + P+   V   G++ +S++++
Sbjct: 33  LDLVFVIDSSRSVRPFEFETMRQFLM------GLLRGLNVGPNATRV---GVIQYSSQVQ 83

Query: 232 EFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM-QGMRQHCNTEDANYK 288
             F L        ++R I+ L      T +   ++YA N  F + +G R      +    
Sbjct: 84  SVFPLRAFSRREDMERAIRDLVPLAQGTMTGLAIQYAMNVAFSVAEGAR----PPEERVP 139

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NSF 345
           ++ V +TDG     +   +      +A+ RG  +YA+G++       LRA ASP      
Sbjct: 140 RVAVIVTDG-----RPQDRVAEVAAQARARGIEIYAVGVQRADVGS-LRAMASPPLDEHV 193

Query: 346 YLVEN 350
           +LVE+
Sbjct: 194 FLVES 198


>gi|281345581|gb|EFB21165.1| hypothetical protein PANDA_005644 [Ailuropoda melanoleuca]
          Length = 581

 Score = 45.1 bits (105), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 85/185 (45%), Gaps = 25/185 (13%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ V+D SRS+  F      + +   + +  +L  + + P+   V   G++ +S++++
Sbjct: 11  LDLVFVIDSSRSVRPF------EFETMRQFLVGLLRGLDVGPNATRV---GVIQYSSQVQ 61

Query: 232 EFFLLEWGVSH--LQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM-QGMRQHCNTEDANYK 288
             F L        ++  I+ L      T +   ++YA N  F + +G R      +A   
Sbjct: 62  SVFPLGAFARREDMEHAIRALVPLAQGTMTGLAIQYAMNVAFSVAEGAR----PPEARVP 117

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NSF 345
           +I V +TDG     +   +      +A+ RG  +YA+G++       LRA ASP      
Sbjct: 118 RIAVIVTDG-----RPQDRVAEVAAQARARGIEIYAVGVQRADVGS-LRAMASPPLDEHV 171

Query: 346 YLVEN 350
           +LVE+
Sbjct: 172 FLVES 176



 Score = 37.7 bits (86), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 39/194 (20%), Positives = 90/194 (46%), Gaps = 27/194 (13%)

Query: 164 VNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGL 223
            N   +  +D+++++D S+S+           ++  + +N +++ + + P+   V   GL
Sbjct: 355 CNRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQIVDFLDVSPEGTRV---GL 405

Query: 224 VTFSNKIE-EFFLLEWGVSHLQRK----IKYLSKFGVSTNSTPGLKYAYNQIF-DMQGMR 277
           V FS+++  EF L  +G +   ++    ++Y+ +    T +   L++     F + QG R
Sbjct: 406 VQFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMER---GTMTGLALRHMVEHSFSEAQGAR 462

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                   N  ++ +  TDG +    +D  S++    AK+ G ++YA+G+      E  +
Sbjct: 463 ----PRALNVPRVGLVFTDGRS----QDDISVWA-ARAKEEGIVMYAVGVGKAVEEELRQ 513

Query: 338 ACASPNSFYLVENP 351
             + P   ++  +P
Sbjct: 514 IASEPAELHVSYSP 527


>gi|317483048|ref|ZP_07942050.1| von Willebrand factor type A domain-containing protein
           [Bifidobacterium sp. 12_1_47BFAA]
 gi|316915549|gb|EFV36969.1| von Willebrand factor type A domain-containing protein
           [Bifidobacterium sp. 12_1_47BFAA]
          Length = 813

 Score = 44.7 bits (104), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 83/184 (45%), Gaps = 30/184 (16%)

Query: 168 TDARLDMMIVLDVSRSMESFFDSSITKIDMAIKS-----INAMLEEVKLIPDVNNVVQSG 222
           T+  LD+++VLDVS SM         KID A+K+     I+A  +E   I D +   +  
Sbjct: 119 TNQPLDIVLVLDVSGSMADNLSGGPKKID-ALKTAVNGFIDATADENAKITDQSQRNRIA 177

Query: 223 LVTFSNKIE-----EFFLLEWG-------VSHLQRKIKYLSKF--GVSTNSTPGLKYAYN 268
           LV F+   +     +F+   W        VS+L   +  L+    G+S +      YA+N
Sbjct: 178 LVKFAGTEKTSVGNDFYREGWSSYNYTQIVSNLTYDVSGLTSTVNGLSASGATSADYAFN 237

Query: 269 QIFDMQGMRQHCNTEDANYKKIIVFMTDGE-NLSTKEDQQ-SLYYCNEAKK---RGAIVY 323
           +       +       AN KK+++F TDGE N  +  D   +    N+AK     G  +Y
Sbjct: 238 RAQAALTYQPR-----ANAKKVVIFFTDGEPNHGSGFDPTVAATAVNKAKSLKDAGTTIY 292

Query: 324 AIGI 327
           +IG+
Sbjct: 293 SIGV 296


>gi|281183022|ref|NP_001162498.1| matrilin-4 [Papio anubis]
 gi|134093054|gb|ABO52914.1| matrilin 4 isoform 1 precursor [Papio anubis]
          Length = 581

 Score = 44.7 bits (104), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 85/185 (45%), Gaps = 25/185 (13%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ V+D SRS+  F      + +   + +  +L  + + P+   V   G++ +S++++
Sbjct: 33  LDLVFVIDSSRSVRPF------EFETMRQFLVGLLRGLNVGPNATRV---GVIQYSSQVQ 83

Query: 232 EFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM-QGMRQHCNTEDANYK 288
             F L        ++R I+ L      T +   ++YA N  F + +G R      +    
Sbjct: 84  SVFPLRAFSRREDMERAIRDLVPLAQGTMTGLAIQYAMNVAFSVAEGAR----PPEERVP 139

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NSF 345
           ++ V +TDG     +   +      +A+ RG  +YA+G++       LRA ASP      
Sbjct: 140 RVAVIVTDG-----RPQDRVAEVAAQARARGIEIYAVGVQRADVGS-LRAMASPPLDEHV 193

Query: 346 YLVEN 350
           +LVE+
Sbjct: 194 FLVES 198


>gi|312794604|ref|YP_004027527.1| von willebrand factor type a [Caldicellulosiruptor kristjanssonii
           177R1B]
 gi|312181744|gb|ADQ41914.1| von Willebrand factor type A [Caldicellulosiruptor kristjanssonii
           177R1B]
          Length = 900

 Score = 44.7 bits (104), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 57/221 (25%), Positives = 96/221 (43%), Gaps = 38/221 (17%)

Query: 148 YTNS-RHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAML 206
           Y+NS    ++P+   +K N + +  +D+M+VLD S SM    D+ I K+++A  +   M+
Sbjct: 382 YSNSVLEKMLPVKMELK-NKEKEKNIDVMLVLDHSGSMADTEDAGIPKLEIAKSASAKMV 440

Query: 207 EEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRK---IKYLS--KFGVSTNSTP 261
           E ++    V      G++ F +     +   +    L RK   I+ +S  + G  T   P
Sbjct: 441 EHLESSDGV------GVIAFDHN----YYWAYKFGKLVRKEDVIESISSIEVGGGTAIIP 490

Query: 262 GLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYY--CNEAKKRG 319
            L  A   +   +              K++V +TDG        +QS Y    +EAK+  
Sbjct: 491 PLSEAVKTLKKSKAKN-----------KLVVLLTDGMG------EQSGYEIPADEAKRNN 533

Query: 320 AIVYAIGIRVIRSHEFLRACASPNS--FYLVENPHSMYDAF 358
             +  IG+    +   L   A+  S  FYLV NP  + D F
Sbjct: 534 IKITTIGVGKFVNASVLSWIAAYTSGRFYLVSNPSELVDVF 574


>gi|274320027|ref|NP_001162099.1| matrilin-4 [Macaca mulatta]
 gi|134093113|gb|ABO52973.1| matrilin 4 isoform 1 precursor [Macaca mulatta]
          Length = 581

 Score = 44.3 bits (103), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 85/185 (45%), Gaps = 25/185 (13%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ V+D SRS+  F      + +   + +  +L  + + P+   V   G++ +S++++
Sbjct: 33  LDLVFVIDSSRSVRPF------EFETMRQFLVGLLRGLNVGPNATRV---GVIQYSSQVQ 83

Query: 232 EFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM-QGMRQHCNTEDANYK 288
             F L        ++R I+ L      T +   ++YA N  F + +G R      +    
Sbjct: 84  SVFPLRAFSRREDMERAIRDLVPLAQGTMTGLAIQYAMNVAFSVAEGAR----PPEERVP 139

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NSF 345
           ++ V +TDG     +   +      +A+ RG  +YA+G++       LRA ASP      
Sbjct: 140 RVAVIVTDG-----RPQDRVAEVAAQARARGIEIYAVGVQRADVGS-LRAMASPPLDEHV 193

Query: 346 YLVEN 350
           +LVE+
Sbjct: 194 FLVES 198


>gi|47208180|emb|CAF89812.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 1636

 Score = 44.3 bits (103), Expect = 0.028,   Method: Composition-based stats.
 Identities = 50/199 (25%), Positives = 86/199 (43%), Gaps = 30/199 (15%)

Query: 173 DMMIVLDVSRSME--SFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK- 229
           D+  ++D S S+    F+D          K I   L+  ++ P   N V+ G+V +++  
Sbjct: 459 DIFFLIDQSGSIHPPDFYDMK--------KFILEFLQTFRVGP---NHVRIGVVKYADSP 507

Query: 230 IEEFFLLEW-GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
             EF L  +  V  L++ I  + + G  T +   L +   Q FD     +   T     K
Sbjct: 508 TLEFDLHTYTDVKSLEKAITNIHQVGGGTETGKALDFMRPQ-FD-----RAVTTRGHKVK 561

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLV 348
           + +V +TDG +    +D       ++ + +G +VYAIG++     E L     P   + V
Sbjct: 562 EYLVVITDGNSTDKVKDP-----ADKLRAQGVVVYAIGVKDAVEKELLEISGEPQRTFYV 616

Query: 349 ENPHSMYDAFSHIGKDIVT 367
            N    +DA   I  DI+T
Sbjct: 617 NN----FDALKPIKDDIIT 631


>gi|222149754|ref|YP_002550711.1| hypothetical protein Avi_3756 [Agrobacterium vitis S4]
 gi|221736736|gb|ACM37699.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 437

 Score = 44.3 bits (103), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 77/182 (42%), Gaps = 14/182 (7%)

Query: 192 ITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLS 251
           I  + +A+  + A L+  K  P+ +  V++G  +++   +    + WG +++   +  LS
Sbjct: 249 IESLKLAVADLAAQLK--KADPN-SEYVRTGADSYNASADTAQAMSWGTANVVTYVNALS 305

Query: 252 KFGVSTNSTPGLKYAYN--QIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSL 309
             G  T++   L  AY+  Q  +   +  H  +  +   + IVFMTDGE         S 
Sbjct: 306 ATG-GTDARGALSAAYSALQTSNKTEITAHNVSSVSKIGRYIVFMTDGEMTGNSSSWSSS 364

Query: 310 Y------YCNEAKKRGAIVYAIG-IRVIRSHEFLRACASPNS-FYLVENPHSMYDAFSHI 361
                   C   K  G  +Y +  +        L ACAS  S +Y   +  S+  AF  I
Sbjct: 365 IDSAVRSQCTSIKADGIQIYTVAFMAPANGKSLLSACASDASHYYEATDAASLVAAFGEI 424

Query: 362 GK 363
           GK
Sbjct: 425 GK 426


>gi|311274909|ref|XP_003134506.1| PREDICTED: matrilin-4-like [Sus scrofa]
          Length = 721

 Score = 43.9 bits (102), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 86/187 (45%), Gaps = 29/187 (15%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ V+D SRS+  F      + +   + +  +L  + + P+   V   G++ +S++++
Sbjct: 173 LDLVFVIDSSRSVRPF------EFETMRQFLVGLLRSLDVGPNATRV---GVIQYSSQVQ 223

Query: 232 EFFLLEWGV----SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM-QGMRQHCNTEDAN 286
             F L  G       ++  I+ L      T +   ++YA N  F + +G R      +A 
Sbjct: 224 SVFPL--GAFSRREDMEGAIRALVPLAQGTMTGLAIQYAMNVAFSVAEGAR----PPEAR 277

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---N 343
             ++ V +TDG     +   +      +A+ RG  +YA+G++       LRA ASP    
Sbjct: 278 VPRVAVIVTDG-----RPQDRVAEVAAQARARGIEIYAVGVQRADVGS-LRAMASPPLDE 331

Query: 344 SFYLVEN 350
             +LVE+
Sbjct: 332 HVFLVES 338



 Score = 36.2 bits (82), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 39/194 (20%), Positives = 89/194 (45%), Gaps = 27/194 (13%)

Query: 164 VNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGL 223
            N   +  +D+++++D S+S+           ++  + +N +++ + + P+   V   GL
Sbjct: 476 CNRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQIVDFLDVSPEGTRV---GL 526

Query: 224 VTFSNKIE-EFFLLEWGVSHLQRK----IKYLSKFGVSTNSTPGLKYAYNQIF-DMQGMR 277
           V FS+++  EF L  +G +   ++    ++Y+ +    T +   L++     F + QG R
Sbjct: 527 VQFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMER---GTMTGLALRHMVEHSFSEAQGAR 583

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                   N  ++ +  TDG +    +D  S++    AK+ G ++YA+G+      E   
Sbjct: 584 ----PRALNVPRVGLVFTDGRS----QDDVSVWA-ARAKEEGIVMYAVGVGKAVEEELRE 634

Query: 338 ACASPNSFYLVENP 351
             + P   ++  +P
Sbjct: 635 IASEPAELHVSYSP 648


>gi|13529371|gb|AAH05429.1| Matn2 protein [Mus musculus]
          Length = 956

 Score = 43.9 bits (102), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 41/182 (22%), Positives = 88/182 (48%), Gaps = 21/182 (11%)

Query: 149 TNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEE 208
           +  RH+ M   +++  +S  + R D++ ++D SRS+ +   + + +  + I      L+ 
Sbjct: 33  SRGRHVRMYPQTALLESSCENKRADLVFIIDSSRSVNTHDYAKVKEFILDI------LQF 86

Query: 209 VKLIPDVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYA 266
           + + PDV  V   GL+ + + ++  F L+     S ++R +K +      T +   ++YA
Sbjct: 87  LDIGPDVTRV---GLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYA 143

Query: 267 YNQIF-DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAI 325
            N  F + +G R        N  +II+ +TDG    +  +  +     +A+  G +++AI
Sbjct: 144 LNIAFSEAEGAR----PLRENVPRIIMIVTDGRPQDSVAEVAA-----KARNTGILIFAI 194

Query: 326 GI 327
           G+
Sbjct: 195 GV 196


>gi|218506715|ref|ZP_03504593.1| hypothetical protein RetlB5_03444 [Rhizobium etli Brasil 5]
          Length = 269

 Score = 43.5 bits (101), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 57/142 (40%), Gaps = 18/142 (12%)

Query: 236 LEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK------- 288
           L WG++ +   +  L   G  TNS+  +  AY  +          + EDA +K       
Sbjct: 119 LAWGITAVTSYVNALESGG-GTNSSGAVNTAYTSLTAKNAAGN--DAEDAAHKLKTGQLP 175

Query: 289 -KIIVFMTDGENLSTKEDQQSL-----YYCNEAKKRGAIVYAIGIRVIRSHE-FLRACAS 341
            K IVFMTDG+N       +S        C+ AK +G   Y I        +  L  CAS
Sbjct: 176 KKYIVFMTDGDNNDDSRGGRSYDTLTKATCDTAKAKGIETYTIAFMAPEGGQALLHYCAS 235

Query: 342 PNSFYL-VENPHSMYDAFSHIG 362
            ++ Y   E    +  AF  IG
Sbjct: 236 DDAHYFQAEKMEDLLAAFKAIG 257


>gi|317502941|ref|ZP_07961033.1| aerotolerance protein BatB [Prevotella salivae DSM 15606]
 gi|315665940|gb|EFV05515.1| aerotolerance protein BatB [Prevotella salivae DSM 15606]
          Length = 340

 Score = 43.5 bits (101), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 48/202 (23%), Positives = 90/202 (44%), Gaps = 32/202 (15%)

Query: 132 ISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSS 191
           +S+Y+  +KFC  +   T    ++       K++ +    ++++I LD+S SM       
Sbjct: 50  VSKYRPTIKFCLLLSAITILIFMIARPQVGSKISHEKREGIEVLIALDISNSM------- 102

Query: 192 ITKIDMAIKSINAMLEEVKLIPDVNNVV------QSGLVTFSNKIEEFFLLEWGVSHLQR 245
                MA   I + LE+ KL+  + ++V      + GLV F+   + F  L     ++  
Sbjct: 103 -----MAQDVIPSRLEKSKLL--IEDLVDHFTNDKVGLVVFAG--DAFVQLPITNDYVSA 153

Query: 246 KIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKED 305
           K+ +L     S  +T G   A         + Q C T+  +  + I+ +TDGE+     +
Sbjct: 154 KM-FLQNINPSLITTQGTDLAR-----AISLSQSCFTQREHIGRAIIVITDGED----HE 203

Query: 306 QQSLYYCNEAKKRGAIVYAIGI 327
             +L    EA K+G  V+ +G+
Sbjct: 204 GGALEAAREAYKKGINVFILGV 225


>gi|224046544|ref|XP_002198814.1| PREDICTED: matrilin 2 [Taeniopygia guttata]
          Length = 902

 Score = 43.1 bits (100), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 82/166 (49%), Gaps = 21/166 (12%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           NS  +  LD++ ++D SRS+ S +D    K+   I +I   L+ + + PD  +V   GL+
Sbjct: 7   NSCNNKHLDLVFIIDSSRSV-SHYD--FEKVKEFILTI---LQFLDISPDATHV---GLI 57

Query: 225 TFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIF-DMQGMRQHCN 281
            + + +++ F L+       ++R +K +   G  T +   L+YA N  F + +G R    
Sbjct: 58  QYGSTVKQEFSLKTFRRKQDIERAVKRMMHLGTGTMTGLALQYAVNIAFSETEGAR---- 113

Query: 282 TEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGI 327
               N  +II+ +TDG       +  +     +A+  G +++AIG+
Sbjct: 114 PLRQNVPRIIMIVTDGRPQDPVAEIAA-----KARNSGILIFAIGV 154


>gi|134093078|gb|ABO52938.1| matrilin 4 isoform 1 precursor [Colobus guereza]
          Length = 581

 Score = 43.1 bits (100), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 85/185 (45%), Gaps = 25/185 (13%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ V+D SRS+  F      + +   + +  ++  + + P+   V   G++ +S++++
Sbjct: 33  LDLVFVIDSSRSVRPF------EFETMRQFLVGLVRGLNVGPNATRV---GVIQYSSQVQ 83

Query: 232 EFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM-QGMRQHCNTEDANYK 288
             F L        ++R I+ L      T +   ++YA N  F + +G R      +    
Sbjct: 84  SVFPLRAFSRREDMERAIRDLVPLAQGTMTGLAIQYAMNVAFSVAEGAR----PPEERVP 139

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NSF 345
           ++ V +TDG     +   +      +A+ RG  +YA+G++       LRA ASP      
Sbjct: 140 RVAVIVTDG-----RPQDRVAEVAAQARARGIEIYAVGVQRADVGS-LRAMASPPLDEHV 193

Query: 346 YLVEN 350
           +LVE+
Sbjct: 194 FLVES 198


>gi|126341666|ref|XP_001379908.1| PREDICTED: hypothetical protein [Monodelphis domestica]
          Length = 2347

 Score = 43.1 bits (100), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 45/208 (21%), Positives = 81/208 (38%), Gaps = 43/208 (20%)

Query: 169 DARLDMMIVLDVSRS--------MESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQ 220
           D + D+M ++D SRS        M++F  + + K  +                   + VQ
Sbjct: 624 DVKADVMFLVDSSRSIGLENFGKMKTFMKNLVNKSQIG-----------------EDQVQ 666

Query: 221 SGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQ 278
            G+V FS+  +E F L   W    +   I  +S     T +   LK+  +     +G R 
Sbjct: 667 VGIVQFSDVNKEEFQLNRYWTQHEIFDAIDRMSNIDRETLTGSALKFVSDYFHPSKGAR- 725

Query: 279 HCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRA 338
                    +K ++ +TDGE+    +D          ++ G I+Y++G+      + +  
Sbjct: 726 ------PGVRKFLILITDGESQDPVKDPAMAL-----RQDGVIIYSVGVYGANETQLVEI 774

Query: 339 CASPNSFYLVENPHSMYDAFSHIGKDIV 366
              P   + VE     +D   HI  D+V
Sbjct: 775 SGKPEMIFYVET----FDILKHIEDDLV 798


>gi|134093165|gb|ABO53025.1| matrilin 4 isoform 1 precursor, 5 prime [Chlorocebus aethiops]
          Length = 214

 Score = 43.1 bits (100), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 41/184 (22%), Positives = 82/184 (44%), Gaps = 23/184 (12%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ V+D SRS+  F      + +   + +  +L  +K+     N  + G++ +S++++
Sbjct: 33  LDLVFVIDSSRSVRPF------EFETMRQFLVGLLRGLKV---GANATRVGVIQYSSQVQ 83

Query: 232 EFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
             F L        ++R I+ L      T +   ++Y  N  F +    +     +    +
Sbjct: 84  SVFPLRAFSRREDMERAIRDLVPLAQGTMTGLAIQYVMNVAFSVA---EGARPPEERVPR 140

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NSFY 346
           + V +TDG     +   +      +A+ RG  +YA+G++       LRA ASP      +
Sbjct: 141 VAVIVTDG-----RPQDRVAEVAAQARARGIEIYAVGVQRADVGS-LRAMASPPLDEHVF 194

Query: 347 LVEN 350
           LVE+
Sbjct: 195 LVES 198


>gi|134093103|gb|ABO52963.1| matrilin 4 isoform 1 precursor [Lemur catta]
          Length = 583

 Score = 43.1 bits (100), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 35/160 (21%), Positives = 74/160 (46%), Gaps = 21/160 (13%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ V+D SRS+  F   ++ +       +  +L  + + P+   V   G++ +S++++
Sbjct: 35  LDLVFVIDSSRSVRPFEFETVRQF------LVGLLHGLNVGPNATRV---GVIQYSSQVQ 85

Query: 232 EFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM-QGMRQHCNTEDANYK 288
             F L        ++R I+ L      T +   ++YA N  F + +G R      +    
Sbjct: 86  SVFPLGAFSRPEDMERAIRALVPLAQGTMTGLAIQYAMNVAFSVAEGAR----PPEERVP 141

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR 328
           ++ V +TDG     +   +      +A+ RG  +YA+G++
Sbjct: 142 RVAVIVTDG-----RPQDRVAEVAAQARARGIEIYAVGVQ 176



 Score = 38.9 bits (89), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 40/194 (20%), Positives = 89/194 (45%), Gaps = 27/194 (13%)

Query: 164 VNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGL 223
            N   +  +D+++++D S+S+           ++  + +N +++ + + PD   V   GL
Sbjct: 338 CNRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQIVDFLDVSPDGTRV---GL 388

Query: 224 VTFSNKIE-EFFLLEWGVSHLQRK----IKYLSKFGVSTNSTPGLKYAYNQIF-DMQGMR 277
           V FS+++  EF L  +G +   ++    ++Y+ +    T +   L++     F + QG R
Sbjct: 389 VQFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMER---GTMTGLALRHMVEHSFSEAQGAR 445

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                   N  ++ +  TDG +    +D  S++    AK+ G ++YA+G+      E   
Sbjct: 446 ----PRALNVPRVGLVFTDGRS----QDDISVWA-ARAKEEGIVMYAVGVGKAVEEELRE 496

Query: 338 ACASPNSFYLVENP 351
             + P   ++  +P
Sbjct: 497 IASEPAELHVSYSP 510


>gi|218662625|ref|ZP_03518555.1| hypothetical protein RetlI_26027 [Rhizobium etli IE4771]
          Length = 389

 Score = 43.1 bits (100), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 83/207 (40%), Gaps = 21/207 (10%)

Query: 177 VLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLL 236
           V D      + + + I  + MA  ++ A L      P+    V++G V++         L
Sbjct: 183 VWDTCTGSRANYYTKIEALKMAAGNLFAQLSGAD--PNAQ-YVRTGAVSYDIVQYAPSSL 239

Query: 237 EWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK-------- 288
            WG   +   +  L + G  TNS+  +  AY  +          + ED+ +K        
Sbjct: 240 AWGAIGVSSYVNAL-QAGGGTNSSGAMSTAYLSLTAKNAAGN--DAEDSAHKLKSGQIPQ 296

Query: 289 KIIVFMTDGENLSTKEDQQSL-----YYCNEAKKRGAIVYAIG-IRVIRSHEFLRACASP 342
           K IVFMTDG+N +     +S        C+ AK +G  +Y I  +        L+ CAS 
Sbjct: 297 KYIVFMTDGDNNNDSSGGRSYDTLTKATCDTAKSKGIEIYTIAFMAPPGGQALLQYCASD 356

Query: 343 NSFYL-VENPHSMYDAFSHIGKDIVTK 368
            S Y   E    ++ AF  IG    T+
Sbjct: 357 ASHYFQAEKMEDLFAAFKAIGAKASTQ 383


>gi|146327011|gb|AAI41812.1| Matrilin 4 [Homo sapiens]
          Length = 540

 Score = 42.7 bits (99), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 84/185 (45%), Gaps = 25/185 (13%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ V+D SRS+  F   ++ +  M       +L  + + P+   V   G++ +S++++
Sbjct: 33  LDLVFVIDSSRSVRPFEFETMRQFLM------GLLRGLNVGPNATRV---GVIQYSSQVQ 83

Query: 232 EFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM-QGMRQHCNTEDANYK 288
             F L        ++R I+ L      T +   ++YA N  F + +G R      +    
Sbjct: 84  SVFPLRAFSRREDMERAIRDLVPLAQGTMTGLAIQYAMNVAFSVAEGAR----PPEERVP 139

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NSF 345
           ++ V +TDG     +   +      +A+  G  +YA+G++       LRA ASP      
Sbjct: 140 RVAVIVTDG-----RPQDRVAEVAAQARASGIEIYAVGVQRADVGS-LRAMASPPLDEHV 193

Query: 346 YLVEN 350
           +LVE+
Sbjct: 194 FLVES 198


>gi|3927992|emb|CAA07569.1| matrilin-4 [Homo sapiens]
 gi|124297520|gb|AAI31764.1| Matrilin 4 [Homo sapiens]
 gi|153217472|gb|AAI51220.1| Matrilin 4 [Homo sapiens]
          Length = 581

 Score = 42.7 bits (99), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 84/185 (45%), Gaps = 25/185 (13%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ V+D SRS+  F   ++ +  M       +L  + + P+   V   G++ +S++++
Sbjct: 33  LDLVFVIDSSRSVRPFEFETMRQFLM------GLLRGLNVGPNATRV---GVIQYSSQVQ 83

Query: 232 EFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM-QGMRQHCNTEDANYK 288
             F L        ++R I+ L      T +   ++YA N  F + +G R      +    
Sbjct: 84  SVFPLRAFSRREDMERAIRDLVPLAQGTMTGLAIQYAMNVAFSVAEGAR----PPEERVP 139

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NSF 345
           ++ V +TDG     +   +      +A+  G  +YA+G++       LRA ASP      
Sbjct: 140 RVAVIVTDG-----RPQDRVAEVAAQARASGIEIYAVGVQRADVGS-LRAMASPPLDEHV 193

Query: 346 YLVEN 350
           +LVE+
Sbjct: 194 FLVES 198


>gi|311268548|ref|XP_003132103.1| PREDICTED: collagen alpha-5(VI) chain-like [Sus scrofa]
          Length = 2519

 Score = 42.4 bits (98), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 88/199 (44%), Gaps = 23/199 (11%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ VLD S S++     S+         IN  +  VK      N VQ G + +SN+ +
Sbjct: 811 LDVVFVLDHSSSIQPRDQESM---------INLTMHLVKKSDVGPNRVQFGALRYSNEPD 861

Query: 232 EFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKII 291
             F L    S +   ++ LS  G  T +   L+ A N +F      +H +    N K+++
Sbjct: 862 IIFYLNSNRSAIMEYLRSLSAKGGDTYTAKALERA-NILF----TEEHGSRIKQNVKQML 916

Query: 292 VFMTDGENLSTKEDQQSLYYCNEAKK---RGAIVYAIGIRVIRSHEFLRACASPNSFYLV 348
           + +TDG++         ++  ++A K   +G I+YA+G+      E      + +    V
Sbjct: 917 IIITDGKS------HDHIHLSDKASKLRAKGIIIYAVGVGEANQEELETMAGNKHYTIHV 970

Query: 349 ENPHSMYDAFSHIGKDIVT 367
            N  S+ D +  + + + T
Sbjct: 971 SNFDSLKDVYQPLQESMCT 989


>gi|149042955|gb|EDL96529.1| matrilin 4 (predicted), isoform CRA_a [Rattus norvegicus]
          Length = 637

 Score = 42.4 bits (98), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 42/220 (19%), Positives = 104/220 (47%), Gaps = 34/220 (15%)

Query: 153 HIVMPITSSVKVNSQT-----DARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLE 207
           H + P    ++ + ++     +  +D+++++D S+S+           ++  + +N +++
Sbjct: 376 HCLCPEGRRLQADGKSCDRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQIVD 429

Query: 208 EVKLIPDVNNVVQSGLVTFSNKIE-EFFLLEWGVSHLQRK----IKYLSKFGVSTNSTPG 262
            + + P+   V   GLV FS+++  EF L  +G +   ++    ++Y+ +    T +   
Sbjct: 430 FLDVSPEGTRV---GLVQFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMER---GTMTGLA 483

Query: 263 LKYAYNQIF-DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAI 321
           L++     F ++QG R      D N  ++ +  TDG +    +D  S++    AK+ G +
Sbjct: 484 LRHMVEHSFSEVQGAR----PRDLNVPRVGLVFTDGRS----QDDISVWA-ARAKEEGIV 534

Query: 322 VYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHI 361
           +YA+G+      E     + P+  ++  +P   ++  +H+
Sbjct: 535 MYAVGVGKAVEEELREIASEPSELHVSYSPD--FNTMTHL 572



 Score = 42.4 bits (98), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 86/186 (46%), Gaps = 27/186 (14%)

Query: 172 LDMMIVLDVSRSMESF-FDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
           LD++ ++D SRS+  F F++    +   + S++  L          N  + G++ +S+++
Sbjct: 48  LDLVFMIDSSRSVRPFEFETMRQFLVGLLHSLDVGL----------NATRVGVIQYSSQV 97

Query: 231 EEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIF-DMQGMRQHCNTEDANY 287
           +  F L        ++R I+ +      T +   ++YA N  F + +G R      +   
Sbjct: 98  QSVFPLGAFSNREDMERAIRAVVPLAQGTMTGLAIQYAMNVAFSEAEGAR----PSEERV 153

Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NS 344
            +++V +TDG     +   +      +A+ RG  +YA+G++       LRA ASP     
Sbjct: 154 PRVLVIVTDG-----RPQDRVAEVAAQARARGIEIYAVGVQRADVGS-LRAMASPPLDQH 207

Query: 345 FYLVEN 350
            +LVE+
Sbjct: 208 VFLVES 213


>gi|290769676|gb|ADD61455.1| putative protein [uncultured organism]
          Length = 816

 Score = 42.4 bits (98), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 55/186 (29%), Positives = 83/186 (44%), Gaps = 31/186 (16%)

Query: 168 TDARLDMMIVLDVSRSMESFFDSS---ITKID---MAI-KSINAMLEEVKLIPDVNNVVQ 220
           T+  LD+++VLDVS SM     S     TKID    A+ K INA   E   I D +   +
Sbjct: 119 TNQPLDIVLVLDVSGSMAEKIASGWNQPTKIDSLKTAVNKFINATAAENAKITDQSQRNR 178

Query: 221 SGLVTFSNKIE-----EFFLLEWG-------VSHLQRKIKYLSKF--GVSTNSTPGLKYA 266
             LV F+   +     +F+   W        VS+L   +  L+    G+S +      YA
Sbjct: 179 IALVKFAGTEKTSVGNDFYREGWSSYNYTQIVSNLTYDVSGLTSTVNGLSASGATSADYA 238

Query: 267 YNQIFDMQGMRQHCNTEDANYKKIIVFMTDGE-NLSTKEDQQ-SLYYCNEAKK---RGAI 321
           +N+       +       AN KK+++F TDGE N  +  D   +    N+AK     G  
Sbjct: 239 FNRAQAALTYQPR-----ANAKKVVIFFTDGEPNHGSGFDPTVAATAVNKAKSLKDAGTT 293

Query: 322 VYAIGI 327
           +Y+IG+
Sbjct: 294 IYSIGV 299


>gi|118087212|ref|XP_424219.2| PREDICTED: similar to matrilin 2 [Gallus gallus]
          Length = 1799

 Score = 42.4 bits (98), Expect = 0.13,   Method: Composition-based stats.
 Identities = 37/172 (21%), Positives = 81/172 (47%), Gaps = 21/172 (12%)

Query: 159 TSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNV 218
           + S+  N+  + RLD++ ++D SRS+  +    + +  + I      L+ + + PD   V
Sbjct: 18  SQSLLENTCNNKRLDLVFIIDSSRSVRPYDFEKVKEFILTI------LQFLDVSPDATRV 71

Query: 219 VQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIF-DMQG 275
              GL+ + + ++  F L+       ++R ++ +      T +   ++YA N  F + +G
Sbjct: 72  ---GLIQYGSTVKHEFSLKTFRRKQEIERAVRRMMHLATGTMTGLAIQYAVNIAFSESEG 128

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGI 327
            R      + N  +II+ +TDG       +  +     +A+  G +++AIG+
Sbjct: 129 AR----PLNQNVPRIIMIVTDGRPQDPVGEIAA-----KARNSGILIFAIGV 171


>gi|239620965|ref|ZP_04663996.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis CCUG 52486]
 gi|239516066|gb|EEQ55933.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis CCUG 52486]
          Length = 816

 Score = 42.4 bits (98), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 55/186 (29%), Positives = 83/186 (44%), Gaps = 31/186 (16%)

Query: 168 TDARLDMMIVLDVSRSMESFFDSS---ITKID---MAI-KSINAMLEEVKLIPDVNNVVQ 220
           T+  LD+++VLDVS SM     S     TKID    A+ K INA   E   I D +   +
Sbjct: 119 TNQPLDIVLVLDVSGSMAEKIASGWNQPTKIDSLKTAVNKFINATAAENAKITDQSQRNR 178

Query: 221 SGLVTFSNKIE-----EFFLLEWG-------VSHLQRKIKYLSKF--GVSTNSTPGLKYA 266
             LV F+   +     +F+   W        VS+L   +  L+    G+S +      YA
Sbjct: 179 IALVKFAGTEKTSVGNDFYREGWSSYNYTQIVSNLTYDVSGLTSTVNGLSASGATSADYA 238

Query: 267 YNQIFDMQGMRQHCNTEDANYKKIIVFMTDGE-NLSTKEDQQ-SLYYCNEAKK---RGAI 321
           +N+       +       AN KK+++F TDGE N  +  D   +    N+AK     G  
Sbjct: 239 FNRAQAALTYQPR-----ANAKKVVIFFTDGEPNHGSGFDPTVAATAVNKAKSLKDAGTT 293

Query: 322 VYAIGI 327
           +Y+IG+
Sbjct: 294 IYSIGV 299


>gi|46190503|ref|ZP_00121395.2| COG2304: Uncharacterized protein containing a von Willebrand factor
           type A (vWA) domain [Bifidobacterium longum DJO10A]
 gi|189440499|ref|YP_001955580.1| von Willebrand factor (vWF) domain containing protein
           [Bifidobacterium longum DJO10A]
 gi|189428934|gb|ACD99082.1| von Willebrand factor (vWF) domain containing protein
           [Bifidobacterium longum DJO10A]
          Length = 794

 Score = 42.4 bits (98), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 55/186 (29%), Positives = 83/186 (44%), Gaps = 31/186 (16%)

Query: 168 TDARLDMMIVLDVSRSMESFFDSS---ITKID---MAI-KSINAMLEEVKLIPDVNNVVQ 220
           T+  LD+++VLDVS SM     S     TKID    A+ K INA   E   I D +   +
Sbjct: 97  TNQPLDIVLVLDVSGSMAEKIASGWNQPTKIDSLKTAVNKFINATAAENAKITDQSQRNR 156

Query: 221 SGLVTFSNKIE-----EFFLLEWG-------VSHLQRKIKYLSKF--GVSTNSTPGLKYA 266
             LV F+   +     +F+   W        VS+L   +  L+    G+S +      YA
Sbjct: 157 IALVKFAGTEKTSVGNDFYREGWSSYNYTQIVSNLTYDVSGLTSTVNGLSASGATSADYA 216

Query: 267 YNQIFDMQGMRQHCNTEDANYKKIIVFMTDGE-NLSTKEDQQ-SLYYCNEAKK---RGAI 321
           +N+       +       AN KK+++F TDGE N  +  D   +    N+AK     G  
Sbjct: 217 FNRAQAALTYQPR-----ANAKKVVIFFTDGEPNHGSGFDPTVAATAVNKAKSLKDAGTT 271

Query: 322 VYAIGI 327
           +Y+IG+
Sbjct: 272 IYSIGV 277


>gi|157818269|ref|NP_001100009.1| matrilin-4 [Rattus norvegicus]
 gi|149042956|gb|EDL96530.1| matrilin 4 (predicted), isoform CRA_b [Rattus norvegicus]
          Length = 624

 Score = 42.4 bits (98), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 42/220 (19%), Positives = 104/220 (47%), Gaps = 34/220 (15%)

Query: 153 HIVMPITSSVKVNSQT-----DARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLE 207
           H + P    ++ + ++     +  +D+++++D S+S+           ++  + +N +++
Sbjct: 363 HCLCPEGRRLQADGKSCDRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQIVD 416

Query: 208 EVKLIPDVNNVVQSGLVTFSNKIE-EFFLLEWGVSHLQRK----IKYLSKFGVSTNSTPG 262
            + + P+   V   GLV FS+++  EF L  +G +   ++    ++Y+ +    T +   
Sbjct: 417 FLDVSPEGTRV---GLVQFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMER---GTMTGLA 470

Query: 263 LKYAYNQIF-DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAI 321
           L++     F ++QG R      D N  ++ +  TDG +    +D  S++    AK+ G +
Sbjct: 471 LRHMVEHSFSEVQGAR----PRDLNVPRVGLVFTDGRS----QDDISVWA-ARAKEEGIV 521

Query: 322 VYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHI 361
           +YA+G+      E     + P+  ++  +P   ++  +H+
Sbjct: 522 MYAVGVGKAVEEELREIASEPSELHVSYSPD--FNTMTHL 559



 Score = 42.0 bits (97), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 86/186 (46%), Gaps = 27/186 (14%)

Query: 172 LDMMIVLDVSRSMESF-FDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
           LD++ ++D SRS+  F F++    +   + S++  L          N  + G++ +S+++
Sbjct: 35  LDLVFMIDSSRSVRPFEFETMRQFLVGLLHSLDVGL----------NATRVGVIQYSSQV 84

Query: 231 EEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIF-DMQGMRQHCNTEDANY 287
           +  F L        ++R I+ +      T +   ++YA N  F + +G R      +   
Sbjct: 85  QSVFPLGAFSNREDMERAIRAVVPLAQGTMTGLAIQYAMNVAFSEAEGAR----PSEERV 140

Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NS 344
            +++V +TDG     +   +      +A+ RG  +YA+G++       LRA ASP     
Sbjct: 141 PRVLVIVTDG-----RPQDRVAEVAAQARARGIEIYAVGVQRADVGS-LRAMASPPLDQH 194

Query: 345 FYLVEN 350
            +LVE+
Sbjct: 195 VFLVES 200


>gi|322689979|ref|YP_004209713.1| cell surface protein [Bifidobacterium longum subsp. infantis 157F]
 gi|320461315|dbj|BAJ71935.1| putative cell surface protein [Bifidobacterium longum subsp.
           infantis 157F]
          Length = 794

 Score = 42.4 bits (98), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 55/186 (29%), Positives = 83/186 (44%), Gaps = 31/186 (16%)

Query: 168 TDARLDMMIVLDVSRSMESFFDSS---ITKID---MAI-KSINAMLEEVKLIPDVNNVVQ 220
           T+  LD+++VLDVS SM     S     TKID    A+ K INA   E   I D +   +
Sbjct: 97  TNQPLDIVLVLDVSGSMAEKIASGWNQPTKIDSLKTAVNKFINATAAENAKITDQSQRNR 156

Query: 221 SGLVTFSNKIE-----EFFLLEWG-------VSHLQRKIKYLSKF--GVSTNSTPGLKYA 266
             LV F+   +     +F+   W        VS+L   +  L+    G+S +      YA
Sbjct: 157 IALVKFAGTEKTSVGNDFYREGWSSYNYTQIVSNLTYDVSGLTSTVNGLSASGATSADYA 216

Query: 267 YNQIFDMQGMRQHCNTEDANYKKIIVFMTDGE-NLSTKEDQQ-SLYYCNEAKK---RGAI 321
           +N+       +       AN KK+++F TDGE N  +  D   +    N+AK     G  
Sbjct: 217 FNRAQAALTYQPR-----ANAKKVVIFFTDGEPNHGSGFDPTVAATAVNKAKSLKDAGTT 271

Query: 322 VYAIGI 327
           +Y+IG+
Sbjct: 272 IYSIGV 277


>gi|320106407|ref|YP_004181997.1| VWFA-like domain-containing protein [Terriglobus saanensis SP1PR4]
 gi|319924928|gb|ADV82003.1| VWFA-related domain-containing protein [Terriglobus saanensis
           SP1PR4]
          Length = 305

 Score = 42.0 bits (97), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 50/212 (23%), Positives = 89/212 (41%), Gaps = 33/212 (15%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
           Q    L M++ +D S S+ + F    T+ D A + +  ML E           +  L++F
Sbjct: 72  QATTPLSMVMAIDTSESVITQFQ---TERDAAKRFVKQMLREQD---------EMDLISF 119

Query: 227 SNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
           S+ ++E          +   I  L K G +T+        Y+ I+ +   R      DA 
Sbjct: 120 SDTVDEIVPFTNDAGRMNAGIGNLHK-GDATS-------LYDAIY-LASQRLTEAKRDAT 170

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAI---------GIRVIRSHEFLR 337
            +KI+V +TDG N  T +  +       A++ GA +Y I         G      H  ++
Sbjct: 171 RRKILVIVTDGGN--TTKGMRYQQAVEAAERAGAAIYPIIMVPIEADAGRNTGGEHALIQ 228

Query: 338 -ACASPNSFYLVENPHSMYDAFSHIGKDIVTK 368
            A  +   ++ V + H +  AF+H+  D+ T+
Sbjct: 229 MAQDTGGKYFYVLDKHDLDKAFAHLSDDLRTQ 260


>gi|23466092|ref|NP_696695.1| hypothetical protein BL1539 [Bifidobacterium longum NCC2705]
 gi|322691915|ref|YP_004221485.1| cell surface protein [Bifidobacterium longum subsp. longum JCM
           1217]
 gi|23326823|gb|AAN25331.1| hypothetical protein with gram positive cell wall anchoring domain
           [Bifidobacterium longum NCC2705]
 gi|320456771|dbj|BAJ67393.1| putative cell surface protein [Bifidobacterium longum subsp. longum
           JCM 1217]
          Length = 794

 Score = 42.0 bits (97), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 55/186 (29%), Positives = 83/186 (44%), Gaps = 31/186 (16%)

Query: 168 TDARLDMMIVLDVSRSMESFFDSS---ITKID---MAI-KSINAMLEEVKLIPDVNNVVQ 220
           T+  LD+++VLDVS SM     S     TKID    A+ K INA   E   I D +   +
Sbjct: 97  TNQPLDIVLVLDVSGSMAEKIASGWNQPTKIDSLKTAVNKFINATAAENAKITDQSQRNR 156

Query: 221 SGLVTFSNKIE-----EFFLLEWG-------VSHLQRKIKYLSKF--GVSTNSTPGLKYA 266
             LV F+   +     +F+   W        VS+L   +  L+    G+S +      YA
Sbjct: 157 IALVKFAGTEKTSVGNDFYREGWSSYNYTQIVSNLTYDVSGLTSTVNGLSASGATSADYA 216

Query: 267 YNQIFDMQGMRQHCNTEDANYKKIIVFMTDGE-NLSTKEDQQ-SLYYCNEAKK---RGAI 321
           +N+       +       AN KK+++F TDGE N  +  D   +    N+AK     G  
Sbjct: 217 FNRAQAALTYQPR-----ANAKKVVIFFTDGEPNHGSGFDPTVAATAVNKAKSLKDAGTT 271

Query: 322 VYAIGI 327
           +Y+IG+
Sbjct: 272 IYSIGV 277


>gi|257062895|ref|YP_003142567.1| hypothetical protein Shel_01450 [Slackia heliotrinireducens DSM
           20476]
 gi|256790548|gb|ACV21218.1| uncharacterized protein [Slackia heliotrinireducens DSM 20476]
          Length = 744

 Score = 42.0 bits (97), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 54/135 (40%), Gaps = 17/135 (12%)

Query: 243 LQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLST 302
           L+  ++ LS  G  TN    L+ +Y +   ++G          + K+IIV M+DGE    
Sbjct: 440 LKAAVRDLSAGG-GTNIEDALRVSYER---LEGS--------GSDKRIIVLMSDGEANEG 487

Query: 303 KEDQQSLYYCNEAKKRGAIVYAIGI-----RVIRSHEFLRACASPNSFYLVENPHSMYDA 357
                 + Y NE K  G  +Y +G              +   ASP   Y V++   +   
Sbjct: 488 LVGDDLIAYANEIKDDGVTIYTLGFFQSVSDKAECQRVMEGIASPGCHYEVDDASQLRYF 547

Query: 358 FSHIGKDIVTKRIWY 372
           F  IG DI   R  Y
Sbjct: 548 FGDIGDDINGTRFIY 562


>gi|312133821|ref|YP_004001160.1| von willebrand factor (vwf) domain containing protein
           [Bifidobacterium longum subsp. longum BBMN68]
 gi|311773110|gb|ADQ02598.1| Von Willebrand factor (VWF) domain containing protein
           [Bifidobacterium longum subsp. longum BBMN68]
          Length = 794

 Score = 42.0 bits (97), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 55/186 (29%), Positives = 83/186 (44%), Gaps = 31/186 (16%)

Query: 168 TDARLDMMIVLDVSRSMESFFDSS---ITKID---MAI-KSINAMLEEVKLIPDVNNVVQ 220
           T+  LD+++VLDVS SM     S     TKID    A+ K INA   E   I D +   +
Sbjct: 97  TNQPLDIVLVLDVSGSMAEKIASGWNQPTKIDSLKTAVNKFINATAAENAKITDQSQRNR 156

Query: 221 SGLVTFSNKIE-----EFFLLEWG-------VSHLQRKIKYLSKF--GVSTNSTPGLKYA 266
             LV F+   +     +F+   W        VS+L   +  L+    G+S +      YA
Sbjct: 157 IALVKFAGTEKTSVGNDFYREGWSSYNYTQIVSNLTYDVSGLTSTVNGLSASGATSADYA 216

Query: 267 YNQIFDMQGMRQHCNTEDANYKKIIVFMTDGE-NLSTKEDQQ-SLYYCNEAKK---RGAI 321
           +N+       +       AN KK+++F TDGE N  +  D   +    N+AK     G  
Sbjct: 217 FNRAQAALTYQPR-----ANAKKVVIFFTDGEPNHGSGFDPTVAATAVNKAKSLKDAGTT 271

Query: 322 VYAIGI 327
           +Y+IG+
Sbjct: 272 IYSIGV 277


>gi|163759224|ref|ZP_02166310.1| hypothetical protein HPDFL43_05650 [Hoeflea phototrophica DFL-43]
 gi|162283628|gb|EDQ33913.1| hypothetical protein HPDFL43_05650 [Hoeflea phototrophica DFL-43]
          Length = 541

 Score = 42.0 bits (97), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 38/182 (20%), Positives = 71/182 (39%), Gaps = 38/182 (20%)

Query: 226 FSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDA 285
           F  ++E    L    S ++  +K L   G STN   G+ + +  + D +   Q     DA
Sbjct: 359 FGCEMEPLVPLTTDFSKIRTTVKALEANG-STNMLEGVMWGWRVLSDREPFAQGAPKSDA 417

Query: 286 NYKKIIVFMTDGEN----------------------------------LSTKEDQQSLYY 311
           + +KI++F+TDG+N                                   +   D+++   
Sbjct: 418 SVEKIMIFLTDGQNSFGNLNNDLGSAYTSMGYLVDGRLDGMTAANIGQTNNALDKKTKAA 477

Query: 312 CNEAKKRGAIVYAIGIRV--IRSHEFLRACASPNSFYL-VENPHSMYDAFSHIGKDIVTK 368
           C  AK+ G  +Y I +    + + + L  CA+ ++ Y    +   +   F  I K +V  
Sbjct: 478 CENAKEDGVTIYTIRLEEADVGTGKMLEECATSSAHYFDAPSRQQLTPIFDAIKKGVVKL 537

Query: 369 RI 370
           R+
Sbjct: 538 RL 539


>gi|229825750|ref|ZP_04451819.1| hypothetical protein GCWU000182_01113 [Abiotrophia defectiva ATCC
           49176]
 gi|229790313|gb|EEP26427.1| hypothetical protein GCWU000182_01113 [Abiotrophia defectiva ATCC
           49176]
          Length = 1659

 Score = 42.0 bits (97), Expect = 0.15,   Method: Composition-based stats.
 Identities = 42/132 (31%), Positives = 65/132 (49%), Gaps = 20/132 (15%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
           Q +  LD+++V+D S SME         ++ A K+ N  ++  KL+P  NN V  G+V+F
Sbjct: 82  QNNKILDIVLVMDTSGSMEG------KSLENAKKAANNFVD--KLLPQ-NNNVNIGIVSF 132

Query: 227 SNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
           + K E    L   V+ L+  IK L   G  T +  GL+ A   +          N   A 
Sbjct: 133 AEKGEIKSGLTRNVTTLKNAIKGLKADG-GTYTQQGLEKAATVL----------NGAPAE 181

Query: 287 YKKIIVFMTDGE 298
           +KK++V + DGE
Sbjct: 182 HKKVMVVIGDGE 193


>gi|85374104|ref|YP_458166.1| hypothetical protein ELI_06385 [Erythrobacter litoralis HTCC2594]
 gi|84787187|gb|ABC63369.1| hypothetical protein ELI_06385 [Erythrobacter litoralis HTCC2594]
          Length = 623

 Score = 42.0 bits (97), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 56/138 (40%), Gaps = 10/138 (7%)

Query: 238 WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIV----- 292
           WG     R +     F    +S PG   + + IF   G  +  +    +Y    +     
Sbjct: 489 WG----GRLLSQYGLFAAENSSKPGRTTSRHLIFLTDGQTEPYDLAYGSYGIDPIDERRW 544

Query: 293 FMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPH 352
             T    L+   +++ L+ CNE KK GA V+ +      +++ ++ CA    ++   N  
Sbjct: 545 TQTSSLTLAQTVEERFLFACNEVKKLGATVWVVAFGTA-ANDKMKTCAGSGRYFEAANAS 603

Query: 353 SMYDAFSHIGKDIVTKRI 370
            + DAFS I K     RI
Sbjct: 604 QLNDAFSTIAKSTGDLRI 621


>gi|56696619|ref|YP_166980.1| hypothetical protein SPO1742 [Ruegeria pomeroyi DSS-3]
 gi|56678356|gb|AAV95022.1| conserved hypothetical protein [Ruegeria pomeroyi DSS-3]
          Length = 558

 Score = 42.0 bits (97), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 37/71 (52%), Gaps = 1/71 (1%)

Query: 301 STKEDQQSLYYCNEAKKRGAIVYAIGIRVIRS-HEFLRACASPNSFYLVENPHSMYDAFS 359
           ++ +DQ++ + C+ AK  G IVY +G     S    L+ CAS +S Y   +   + DAF+
Sbjct: 486 ASAKDQRTDHVCDAAKDEGIIVYTVGFEAPYSGRRVLKRCASSDSHYYDADGLEISDAFT 545

Query: 360 HIGKDIVTKRI 370
            I   I   R+
Sbjct: 546 SIASSIRKLRL 556


>gi|259416688|ref|ZP_05740608.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
 gi|259348127|gb|EEW59904.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
          Length = 583

 Score = 42.0 bits (97), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 44/85 (51%), Gaps = 6/85 (7%)

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV-IRSHEFLRACASPNSF 345
           Y ++  ++ D    STK D ++L  C+ AK++G +V+ IG     R  + L+ CAS  S 
Sbjct: 502 YNRLYSYVGD----STK-DSRTLAVCDAAKEKGIVVFTIGFEAPWRGQQVLQQCASSASH 556

Query: 346 YLVENPHSMYDAFSHIGKDIVTKRI 370
           Y   +   + DAF+ I   I   R+
Sbjct: 557 YYDVDGLEISDAFASIASAIRQLRL 581


>gi|302870768|ref|YP_003839404.1| von Willebrand factor type A [Caldicellulosiruptor obsidiansis
           OB47]
 gi|302573627|gb|ADL41418.1| von Willebrand factor type A [Caldicellulosiruptor obsidiansis
           OB47]
          Length = 900

 Score = 42.0 bits (97), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 58/221 (26%), Positives = 97/221 (43%), Gaps = 38/221 (17%)

Query: 148 YTNS-RHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAML 206
           Y+NS    ++P+   +K N + +  +D+++VLD S SM    D+ I+K+++A  +   M+
Sbjct: 382 YSNSVLEKMLPVKMEIK-NKEKEKNIDVVLVLDHSGSMADTEDAGISKLEIAKSASAKMI 440

Query: 207 EEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRK---IKYLS--KFGVSTNSTP 261
           E ++    V      G++ F +     +   +  S L RK   I+ +S  + G  T   P
Sbjct: 441 EHLESSDGV------GVIAFDHN----YYWAYEFSKLVRKKDVIESISSIEVGGGTAIIP 490

Query: 262 GLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYY--CNEAKKRG 319
            L  A   +   +   +            IV +TDG        +Q  Y    NEAK+  
Sbjct: 491 PLSEAVKTLKKSKAKSKL-----------IVLLTDGMG------EQGGYEIPANEAKRNN 533

Query: 320 AIVYAIGIRVIRSHEFLRACASPNS--FYLVENPHSMYDAF 358
             +  IG+    +   L   AS  S  FYLV NP+ + D F
Sbjct: 534 IKITTIGVGKFVNLPVLSWIASFTSGRFYLVSNPYELVDVF 574


>gi|291087243|ref|ZP_06571866.1| putative von Willebrand factor type A domain protein [Clostridium sp.
            M62/1]
 gi|291076088|gb|EFE13452.1| putative von Willebrand factor type A domain protein [Clostridium sp.
            M62/1]
          Length = 2012

 Score = 42.0 bits (97), Expect = 0.17,   Method: Composition-based stats.
 Identities = 57/213 (26%), Positives = 91/213 (42%), Gaps = 27/213 (12%)

Query: 172  LDMMIVLDVSRSMESFFDSSITKI-DMAIKS----INAMLEEVKLIPDVNNV---VQSGL 223
            +D++ V+D S SM+   D +  K  D   +S    +N  LEE+  IPD+ +    +Q   
Sbjct: 1475 VDLVFVIDKSLSMDYDIDGNEIKWWDDETESRKDIVNDALEEI--IPDLCSQQYDIQIAG 1532

Query: 224  VTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVS-TNSTPGLKYAYNQIFDMQGMRQHCNT 282
              FS       +L+W     Q     LS   ++ T+S+     A     DM       + 
Sbjct: 1533 YQFSGSSTR--VLDWSREEQQ----VLSGLKIARTSSSTEPSQALADALDMLKTGSPAHR 1586

Query: 283  EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRS---HEFLRAC 339
              +N KK ++FMTDGE   T+ +  S          GA +Y IG+    S    E +R+ 
Sbjct: 1587 NQSNVKKYLIFMTDGE--PTEPEDWSYNAVRNHAVPGASIYTIGVSSDASTNLMEGIRST 1644

Query: 340  ASPNSFYLV-----ENPHSMYDAFSHIGKDIVT 367
            A  N  Y        +   + DAF+ I  +I++
Sbjct: 1645 ALSNGMYAPATFKGTSAQLIRDAFTQIKDEIIS 1677


>gi|312877126|ref|ZP_07737097.1| von Willebrand factor type A [Caldicellulosiruptor lactoaceticus
           6A]
 gi|311796100|gb|EFR12458.1| von Willebrand factor type A [Caldicellulosiruptor lactoaceticus
           6A]
          Length = 900

 Score = 42.0 bits (97), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 56/221 (25%), Positives = 95/221 (42%), Gaps = 38/221 (17%)

Query: 148 YTNS-RHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAML 206
           Y+NS    ++P+   +K N + +  +D+++VLD S SM    D+ I K+++A  +   M+
Sbjct: 382 YSNSVLEKMLPVKMELK-NKEKEKNIDVVLVLDHSGSMADTEDAGIPKLEIAKSASAKMV 440

Query: 207 EEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRK---IKYLS--KFGVSTNSTP 261
           E ++    V      G++ F +     +   +    L RK   I+ +S  + G  T   P
Sbjct: 441 EHLESSDGV------GVIAFDHN----YYWAYKFGKLVRKEDVIESISSIEVGGGTAIIP 490

Query: 262 GLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYY--CNEAKKRG 319
            L  A   +   +              K++V +TDG        +QS Y    +EAK+  
Sbjct: 491 PLSEAVKTLKKSKAKN-----------KLVVLLTDGMG------EQSGYEIPADEAKRNN 533

Query: 320 AIVYAIGIRVIRSHEFLRACASPNS--FYLVENPHSMYDAF 358
             +  IG+    +   L   A   S  FYLV NP  + D F
Sbjct: 534 IKITTIGVGKFVNASVLSWIADYTSGRFYLVSNPSELVDVF 574


>gi|223462569|gb|AAI50696.1| RIKEN cDNA E330026B02 gene [Mus musculus]
          Length = 1182

 Score = 42.0 bits (97), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 89/202 (44%), Gaps = 31/202 (15%)

Query: 169 DARLDMMIVLDVSRSM--ESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
           D + D+M ++D S S+  E+F     +K+ M +K+   ++ + ++  D    VQ G+V F
Sbjct: 617 DMKADIMFLVDSSGSIGPENF-----SKMKMFMKN---LVSKSQIGADR---VQIGVVQF 665

Query: 227 SNKIEEFFLLEWGVSH--LQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
           S++ +E F L   +S   +   I  ++  G +T +   L +        +G R       
Sbjct: 666 SHENKEEFQLNTFMSQSDIANAIDRMTHIGETTLTGSALTFVSQYFSPDKGAR------- 718

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNS 344
            N +K ++ +TDGE      D          +K G I+Y++G+      +       P  
Sbjct: 719 PNVRKFLILITDGEAQDIVRDPALAL-----RKEGVIIYSVGVFGSNVTQLEEISGKPEM 773

Query: 345 FYLVENPHSMYDAFSHIGKDIV 366
            + VEN    +D   HI  D+V
Sbjct: 774 VFYVEN----FDILQHIEDDLV 791



 Score = 40.0 bits (92), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 90/201 (44%), Gaps = 29/201 (14%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ V+D S S++ + + +I K        + M+  VK      N V+ G + +++  E
Sbjct: 807 LDVVFVIDSSGSID-YQEYNIMK--------DFMIGLVKKADVGKNQVRFGALKYADDPE 857

Query: 232 EFFLLEWGVSHLQRKIKYLS------KFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDA 285
             F L+     L  K++ +S        G +T +   L ++ +   + +G R H      
Sbjct: 858 VLFYLD----ELGTKLEVISVLQNDHPMGGNTYTAEALAFSNHMFTEARGSRLH-----K 908

Query: 286 NYKKIIVFMTDGENLSTKEDQQSLYYCNEA-KKRGAIVYAIGIRVIRSHEFLRACASPNS 344
              ++++ +TDGE+     D + L    +A + +G +V A+GI    S E L    S + 
Sbjct: 909 GVPQVLIVITDGES----HDAEKLNATAKALRDKGILVLAVGIAGANSWELLAMAGSGDK 964

Query: 345 FYLVENPHSMYDAFSHIGKDI 365
           +Y VE    +   FS +   +
Sbjct: 965 YYFVETFGGLKGIFSDVSASV 985


>gi|329850249|ref|ZP_08265094.1| von Willebrand factor type A domain protein [Asticcacaulis
           biprosthecum C19]
 gi|328840564|gb|EGF90135.1| von Willebrand factor type A domain protein [Asticcacaulis
           biprosthecum C19]
          Length = 412

 Score = 41.6 bits (96), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 62/141 (43%), Gaps = 14/141 (9%)

Query: 240 VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGEN 299
           +S  +  IK L   G  TN T G+++    +   Q             +K ++ +TDG+N
Sbjct: 274 ISSARNFIKTLQPGGY-TNVTMGVQWGMEVLSPNQPFSDATEFGSTKARKFMIVVTDGDN 332

Query: 300 LSTKE---------DQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACAS-PNSFYLVE 349
             TK          D+++   C  AK +G  VY + I +  +   LR CAS P  FY + 
Sbjct: 333 --TKSFTSWSASVIDKRTALACENAKAKGITVYTVKI-IQGNSNMLRKCASAPEYFYDLT 389

Query: 350 NPHSMYDAFSHIGKDIVTKRI 370
           + + +  A S I K I   R+
Sbjct: 390 SANQLNAAMSGIFKSINKTRL 410


>gi|156616288|ref|NP_766515.2| collagen alpha-6(VI) chain isoform 2 [Mus musculus]
          Length = 1182

 Score = 41.6 bits (96), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 89/202 (44%), Gaps = 31/202 (15%)

Query: 169 DARLDMMIVLDVSRSM--ESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
           D + D+M ++D S S+  E+F     +K+ M +K+   ++ + ++  D    VQ G+V F
Sbjct: 617 DMKADIMFLVDSSGSIGPENF-----SKMKMFMKN---LVSKSQIGADR---VQIGVVQF 665

Query: 227 SNKIEEFFLLEWGVSH--LQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
           S++ +E F L   +S   +   I  ++  G +T +   L +        +G R       
Sbjct: 666 SHENKEEFQLNTFMSQSDIANAIDRMTHIGETTLTGSALTFVSQYFSPDKGAR------- 718

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNS 344
            N +K ++ +TDGE      D          +K G I+Y++G+      +       P  
Sbjct: 719 PNVRKFLILITDGEAQDIVRDPAIAL-----RKEGVIIYSVGVFGSNVTQLEEISGKPEM 773

Query: 345 FYLVENPHSMYDAFSHIGKDIV 366
            + VEN    +D   HI  D+V
Sbjct: 774 VFYVEN----FDILQHIEDDLV 791



 Score = 40.0 bits (92), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 90/201 (44%), Gaps = 29/201 (14%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ V+D S S++ + + +I K        + M+  VK      N V+ G + +++  E
Sbjct: 807 LDVVFVIDSSGSID-YQEYNIMK--------DFMIGLVKKADVGKNQVRFGALKYADDPE 857

Query: 232 EFFLLEWGVSHLQRKIKYLS------KFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDA 285
             F L+     L  K++ +S        G +T +   L ++ +   + +G R H      
Sbjct: 858 VLFYLD----ELGTKLEVVSVLQNDHPMGGNTYTAEALAFSDHMFTEARGSRLH-----K 908

Query: 286 NYKKIIVFMTDGENLSTKEDQQSLYYCNEA-KKRGAIVYAIGIRVIRSHEFLRACASPNS 344
              ++++ +TDGE+     D + L    +A + +G +V A+GI    S E L    S + 
Sbjct: 909 GVPQVLIVITDGES----HDAEKLNTTAKALRDKGILVLAVGIAGANSWELLAMAGSSDK 964

Query: 345 FYLVENPHSMYDAFSHIGKDI 365
           +Y VE    +   FS +   +
Sbjct: 965 YYFVETFGGLKGIFSDVSASV 985


>gi|26344185|dbj|BAC35749.1| unnamed protein product [Mus musculus]
          Length = 1182

 Score = 41.6 bits (96), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 89/202 (44%), Gaps = 31/202 (15%)

Query: 169 DARLDMMIVLDVSRSM--ESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
           D + D+M ++D S S+  E+F     +K+ M +K+   ++ + ++  D    VQ G+V F
Sbjct: 617 DMKADIMFLVDSSGSIGPENF-----SKMKMFMKN---LVSKSQIGADR---VQIGVVQF 665

Query: 227 SNKIEEFFLLEWGVSH--LQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
           S++ +E F L   +S   +   I  ++  G +T +   L +        +G R       
Sbjct: 666 SHENKEEFQLNTFMSQSDIANAIDRMTHIGETTLTGSALTFVSQYFSPDKGAR------- 718

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNS 344
            N +K ++ +TDGE      D          +K G I+Y++G+      +       P  
Sbjct: 719 PNVRKFLILITDGEAQDIVRDPAIAL-----RKEGVIIYSVGVFGSNVTQLEEISGKPEM 773

Query: 345 FYLVENPHSMYDAFSHIGKDIV 366
            + VEN    +D   HI  D+V
Sbjct: 774 VFYVEN----FDILQHIEDDLV 791



 Score = 39.7 bits (91), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 90/201 (44%), Gaps = 29/201 (14%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ V+D S S++ + + +I K        + M+  VK      N V+ G + +++  E
Sbjct: 807 LDVVFVIDSSGSID-YQEYNIMK--------DFMIGLVKKADVGKNQVRFGALKYADDPE 857

Query: 232 EFFLLEWGVSHLQRKIKYLS------KFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDA 285
             F L+     L  K++ +S        G +T +   L ++ +   + +G R H      
Sbjct: 858 VLFYLD----ELGTKLEVVSVLQNDHPMGGNTYTAEALAFSDHMFTEARGSRLH-----K 908

Query: 286 NYKKIIVFMTDGENLSTKEDQQSLYYCNEA-KKRGAIVYAIGIRVIRSHEFLRACASPNS 344
              ++++ +TDGE+     D + L    +A + +G +V A+GI    S E L    S + 
Sbjct: 909 GVPQVLIVITDGES----NDAEKLNTTAKALRDKGILVLAVGIAGANSWELLAMAGSSDK 964

Query: 345 FYLVENPHSMYDAFSHIGKDI 365
           +Y VE    +   FS +   +
Sbjct: 965 YYFVETFGGLKGIFSDVSASV 985


>gi|149773091|emb|CAO01895.1| collagen type VI alpha 6 [Mus musculus]
          Length = 1162

 Score = 41.6 bits (96), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 88/202 (43%), Gaps = 31/202 (15%)

Query: 169 DARLDMMIVLDVSRSM--ESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
           D + D+M ++D S S+  E+F     +K+ M +K+   ++ + ++  D    VQ G+V F
Sbjct: 597 DMKADIMFLVDSSGSIGPENF-----SKMKMFMKN---LVSKSQIGADR---VQIGVVQF 645

Query: 227 SNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
           S++ +E F L      S +   I  ++  G +T +   L +        +G R       
Sbjct: 646 SHENKEEFQLNTFMSQSDIANAIDRMTHIGETTLTGSALTFVSQYFSPDKGAR------- 698

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNS 344
            N +K ++ +TDGE      D          +K G I+Y++G+      +       P  
Sbjct: 699 PNVRKFLILITDGEAQDIVRDPAIAL-----RKEGVIIYSVGVFGSNVTQLEEISGKPEM 753

Query: 345 FYLVENPHSMYDAFSHIGKDIV 366
            + VEN    +D   HI  D+V
Sbjct: 754 VFYVEN----FDILQHIEDDLV 771



 Score = 40.0 bits (92), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 90/201 (44%), Gaps = 29/201 (14%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ V+D S S++ + + +I K        + M+  VK      N V+ G + +++  E
Sbjct: 787 LDVVFVIDSSGSID-YQEYNIMK--------DFMIGLVKKADVGKNQVRFGALKYADDPE 837

Query: 232 EFFLLEWGVSHLQRKIKYLS------KFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDA 285
             F L+     L  K++ +S        G +T +   L ++ +   + +G R H      
Sbjct: 838 VLFYLD----ELGTKLEVVSVLQNDHPMGGNTYTAEALAFSDHMFTEARGSRLH-----K 888

Query: 286 NYKKIIVFMTDGENLSTKEDQQSLYYCNEA-KKRGAIVYAIGIRVIRSHEFLRACASPNS 344
              ++++ +TDGE+     D + L    +A + +G +V A+GI    S E L    S + 
Sbjct: 889 GVPQVLIVITDGES----HDAEKLNTTAKALRDKGILVLAVGIAGANSWELLAMAGSSDK 944

Query: 345 FYLVENPHSMYDAFSHIGKDI 365
           +Y VE    +   FS +   +
Sbjct: 945 YYFVETFGGLKGIFSDVSASV 965


>gi|288956977|ref|YP_003447318.1| hypothetical protein AZL_001360 [Azospirillum sp. B510]
 gi|288909285|dbj|BAI70774.1| hypothetical protein AZL_001360 [Azospirillum sp. B510]
          Length = 456

 Score = 41.6 bits (96), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 44/104 (42%), Gaps = 21/104 (20%)

Query: 288 KKIIVFMTDGENL-------------------STKEDQQSLYYCNEAKK-RGAIVYAIGI 327
           KK++V MTDG N                    ++K D   +  CN AKK    ++Y I  
Sbjct: 351 KKVLVLMTDGVNHIAGRNYTAYYSDPYQTVADASKADADLMTICNAAKKDHNVVLYTITY 410

Query: 328 RVIRSHEFLRACAS-PNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
                 + +  CAS P+  Y    P  +  AF+ +G D+ T ++
Sbjct: 411 GSDTDEQQMSDCASDPSKHYHAALPQDLAKAFTQVGTDLTTMKL 454


>gi|14548116|sp|O89029|MATN4_MOUSE RecName: Full=Matrilin-4; Short=MAT-4; Flags: Precursor
 gi|3766288|emb|CAA06889.1| matrilin-4 precursor [Mus musculus]
 gi|22477196|gb|AAH36558.1| Matrilin 4 [Mus musculus]
 gi|148674433|gb|EDL06380.1| matrilin 4, isoform CRA_a [Mus musculus]
 gi|148674434|gb|EDL06381.1| matrilin 4, isoform CRA_a [Mus musculus]
          Length = 624

 Score = 41.6 bits (96), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 41/210 (19%), Positives = 98/210 (46%), Gaps = 32/210 (15%)

Query: 153 HIVMPITSSVKVNSQT-----DARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLE 207
           H + P    ++ + ++     +  +D+++++D S+S+           ++  + +N +++
Sbjct: 363 HCLCPEGRRLQADGKSCDRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQIVD 416

Query: 208 EVKLIPDVNNVVQSGLVTFSNKIE-EFFLLEWGVSHLQRK----IKYLSKFGVSTNSTPG 262
            + + P+   V   GLV FS+++  EF L  +G +   ++    ++Y+ +    T +   
Sbjct: 417 FLDVSPEGTRV---GLVQFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMER---GTMTGLA 470

Query: 263 LKYAYNQIF-DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAI 321
           L++     F + QG R      D N  ++ +  TDG +    +D  S++    AK+ G +
Sbjct: 471 LRHMVEHSFSEAQGAR----PRDLNVPRVGLVFTDGRS----QDDISVWA-ARAKEEGIV 521

Query: 322 VYAIGIRVIRSHEFLRACASPNSFYLVENP 351
           +YA+G+      E     + P+  ++  +P
Sbjct: 522 MYAVGVGKAVEEELREIASEPSELHVSYSP 551



 Score = 41.2 bits (95), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 87/188 (46%), Gaps = 31/188 (16%)

Query: 172 LDMMIVLDVSRSMESF-FDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
           LD++ ++D SRS+  F F++    +   ++S++  L          N  + G++ +S+++
Sbjct: 35  LDLVFMIDSSRSVRPFEFETMRQFLVGLLRSLDVGL----------NATRVGVIQYSSQV 84

Query: 231 EEFFLLEWGV----SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIF-DMQGMRQHCNTEDA 285
           +  F L  G       ++R I+ +      T +   ++YA N  F + +G R      + 
Sbjct: 85  QSVFPL--GAFSRREDMERAIRAVVPLAQGTMTGLAIQYAMNVAFSEAEGAR----PSEE 138

Query: 286 NYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP--- 342
              +++V +TDG     +   +      +A+ RG  +YA+G++       LR  ASP   
Sbjct: 139 RVPRVLVIVTDG-----RPQDRVAEVAAQARARGIEIYAVGVQRADVGS-LRTMASPPLD 192

Query: 343 NSFYLVEN 350
              +LVE+
Sbjct: 193 QHVFLVES 200


>gi|224967060|ref|NP_038620.2| matrilin-4 precursor [Mus musculus]
          Length = 624

 Score = 41.6 bits (96), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 41/210 (19%), Positives = 98/210 (46%), Gaps = 32/210 (15%)

Query: 153 HIVMPITSSVKVNSQT-----DARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLE 207
           H + P    ++ + ++     +  +D+++++D S+S+           ++  + +N +++
Sbjct: 363 HCLCPEGRRLQADGKSCDRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQIVD 416

Query: 208 EVKLIPDVNNVVQSGLVTFSNKIE-EFFLLEWGVSHLQRK----IKYLSKFGVSTNSTPG 262
            + + P+   V   GLV FS+++  EF L  +G +   ++    ++Y+ +    T +   
Sbjct: 417 FLDVSPEGTRV---GLVQFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMER---GTMTGLA 470

Query: 263 LKYAYNQIF-DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAI 321
           L++     F + QG R      D N  ++ +  TDG +    +D  S++    AK+ G +
Sbjct: 471 LRHMVEHSFSEAQGAR----PRDLNVPRVGLVFTDGRS----QDDISVWA-ARAKEEGIV 521

Query: 322 VYAIGIRVIRSHEFLRACASPNSFYLVENP 351
           +YA+G+      E     + P+  ++  +P
Sbjct: 522 MYAVGVGKAVEEELREIASEPSELHVSYSP 551



 Score = 41.2 bits (95), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 87/188 (46%), Gaps = 31/188 (16%)

Query: 172 LDMMIVLDVSRSMESF-FDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
           LD++ ++D SRS+  F F++    +   ++S++  L          N  + G++ +S+++
Sbjct: 35  LDLVFMIDSSRSVRPFEFETMRQFLVGLLRSLDVGL----------NATRVGVIQYSSQV 84

Query: 231 EEFFLLEWGV----SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIF-DMQGMRQHCNTEDA 285
           +  F L  G       ++R I+ +      T +   ++YA N  F + +G R      + 
Sbjct: 85  QSVFPL--GAFSRREDMERAIRAVVPLAQGTMTGLAIQYAMNVAFSEAEGAR----PSEE 138

Query: 286 NYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP--- 342
              +++V +TDG     +   +      +A+ RG  +YA+G++       LR  ASP   
Sbjct: 139 RVPRVLVIVTDG-----RPQDRVAEVAAQARARGIEIYAVGVQRADVGS-LRTMASPPLD 192

Query: 343 NSFYLVEN 350
              +LVE+
Sbjct: 193 QHVFLVES 200


>gi|3766289|emb|CAA06890.1| matrilin-4 precursor, alternate splice product [Mus musculus]
          Length = 434

 Score = 41.6 bits (96), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 41/210 (19%), Positives = 98/210 (46%), Gaps = 32/210 (15%)

Query: 153 HIVMPITSSVKVNSQT-----DARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLE 207
           H + P    ++ + ++     +  +D+++++D S+S+           ++  + +N +++
Sbjct: 173 HCLCPEGRRLQADGKSCDRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQIVD 226

Query: 208 EVKLIPDVNNVVQSGLVTFSNKIE-EFFLLEWGVSHLQRK----IKYLSKFGVSTNSTPG 262
            + + P+   V   GLV FS+++  EF L  +G +   ++    ++Y+ +    T +   
Sbjct: 227 FLDVSPEGTRV---GLVQFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMER---GTMTGLA 280

Query: 263 LKYAYNQIF-DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAI 321
           L++     F + QG R      D N  ++ +  TDG +    +D  S++    AK+ G +
Sbjct: 281 LRHMVEHSFSEAQGAR----PRDLNVPRVGLVFTDGRS----QDDISVWA-ARAKEEGIV 331

Query: 322 VYAIGIRVIRSHEFLRACASPNSFYLVENP 351
           +YA+G+      E     + P+  ++  +P
Sbjct: 332 MYAVGVGKAVEEELREIASEPSELHVSYSP 361


>gi|148689164|gb|EDL21111.1| RIKEN cDNA E330026B02 [Mus musculus]
          Length = 1482

 Score = 41.2 bits (95), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 47/200 (23%), Positives = 86/200 (43%), Gaps = 27/200 (13%)

Query: 169 DARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
           D + D+M ++D S S+      + +K+ M +K+   ++ + ++  D    VQ G+V FS+
Sbjct: 617 DMKADIMFLVDSSGSIGP---ENFSKMKMFMKN---LVSKSQIGADR---VQIGVVQFSH 667

Query: 229 KIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
           + +E F L      S +   I  ++  G +T +   L +        +G R        N
Sbjct: 668 ENKEEFQLNTFMSQSDIANAIDRMTHIGETTLTGSALTFVSQYFSPDKGAR-------PN 720

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFY 346
            +K ++ +TDGE      D          +K G I+Y++G+      +       P   +
Sbjct: 721 VRKFLILITDGEAQDIVRDPALAL-----RKEGVIIYSVGVFGSNVTQLEEISGKPEMVF 775

Query: 347 LVENPHSMYDAFSHIGKDIV 366
            VEN    +D   HI  D+V
Sbjct: 776 YVEN----FDILQHIEDDLV 791



 Score = 40.8 bits (94), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 90/201 (44%), Gaps = 29/201 (14%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ V+D S S++ + + +I K        + M+  VK      N V+ G + +++  E
Sbjct: 807 LDVVFVIDSSGSID-YQEYNIMK--------DFMIGLVKKADVGKNQVRFGALKYADDPE 857

Query: 232 EFFLLEWGVSHLQRKIKYLS------KFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDA 285
             F L+     L  K++ +S        G +T +   L ++ +   + +G R H      
Sbjct: 858 VLFYLD----ELGTKLEVISVLQNDHPMGGNTYTAEALAFSNHMFTEARGSRLH-----K 908

Query: 286 NYKKIIVFMTDGENLSTKEDQQSLYYCNEA-KKRGAIVYAIGIRVIRSHEFLRACASPNS 344
              ++++ +TDGE+     D + L    +A + +G +V A+GI    S E L    S + 
Sbjct: 909 GVPQVLIVITDGES----HDAEKLNATAKALRDKGILVLAVGIAGANSWELLAMAGSGDK 964

Query: 345 FYLVENPHSMYDAFSHIGKDI 365
           +Y VE    +   FS +   +
Sbjct: 965 YYFVETFGGLKGIFSDVSASV 985


>gi|126303381|ref|XP_001379571.1| PREDICTED: similar to matrilin-4 [Monodelphis domestica]
          Length = 623

 Score = 41.2 bits (95), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 84/185 (45%), Gaps = 25/185 (13%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ V+D SRS+  F   ++ +  + I      +  + + P+   V   G++ +S++++
Sbjct: 35  LDLVFVIDSSRSVRPFEFETMRRFLVNI------IRGLDIGPNATRV---GVIQYSSQVQ 85

Query: 232 EFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM-QGMRQHCNTEDANYK 288
             F L        ++R I  +      T +   ++YA N  F + +G R       A   
Sbjct: 86  SVFPLGAFSRREDMERAIHAIVPLAQGTMTGLAIQYAMNVAFSVAEGAR----PSQARVP 141

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NSF 345
           ++ V +TDG     +   +      +A+ RG  +YA+G++       LRA ASP      
Sbjct: 142 RVAVIVTDG-----RPQDRVTEVAAQARNRGIEIYAVGVQRADVGS-LRAMASPPLDEHV 195

Query: 346 YLVEN 350
           +LVE+
Sbjct: 196 FLVES 200



 Score = 37.0 bits (84), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 40/186 (21%), Positives = 87/186 (46%), Gaps = 27/186 (14%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           +D+++V+D S+S+           ++  + +N +++ + + P+   V   GLV +S+++ 
Sbjct: 387 VDLVLVIDGSKSVRP------QNFELVKRFVNQIVDFLDVSPEGTRV---GLVQYSSRVR 437

Query: 232 -EFFLLEWGVSHLQRK----IKYLSKFGVSTNSTPGLKYAYNQIF-DMQGMRQHCNTEDA 285
            EF L  +G +   ++    ++Y+ K    T +   L++     F + QG R        
Sbjct: 438 TEFPLGRYGTADEVKQAVLAVEYMEK---GTMTGLALRHLVEHSFSEAQGARPRAQ---- 490

Query: 286 NYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSF 345
           N  ++ +  TDG +    +D  S++    AK+ G I+YA+G+      E     + P   
Sbjct: 491 NVPRVGLVFTDGRS----QDDISVWA-ARAKEEGIIMYAVGVGKAVEEELREIASDPPEQ 545

Query: 346 YLVENP 351
           ++  +P
Sbjct: 546 HVSYSP 551


>gi|134093121|gb|ABO52981.1| matrilin 4 isoform 1 precursor [Callithrix jacchus]
          Length = 580

 Score = 41.2 bits (95), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 84/185 (45%), Gaps = 25/185 (13%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ V+D SRS+  F      + +   + +  ++  + + P+   V   G++ +S++++
Sbjct: 32  LDLVFVIDSSRSVRPF------EFETMRQFLVGLVRGLNVGPNATRV---GVIQYSSQVQ 82

Query: 232 EFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM-QGMRQHCNTEDANYK 288
             F L        + R I+ L      T +   ++YA N  F + +G R      +    
Sbjct: 83  SVFPLRAFSRREDMVRAIRDLVPLAQGTMTGLAIQYAMNVAFSVAEGAR----PPEERVP 138

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NSF 345
           ++ V +TDG     +   +      +A+ RG  +YA+G++       LRA ASP      
Sbjct: 139 RVAVIVTDG-----RPQDRVAEVAAQARARGIEIYAVGVQRADVGS-LRAMASPPLEEHV 192

Query: 346 YLVEN 350
           +LVE+
Sbjct: 193 FLVES 197


>gi|47219516|emb|CAG09870.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 1259

 Score = 41.2 bits (95), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 73/155 (47%), Gaps = 25/155 (16%)

Query: 219 VQSGLVTFSNKIEEFFLL--EWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIF-DMQG 275
           VQ  LV +S      F L     ++ + R ++     G STN+   +KY  ++IF   +G
Sbjct: 432 VQISLVQYSRDPHTEFALNTHHDINAVVRAVRTFPYRGGSTNTGKAMKYVKDKIFVASRG 491

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR-VIRSHE 334
            RQ       N  +++V +TDG++  + +D          +     ++A+G++  +RS  
Sbjct: 492 ARQ-------NVPRVMVLITDGKSSDSFKDA-----ATNLRNIDVEIFAVGVKDAVRSE- 538

Query: 335 FLRACASP---NSFYLVENPHSMYDAFSHIGKDIV 366
            L A A+P   N  + VE+    +DAF  I K++ 
Sbjct: 539 -LEAIANPPADNHVFEVED----FDAFQRISKELT 568


>gi|328953621|ref|YP_004370955.1| hypothetical protein Desac_1940 [Desulfobacca acetoxidans DSM
          11109]
 gi|328453945|gb|AEB09774.1| hypothetical protein Desac_1940 [Desulfobacca acetoxidans DSM
          11109]
          Length = 376

 Score = 41.2 bits (95), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 14/60 (23%), Positives = 36/60 (60%)

Query: 10 NFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEG 69
          N   + +G + ++TA+ LP++    G+ I++ +++ +KT + S +D ++     ++ N+G
Sbjct: 4  NLGRHEEGAIAVITALLLPVLIGFTGLAIDIGNLYVIKTRMQSAVDAAVCGGGLKLPNQG 63


>gi|296200542|ref|XP_002747689.1| PREDICTED: matrilin-4 [Callithrix jacchus]
          Length = 770

 Score = 41.2 bits (95), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 84/185 (45%), Gaps = 25/185 (13%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ V+D SRS+  F      + +   + +  ++  + + P+   V   G++ +S++++
Sbjct: 32  LDLVFVIDSSRSVRPF------EFETMRQFLVGLVRGLNVGPNATRV---GVIQYSSQVQ 82

Query: 232 EFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM-QGMRQHCNTEDANYK 288
             F L        + R I+ L      T +   ++YA N  F + +G R      +    
Sbjct: 83  SVFPLRAFSRREDMVRAIRDLVPLAQGTMTGLAIQYAMNVAFSVAEGAR----PPEERVP 138

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NSF 345
           ++ V +TDG     +   +      +A+ RG  +YA+G++       LRA ASP      
Sbjct: 139 RVAVIVTDG-----RPQDRVAEVAAQARARGIEIYAVGVQRADVGS-LRAMASPPLEEHV 192

Query: 346 YLVEN 350
           +LVE+
Sbjct: 193 FLVES 197


>gi|126662673|ref|ZP_01733672.1| hypothetical protein FBBAL38_04940 [Flavobacteria bacterium BAL38]
 gi|126626052|gb|EAZ96741.1| hypothetical protein FBBAL38_04940 [Flavobacteria bacterium BAL38]
          Length = 288

 Score = 40.8 bits (94), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 77/171 (45%), Gaps = 33/171 (19%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
           + +  L MM+V+D+S S ESF   +  K DM +  I A L          N  + GL+ F
Sbjct: 72  EEERELTMMLVVDISGS-ESFGTKNQQKRDM-VTEIAATL----AFSATQNNDKIGLLLF 125

Query: 227 SNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNST---PGLKYAYNQIFDMQGMRQHCNTE 283
           S++IE F   + G SH+ R I+ L +F   +N T     LKY       + G+ +     
Sbjct: 126 SDQIELFIPPKKGKSHVLRIIRELIEFQPKSNKTDLAQALKY-------LSGVLK----- 173

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHE 334
               KK IVFM    +   K+ QQ+L     AKK        GIRV    E
Sbjct: 174 ----KKAIVFMIS--DFMVKDYQQTLKIA--AKKHD----VTGIRVYDQRE 212


>gi|291409921|ref|XP_002721255.1| PREDICTED: matrilin 4 [Oryctolagus cuniculus]
          Length = 346

 Score = 40.8 bits (94), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 85/187 (45%), Gaps = 29/187 (15%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ V+D SRS+         + +   + +  ++  + + P+   V   G++ +S++++
Sbjct: 35  LDLVFVIDSSRSVRPL------EFETMRRFLVGLVRSLDVGPNATRV---GVIQYSSQVQ 85

Query: 232 EFFLLEWGV----SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM-QGMRQHCNTEDAN 286
             F L  G       ++R ++ L      T +   ++YA N  F + +G R      +  
Sbjct: 86  SVFPL--GAFSRREDMERALRTLVPLAQGTMTGLAIQYAMNVAFSVAEGAR----PPEER 139

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---N 343
             ++ V +TDG     +   +      +A+ RG  +YA+G++       LRA ASP    
Sbjct: 140 VPRVAVIVTDG-----RPQDRVAEVAAQARARGIEIYAVGVQRADVGS-LRAMASPPLDE 193

Query: 344 SFYLVEN 350
             +LVE+
Sbjct: 194 HVFLVES 200


>gi|299139026|ref|ZP_07032203.1| VWFA-related domain protein-like protein [Acidobacterium sp.
           MP5ACTX8]
 gi|298599180|gb|EFI55341.1| VWFA-related domain protein-like protein [Acidobacterium sp.
           MP5ACTX8]
          Length = 318

 Score = 40.8 bits (94), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 46/94 (48%), Gaps = 12/94 (12%)

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAI---------GIRVIRSHEF 335
           A  ++++V +TDGEN +      +     +A++ GA++YA+         G      H  
Sbjct: 182 AGQRRVLVLITDGENTTHHGSYDAA--LEQAQRAGAMIYALIIVPVSADAGRNTGGEHAL 239

Query: 336 LR-ACASPNSFYLVENPHSMYDAFSHIGKDIVTK 368
           ++ A  +   +Y VE+ H +  AF H+  D+ T+
Sbjct: 240 IQLARDTGGKYYYVEDKHDLAPAFQHVSDDLRTQ 273


>gi|218678237|ref|ZP_03526134.1| hypothetical protein RetlC8_04927 [Rhizobium etli CIAT 894]
          Length = 120

 Score = 40.4 bits (93), Expect = 0.41,   Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 37/82 (45%), Gaps = 7/82 (8%)

Query: 288 KKIIVFMTDGENLSTKE-----DQQSLYYCNEAKKRGAIVYAIGIRV-IRSHEFLRACAS 341
           KK IVFMTDG+N +        D  +   C++AK +G  +Y I           L  CAS
Sbjct: 27  KKYIVFMTDGDNNNDSSGGRSYDTATKKTCDDAKSKGIEIYTIAFMAPAGGQALLHYCAS 86

Query: 342 PNSFYL-VENPHSMYDAFSHIG 362
            +S Y   E    +  AF  IG
Sbjct: 87  DDSHYFQAEKMEDLLAAFEAIG 108


>gi|149018699|gb|EDL77340.1| rCG25821 [Rattus norvegicus]
          Length = 1513

 Score = 40.4 bits (93), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 84/203 (41%), Gaps = 33/203 (16%)

Query: 169 DARLDMMIVLDVSRS--MESFFDSSITKIDMAIKS-INAMLEEVKLIPDVNNVVQSGLVT 225
           D + D+M ++D S S  +E+F    +   ++  KS I A            + VQ G+V 
Sbjct: 617 DMKADIMFLVDSSGSIGLENFSKMKVFMKNLVSKSQIGA------------DRVQIGVVQ 664

Query: 226 FSNKIEEFFLLEWGVSH--LQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           FS++  E F L   +S   +   I  ++  G +T +   L +        +G R      
Sbjct: 665 FSHENREEFQLNTFMSQNDIANAIDQMAHIGETTLTGSALTFVSQYFSPEKGAR------ 718

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPN 343
             N +K ++ +TDGE     +D          +K G I+Y++G+      +       P 
Sbjct: 719 -PNVRKFLILITDGEAQDIVKDPAVAL-----RKDGVIIYSVGVFGSNVTQLEEISGKPE 772

Query: 344 SFYLVENPHSMYDAFSHIGKDIV 366
             + VEN    +D   HI  D+V
Sbjct: 773 MVFYVEN----FDILQHIEDDLV 791



 Score = 39.7 bits (91), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 46/201 (22%), Positives = 90/201 (44%), Gaps = 29/201 (14%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ V+D S S++ + + +I K        + M+  VK      N V+ G + +++  E
Sbjct: 807 LDVVFVIDSSGSID-YQEYNIMK--------DFMIGLVKKADVGKNQVRFGALKYADDPE 857

Query: 232 EFFLLEWGVSHLQRKIKYLS------KFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDA 285
             F L+     L  K++ +S        G +T +   L ++ +   + +G R H      
Sbjct: 858 VLFYLD----ELGTKLEVISVLQNDQPMGGNTYTAEALAFSDHMFTEARGSRLH-----K 908

Query: 286 NYKKIIVFMTDGENLSTKEDQQSLYYCNEA-KKRGAIVYAIGIRVIRSHEFLRACASPNS 344
              ++++ +TDGE+     D + L    +A + +G +V A+GI    + E L    S + 
Sbjct: 909 GVPQVLIVITDGES----HDAEKLNATAKALRDKGILVLAVGIAGANTWELLAMAGSSDK 964

Query: 345 FYLVENPHSMYDAFSHIGKDI 365
           +Y VE    +   FS +   +
Sbjct: 965 YYFVETFGGLKGIFSDVSASV 985


>gi|953237|gb|AAA99719.1| collagen type XII alpha-1 precursor [Mus musculus]
          Length = 3067

 Score = 40.4 bits (93), Expect = 0.43,   Method: Composition-based stats.
 Identities = 60/257 (23%), Positives = 115/257 (44%), Gaps = 36/257 (14%)

Query: 112 RSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDAR 171
           ++T+L++  +  +  Y IS  +   +     T +   T  +    P+   V+ +   D +
Sbjct: 385 QTTTLNVRDLTADTEYQISVFAMKGLTSSEPTSVMEKTQPK--TQPMKVQVECSRGVDIK 442

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFS-NKI 230
            D++ ++D S S+ +   ++  K+   ++ +    E   + P   N VQ  LV +S +  
Sbjct: 443 ADIVFLVDGSYSIGT---ANFVKVRAFLEVLAKSFE---ISP---NRVQISLVQYSRDPH 493

Query: 231 EEFFLLEWG-VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIF-DMQGMRQHCNTEDANYK 288
            EF L E+  V  + + I      G STN+   + Y   +IF   +G R       +N  
Sbjct: 494 TEFTLKEFNRVEDIIKAINTFPYRGGSTNTGKAMTYVREKIFVPNKGSR-------SNVP 546

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR-VIRSHEFLRACASPNS--- 344
           K+++ +TDGE+     D        + +     ++A+G++  +RS   L A ASP +   
Sbjct: 547 KVMILITDGESSDAFRDPAI-----KLRNSDVEIFAVGVKDAVRSE--LEAIASPPAETH 599

Query: 345 FYLVENPHSMYDAFSHI 361
            + VE+    +DAF  I
Sbjct: 600 VFTVED----FDAFQRI 612


>gi|114682173|ref|XP_001153832.1| PREDICTED: matrilin 4 isoform 1 [Pan troglodytes]
          Length = 488

 Score = 40.4 bits (93), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 69/149 (46%), Gaps = 19/149 (12%)

Query: 211 LIPDVN---NVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKY 265
           L+P +N   N  + G++ +S++++  F L        ++R I+ L      T +   ++Y
Sbjct: 8   LLPGLNVGPNATRVGVIQYSSQVQSVFPLRAFSRREDMERAIRDLVPLAQGTMTGLAIQY 67

Query: 266 AYNQIFDM-QGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYA 324
           A N  F + +G R      +    ++ V +TDG     +   +      +A+ RG  +YA
Sbjct: 68  AMNVAFSVAEGAR----PPEERVPRVAVIVTDG-----RPQDRVAEVAAQARARGIEIYA 118

Query: 325 IGIRVIRSHEFLRACASP---NSFYLVEN 350
           +G++       LRA ASP      +LVE+
Sbjct: 119 VGVQRADVGS-LRAMASPPLDEHVFLVES 146



 Score = 36.6 bits (83), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 40/194 (20%), Positives = 88/194 (45%), Gaps = 27/194 (13%)

Query: 164 VNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGL 223
            N   +  +D+++++D S+S+           ++  + +N +++ + + P+   V   GL
Sbjct: 243 CNRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQIVDFLDVSPEGTRV---GL 293

Query: 224 VTFSNKIE-EFFLLEWGVSHLQRK----IKYLSKFGVSTNSTPGLKYAYNQIF-DMQGMR 277
           V FS+++  EF L  +G +   ++    ++Y+ +    T +   L++     F + QG R
Sbjct: 294 VQFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMER---GTMTGLALRHMVEHSFSEAQGAR 350

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                   N  ++ +  TDG +    +D  S++    AK+ G +VYA+G+      E   
Sbjct: 351 ----PRALNVPRVGLVFTDGRS----QDDISVWAAR-AKEEGIVVYAVGVGKAVEAELRE 401

Query: 338 ACASPNSFYLVENP 351
             + P   ++   P
Sbjct: 402 IASEPAELHVSYAP 415


>gi|156616286|ref|NP_001096077.1| collagen alpha-6(VI) chain isoform 1 [Mus musculus]
 gi|189082903|sp|Q8C6K9|CO6A6_MOUSE RecName: Full=Collagen alpha-6(VI) chain; Flags: Precursor
          Length = 2265

 Score = 40.4 bits (93), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 47/200 (23%), Positives = 86/200 (43%), Gaps = 27/200 (13%)

Query: 169 DARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
           D + D+M ++D S S+      + +K+ M +K+   ++ + ++  D    VQ G+V FS+
Sbjct: 617 DMKADIMFLVDSSGSIGP---ENFSKMKMFMKN---LVSKSQIGADR---VQIGVVQFSH 667

Query: 229 KIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
           + +E F L      S +   I  ++  G +T +   L +        +G R        N
Sbjct: 668 ENKEEFQLNTFMSQSDIANAIDRMTHIGETTLTGSALTFVSQYFSPDKGAR-------PN 720

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFY 346
            +K ++ +TDGE      D          +K G I+Y++G+      +       P   +
Sbjct: 721 VRKFLILITDGEAQDIVRDPAIAL-----RKEGVIIYSVGVFGSNVTQLEEISGKPEMVF 775

Query: 347 LVENPHSMYDAFSHIGKDIV 366
            VEN    +D   HI  D+V
Sbjct: 776 YVEN----FDILQHIEDDLV 791



 Score = 39.7 bits (91), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 47/197 (23%), Positives = 89/197 (45%), Gaps = 29/197 (14%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ V+D S S++ + + +I K        + M+  VK      N V+ G + +++  E
Sbjct: 807 LDVVFVIDSSGSID-YQEYNIMK--------DFMIGLVKKADVGKNQVRFGALKYADDPE 857

Query: 232 EFFLLEWGVSHLQRKIKYLS------KFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDA 285
             F L+     L  K++ +S        G +T +   L ++ +   + +G R H      
Sbjct: 858 VLFYLD----ELGTKLEVVSVLQNDHPMGGNTYTAEALAFSDHMFTEARGSRLH-----K 908

Query: 286 NYKKIIVFMTDGENLSTKEDQQSLYYCNEA-KKRGAIVYAIGIRVIRSHEFLRACASPNS 344
              ++++ +TDGE+     D + L    +A + +G +V A+GI    S E L    S + 
Sbjct: 909 GVPQVLIVITDGES----HDAEKLNTTAKALRDKGILVLAVGIAGANSWELLAMAGSSDK 964

Query: 345 FYLVENPHSMYDAFSHI 361
           +Y VE    +   FS +
Sbjct: 965 YYFVETFGGLKGIFSDV 981


>gi|84688081|ref|ZP_01015939.1| hypothetical protein 1099457000215_RB2654_05415 [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84663909|gb|EAQ10415.1| hypothetical protein RB2654_05415 [Rhodobacterales bacterium
           HTCC2654]
          Length = 595

 Score = 40.4 bits (93), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 43/90 (47%), Gaps = 5/90 (5%)

Query: 285 ANYKKIIVFMTDGE---NLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRS-HEFLRACA 340
           AN+     F+ D     N S K D      C  AK  G +V+ IG  V  S H+ +R+CA
Sbjct: 505 ANWYDQWNFLADAHDYFNYSEKNDNLD-EICTAAKNAGMVVFTIGFEVSGSQHDIMRSCA 563

Query: 341 SPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           S  ++Y   +   +  AF+ I ++I   R+
Sbjct: 564 SAPAYYFDVDGLDISAAFAAIAREISKLRL 593


>gi|326931809|ref|XP_003212016.1| PREDICTED: matrilin-4-like, partial [Meleagris gallopavo]
          Length = 465

 Score = 40.4 bits (93), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 51/223 (22%), Positives = 99/223 (44%), Gaps = 32/223 (14%)

Query: 157 PITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVN 216
           P  +++K  +     LD++ V+D SRS+  F   ++ +          M++ +  +    
Sbjct: 21  PKPAALKCRT---GPLDIVFVIDSSRSVRPFEFETMRRF---------MIDIIGNLDVGP 68

Query: 217 NVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQ 274
           N  + G++ +S++++  F L+  +  + ++R I  +      T +   ++YA N  F +Q
Sbjct: 69  NATRVGVIQYSSQVQNIFSLKTFFTRAEMERAINSIVPLAQGTMTGLAIQYAMNVAFTVQ 128

Query: 275 -GMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSH 333
            G R           +I + +TDG      +D+ S    + A+  G  +YA+GI+    +
Sbjct: 129 EGAR----PPHKKIPRIAIIVTDGR----PQDRVSEVAAH-ARNAGIEIYAVGIQRADMN 179

Query: 334 EFLRACASP---NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
             LRA ASP      +LVE+    ++     GK    K    D
Sbjct: 180 S-LRAMASPPLEEHVFLVES----FELIQQFGKQFQDKLCAID 217


>gi|326918160|ref|XP_003205359.1| PREDICTED: hypothetical protein LOC100539194 [Meleagris gallopavo]
          Length = 1584

 Score = 40.4 bits (93), Expect = 0.51,   Method: Composition-based stats.
 Identities = 45/183 (24%), Positives = 82/183 (44%), Gaps = 31/183 (16%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDM--AIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK- 229
           D++ +LD S        SS+ K D     + ++ ++E  ++ PD   V   G+V +S++ 
Sbjct: 38  DLVFILDAS--------SSVGKEDFEKVRQWVSNLVETFEIGPDKTRV---GVVRYSDRP 86

Query: 230 IEEFFLLEWG----VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQ-GMRQHCNTED 284
             EF L ++     +    RKI+Y   +G +TN+   L+Y     F  + G R      D
Sbjct: 87  TTEFDLGKYKTREEIKEAARKIRY---YGGNTNTGDALRYINTYSFSKEAGGR----LSD 139

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNS 344
              KK+ + +TDG     +     L   N A++ G  ++A+G+      E     + P S
Sbjct: 140 RTVKKVAILLTDG-----RSQDYVLDPANAARQAGIRIFAVGVGEALKEELDEIASEPKS 194

Query: 345 FYL 347
            ++
Sbjct: 195 AHV 197


>gi|212720733|ref|NP_001132911.1| collagen, type XXII, alpha 1 [Gallus gallus]
          Length = 1599

 Score = 40.4 bits (93), Expect = 0.51,   Method: Composition-based stats.
 Identities = 45/183 (24%), Positives = 82/183 (44%), Gaps = 31/183 (16%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDM--AIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK- 229
           D++ +LD S        SS+ K D     + ++ ++E  ++ PD   V   G+V +S++ 
Sbjct: 38  DLVFILDAS--------SSVGKEDFEKVRQWVSNLVETFEIGPDKTRV---GVVRYSDRP 86

Query: 230 IEEFFLLEWG----VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQ-GMRQHCNTED 284
             EF L ++     +    RKI+Y   +G +TN+   L+Y     F  + G R      D
Sbjct: 87  TTEFDLGKYKTCEEIKEAARKIRY---YGGNTNTGDALRYINTYSFSKEAGGR----LSD 139

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNS 344
              KK+ + +TDG     +     L   N A++ G  ++A+G+      E     + P S
Sbjct: 140 RTVKKVAILLTDG-----RSQDYVLDPANAARQAGIRIFAVGVGEALKEELDEIASEPKS 194

Query: 345 FYL 347
            ++
Sbjct: 195 AHV 197


>gi|117618125|ref|YP_856000.1| hypothetical protein AHA_1462 [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117559532|gb|ABK36480.1| conserved hypothetical protein [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 460

 Score = 40.0 bits (92), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 51/120 (42%), Gaps = 17/120 (14%)

Query: 241 SHLQRKIKYLSKF-----GVSTNSTPGLKYAYNQIFDM-QGMRQHCNTE------DANYK 288
           +HL  +  Y           +TN+  G+ + +  +    QG  Q    E       A+ +
Sbjct: 316 AHLSTRAAYRQALDTLHAAFNTNTAEGVMWGWRLLSPQWQGRWQQGAAELPRPYGQADNR 375

Query: 289 KIIVFMTDGENLSTK---EDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSF 345
           KI+V  +DGE++  +    D++ L  C E K++G  VY +         F+  CAS  S 
Sbjct: 376 KILVLFSDGEHMGPEAALRDRKQLLLCREMKRKGIQVYTVAFEG--DARFVAQCASERSL 433


>gi|13476511|ref|NP_108081.1| hypothetical protein mlr7847 [Mesorhizobium loti MAFF303099]
 gi|14027272|dbj|BAB54226.1| mlr7847 [Mesorhizobium loti MAFF303099]
          Length = 548

 Score = 40.0 bits (92), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 52/143 (36%), Gaps = 35/143 (24%)

Query: 254 GVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENL-------STKEDQ 306
           G  TN + GL +    +            +     KI++ +TDGEN+        TK D 
Sbjct: 395 GSGTNVSEGLSWGMRVLSPAAPYTDGAPWKTPGISKIVLLLTDGENVVYGASEQPTKSDY 454

Query: 307 QSLYY-------------------------CNEAKKRGAIVYAIGIR--VIRSHEFLRAC 339
            S  Y                         C + K +G  +Y + ++     +     AC
Sbjct: 455 TSYGYLAGGRFGSDDQTAAARNVDGWTKSVCTQLKNQGVQIYTMVLQSDTAANRALYSAC 514

Query: 340 AS-PNSFYLVENPHSMYDAFSHI 361
           AS P+ +Y V +P  + D F HI
Sbjct: 515 ASDPSGYYAVNDPAKLPDVFQHI 537


>gi|326672754|ref|XP_002664126.2| PREDICTED: collagen alpha-1(XXI) chain-like [Danio rerio]
          Length = 572

 Score = 40.0 bits (92), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 64/134 (47%), Gaps = 18/134 (13%)

Query: 219 VQSGLVTFSNKIEEFFLLEWG----VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQ 274
            Q G+V +S+  + F  +  G     S L + ++ +   G +TN+   +K+A +++F + 
Sbjct: 78  TQVGVVQYSD--DPFLHIPLGKHFSSSDLIKAMESIEYMGGNTNTGRAIKFANDKLFALS 135

Query: 275 GMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHE 334
               +         KI V +TDG     K   + L     A+K+G I++AIG+       
Sbjct: 136 ERGPN------GIAKIAVVLTDG-----KSQDEVLAAAEAARKKGIILFAIGVGSETEEA 184

Query: 335 FLRACAS-PNSFYL 347
            LRA A+ P+S Y+
Sbjct: 185 QLRAIANKPSSTYV 198


>gi|222528098|ref|YP_002571980.1| von Willebrand factor type A [Caldicellulosiruptor bescii DSM 6725]
 gi|222454945|gb|ACM59207.1| von Willebrand factor type A [Caldicellulosiruptor bescii DSM 6725]
          Length = 902

 Score = 40.0 bits (92), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 56/219 (25%), Positives = 97/219 (44%), Gaps = 34/219 (15%)

Query: 148 YTNS-RHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAML 206
           Y+NS    ++P+   +K N + +  +D+++VLD S SM    D+ I K+++A  +   M+
Sbjct: 382 YSNSVLEKMLPVKMEIK-NKEKEKNIDVVLVLDHSGSMADTEDAGIPKLEIAKSASAKMI 440

Query: 207 EEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWG-VSHLQRKIKYLS--KFGVSTNSTPGL 263
           E ++    V      G++ F +    ++  ++G +S  +  I+ +S  + G  T   P L
Sbjct: 441 EHLESSDGV------GVIAFDHNY--YWAYKFGKISKKEDVIESISSIEVGGGTAIIPPL 492

Query: 264 KYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYY--CNEAKKRGAI 321
             A   +   +   +            IV +TDG        +Q  Y    NEAK+    
Sbjct: 493 SEAVKTLKKSKAKSKL-----------IVLLTDGMG------EQGGYEIPANEAKRNNIK 535

Query: 322 VYAIGIRVIRSHEFLRACASPNS--FYLVENPHSMYDAF 358
           +  IG+    +   L   AS  S  FYLV NP  + D F
Sbjct: 536 ITTIGVGKYVNATVLSWIASFTSGRFYLVSNPSELVDVF 574


>gi|306824220|ref|ZP_07457590.1| conserved hypothetical protein [Bifidobacterium dentium ATCC 27679]
 gi|309801684|ref|ZP_07695804.1| von Willebrand factor type A domain protein [Bifidobacterium
           dentium JCVIHMP022]
 gi|304552423|gb|EFM40340.1| conserved hypothetical protein [Bifidobacterium dentium ATCC 27679]
 gi|308221626|gb|EFO77918.1| von Willebrand factor type A domain protein [Bifidobacterium
           dentium JCVIHMP022]
          Length = 967

 Score = 40.0 bits (92), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 80/179 (44%), Gaps = 23/179 (12%)

Query: 172 LDMMIVLDVSRSMESFFDS--SITKIDMAIKSINAMLEEVK----LIPDVNNVVQSGLVT 225
           +D+ +VLDVS SM   F    S +KI     ++N+ L+E       I D NN V+  LV 
Sbjct: 244 IDIALVLDVSGSMNDDFGGRGSPSKISALKTAVNSFLDETAKTNDTIEDDNNKVKVALVK 303

Query: 226 FSNKIEEFFLLEW---------GVSHLQRKIKYLS-KFGVSTNSTPGLKYAYNQIFD--M 273
           ++N+I      +             +  + ++ L+   G+   S  GL+ A     D  M
Sbjct: 304 YANQIGTATGADGCRISNSRQSDTGNCTQIVQELTTDAGLLKTSVNGLQAAGATYADAAM 363

Query: 274 QGMRQHCNTEDANYKKIIVFMTDGE--NLSTKEDQ---QSLYYCNEAKKRGAIVYAIGI 327
           +  +Q      A  KK ++F TDGE  + S  +D     ++    E K  G  VY+IGI
Sbjct: 364 EVAQQALAGGRAGAKKYVIFFTDGEPNHWSGFDDDVANAAIKKSQELKNAGTTVYSIGI 422


>gi|293349448|ref|XP_002727144.1| PREDICTED: collagen type VI alpha 6-like [Rattus norvegicus]
          Length = 2264

 Score = 40.0 bits (92), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 84/203 (41%), Gaps = 33/203 (16%)

Query: 169 DARLDMMIVLDVSRS--MESFFDSSITKIDMAIKS-INAMLEEVKLIPDVNNVVQSGLVT 225
           D + D+M ++D S S  +E+F    +   ++  KS I A            + VQ G+V 
Sbjct: 617 DMKADIMFLVDSSGSIGLENFSKMKVFMKNLVSKSQIGA------------DRVQIGVVQ 664

Query: 226 FSNKIEEFFLLEWGVSH--LQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           FS++  E F L   +S   +   I  ++  G +T +   L +        +G R      
Sbjct: 665 FSHENREEFQLNTFMSQNDIANAIDQMAHIGETTLTGSALTFVSQYFSPEKGAR------ 718

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPN 343
             N +K ++ +TDGE     +D          +K G I+Y++G+      +       P 
Sbjct: 719 -PNVRKFLILITDGEAQDIVKDPAVAL-----RKDGVIIYSVGVFGSNVTQLEEISGKPE 772

Query: 344 SFYLVENPHSMYDAFSHIGKDIV 366
             + VEN    +D   HI  D+V
Sbjct: 773 MVFYVEN----FDILQHIEDDLV 791



 Score = 39.3 bits (90), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 89/197 (45%), Gaps = 29/197 (14%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ V+D S S++ + + +I K        + M+  VK      N V+ G + +++  E
Sbjct: 807 LDVVFVIDSSGSID-YQEYNIMK--------DFMIGLVKKADVGKNQVRFGALKYADDPE 857

Query: 232 EFFLLEWGVSHLQRKIKYLS------KFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDA 285
             F L+     L  K++ +S        G +T +   L ++ +   + +G R H      
Sbjct: 858 VLFYLD----ELGTKLEVISVLQNDQPMGGNTYTAEALAFSDHMFTEARGSRLH-----K 908

Query: 286 NYKKIIVFMTDGENLSTKEDQQSLYYCNEA-KKRGAIVYAIGIRVIRSHEFLRACASPNS 344
              ++++ +TDGE+     D + L    +A + +G +V A+GI    + E L    S + 
Sbjct: 909 GVPQVLIVITDGES----HDAEKLNATAKALRDKGILVLAVGIAGANTWELLAMAGSSDK 964

Query: 345 FYLVENPHSMYDAFSHI 361
           +Y VE    +   FS +
Sbjct: 965 YYFVETFGGLKGIFSDV 981


>gi|118100589|ref|XP_425698.2| PREDICTED: similar to matrilin-4 [Gallus gallus]
          Length = 564

 Score = 40.0 bits (92), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 49/208 (23%), Positives = 93/208 (44%), Gaps = 29/208 (13%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ V+D SRS+  F   ++ +          M++ +  +    N  + G++ +S++++
Sbjct: 33  LDIVFVIDSSRSVRPFEFETMRRF---------MIDIIGNLDVGPNATRVGVIQYSSQVQ 83

Query: 232 EFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQ-GMRQHCNTEDANYK 288
             F L+  +  + ++R I  +      T +   ++YA N  F +Q G R           
Sbjct: 84  NIFSLKTFFTRAEMERAINSIVPLAQGTMTGLAIQYAMNVAFTVQEGAR----PPHKKIP 139

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NSF 345
           +I + +TDG      +D+ S    + A+  G  +YA+GI+    +  LRA ASP      
Sbjct: 140 RIAIIVTDGR----PQDRVSEVAAH-ARNAGIEIYAVGIQRADMNS-LRAMASPPLEEHV 193

Query: 346 YLVENPHSMYDAFSHIGKDIVTKRIWYD 373
           +LVE+    ++     GK    K    D
Sbjct: 194 FLVES----FELIQQFGKQFQDKLCAID 217


>gi|293361343|ref|XP_236593.5| PREDICTED: collagen type VI alpha 6 [Rattus norvegicus]
          Length = 2264

 Score = 40.0 bits (92), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 84/203 (41%), Gaps = 33/203 (16%)

Query: 169 DARLDMMIVLDVSRS--MESFFDSSITKIDMAIKS-INAMLEEVKLIPDVNNVVQSGLVT 225
           D + D+M ++D S S  +E+F    +   ++  KS I A            + VQ G+V 
Sbjct: 617 DMKADIMFLVDSSGSIGLENFSKMKVFMKNLVSKSQIGA------------DRVQIGVVQ 664

Query: 226 FSNKIEEFFLLEWGVSH--LQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           FS++  E F L   +S   +   I  ++  G +T +   L +        +G R      
Sbjct: 665 FSHENREEFQLNTFMSQNDIANAIDQMAHIGETTLTGSALTFVSQYFSPEKGAR------ 718

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPN 343
             N +K ++ +TDGE     +D          +K G I+Y++G+      +       P 
Sbjct: 719 -PNVRKFLILITDGEAQDIVKDPAVAL-----RKDGVIIYSVGVFGSNVTQLEEISGKPE 772

Query: 344 SFYLVENPHSMYDAFSHIGKDIV 366
             + VEN    +D   HI  D+V
Sbjct: 773 MVFYVEN----FDILQHIEDDLV 791



 Score = 39.3 bits (90), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 89/197 (45%), Gaps = 29/197 (14%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ V+D S S++ + + +I K        + M+  VK      N V+ G + +++  E
Sbjct: 807 LDVVFVIDSSGSID-YQEYNIMK--------DFMIGLVKKADVGKNQVRFGALKYADDPE 857

Query: 232 EFFLLEWGVSHLQRKIKYLS------KFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDA 285
             F L+     L  K++ +S        G +T +   L ++ +   + +G R H      
Sbjct: 858 VLFYLD----ELGTKLEVISVLQNDQPMGGNTYTAEALAFSDHMFTEARGSRLH-----K 908

Query: 286 NYKKIIVFMTDGENLSTKEDQQSLYYCNEA-KKRGAIVYAIGIRVIRSHEFLRACASPNS 344
              ++++ +TDGE+     D + L    +A + +G +V A+GI    + E L    S + 
Sbjct: 909 GVPQVLIVITDGES----HDAEKLNATAKALRDKGILVLAVGIAGANTWELLAMAGSSDK 964

Query: 345 FYLVENPHSMYDAFSHI 361
           +Y VE    +   FS +
Sbjct: 965 YYFVETFGGLKGIFSDV 981


>gi|293361345|ref|XP_236596.5| PREDICTED: collagen type VI alpha 4 [Rattus norvegicus]
          Length = 2327

 Score = 39.7 bits (91), Expect = 0.68,   Method: Composition-based stats.
 Identities = 38/132 (28%), Positives = 63/132 (47%), Gaps = 13/132 (9%)

Query: 219 VQSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAY-NQIFDMQG 275
           VQ GLV +S+ I   F L+     S +  +I+ L     STN+   L++   N + +M G
Sbjct: 272 VQVGLVQYSDNIYPAFQLKQSSLKSVVLEQIRNLPYNMGSTNTGSALEFIRANYLTEMSG 331

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF 335
            R     +D    +I++ +TDGE  S  E Q +    ++ K+ G  VY +GI +    E 
Sbjct: 332 SR----AKDG-VPQIVILVTDGE--SNDEVQDA---ADQLKRDGVFVYVVGINIQDVQEL 381

Query: 336 LRACASPNSFYL 347
            +  + P   +L
Sbjct: 382 QKIASEPFEEFL 393


>gi|293349452|ref|XP_002727145.1| PREDICTED: similar to procollagen, type VI, alpha 3 isoform 4
           [Rattus norvegicus]
          Length = 2114

 Score = 39.7 bits (91), Expect = 0.68,   Method: Composition-based stats.
 Identities = 38/132 (28%), Positives = 63/132 (47%), Gaps = 13/132 (9%)

Query: 219 VQSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAY-NQIFDMQG 275
           VQ GLV +S+ I   F L+     S +  +I+ L     STN+   L++   N + +M G
Sbjct: 272 VQVGLVQYSDNIYPAFQLKQSSLKSVVLEQIRNLPYNMGSTNTGSALEFIRANYLTEMSG 331

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF 335
            R     +D    +I++ +TDGE  S  E Q +    ++ K+ G  VY +GI +    E 
Sbjct: 332 SR----AKDG-VPQIVILVTDGE--SNDEVQDA---ADQLKRDGVFVYVVGINIQDVQEL 381

Query: 336 LRACASPNSFYL 347
            +  + P   +L
Sbjct: 382 QKIASEPFEEFL 393


>gi|297581617|ref|ZP_06943539.1| flp pilus assembly protein TadG [Vibrio cholerae RC385]
 gi|297534024|gb|EFH72863.1| flp pilus assembly protein TadG [Vibrio cholerae RC385]
          Length = 467

 Score = 39.7 bits (91), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 38/70 (54%), Gaps = 4/70 (5%)

Query: 283 EDANYKKIIVFMTDGENLS--TKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA 340
           +  N +K+++  TDG +L    K D++ +  C E KK+G  +  I I      + +++CA
Sbjct: 379 QHPNNRKVMLLFTDGNHLVDVAKRDRKQVALCREMKKQG--IEIISIDFNNRSQVMKSCA 436

Query: 341 SPNSFYLVEN 350
           S   +Y+ +N
Sbjct: 437 SAGQYYIADN 446


>gi|311105413|ref|YP_003978266.1| hemolysin-type calcium-binding repeat family protein 3 [Achromobacter
            xylosoxidans A8]
 gi|310760102|gb|ADP15551.1| hemolysin-type calcium-binding repeat family protein 3 [Achromobacter
            xylosoxidans A8]
          Length = 2061

 Score = 39.7 bits (91), Expect = 0.72,   Method: Composition-based stats.
 Identities = 45/153 (29%), Positives = 69/153 (45%), Gaps = 37/153 (24%)

Query: 165  NSQTDARLDMMIVLDVSRSMESFFDSSI---TKIDMAIKSINAMLEEVKLIPDVNNVVQS 221
            N    A  ++ +VLD+S SM+ ++ S     T+++ A K++ ++LE      D    +  
Sbjct: 1436 NVTPGASYNIALVLDLSGSMDYYWGSGSNQETRLETAKKALKSLLENQLATHD--GTINV 1493

Query: 222  GLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVS--TNSTPGLKY--------AYNQI- 270
             L+TF++            S LQ+ I  L+   V    N   GLK         A+N+  
Sbjct: 1494 SLITFADS----------SSKLQKAISGLTPDNVDDMVNILLGLKAGGGTPYGAAFNETK 1543

Query: 271  --FDMQGMRQHCNTEDAN---YKKIIVFMTDGE 298
              FD Q       TEDAN   YK +  F+TDGE
Sbjct: 1544 SWFDGQ------PTEDANGNAYKNLTFFLTDGE 1570


>gi|224077994|ref|XP_002192008.1| PREDICTED: similar to matrilin 4 [Taeniopygia guttata]
          Length = 580

 Score = 39.7 bits (91), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 85/185 (45%), Gaps = 25/185 (13%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ V+D SRS+  F   ++ +  M I      +  + + P+   V   G++ +S++++
Sbjct: 33  LDIVFVIDSSRSVRPFEFETMRRFMMDI------IGNLDVGPNATRV---GVIQYSSQVQ 83

Query: 232 EFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQ-GMRQHCNTEDANYK 288
             F L+  +  + ++R I  +      T +   ++YA N  F  Q G R           
Sbjct: 84  NIFSLKTFFTRADMERAINSIIPLAQGTMTGLAIQYAMNVAFTTQEGAR----PLHKRIP 139

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NSF 345
           +I + +TDG     +   +      +A+  G  +YA+GI+    +  LRA ASP      
Sbjct: 140 RIAIVVTDG-----RPQDRVTEVATQARNAGIEIYAVGIQRADMNS-LRAMASPPLEEHV 193

Query: 346 YLVEN 350
           +LVE+
Sbjct: 194 FLVES 198


>gi|120616160|gb|ABG80452.1| collagen [Hydra vulgaris]
          Length = 2439

 Score = 39.3 bits (90), Expect = 0.95,   Method: Composition-based stats.
 Identities = 45/202 (22%), Positives = 91/202 (45%), Gaps = 22/202 (10%)

Query: 169  DARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
            D   D+   LD S    SF++    +    IKS+   +++++L    ++ V+ G++T+S+
Sbjct: 1836 DIPTDIAFALDAS---ASFYEEGFQQEKDFIKSV---IDKIEL---SSSGVRVGVLTYSD 1886

Query: 229  --KIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
              KI   F   +    +++ I  +    + T    GL+ A     +  G R        +
Sbjct: 1887 EAKIRIRFDYSFDKEDVKKAIDNIPYDSMGTRIDLGLEAAKELFLEKSGGR-------GS 1939

Query: 287  YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGI-RVIRSHEFLRACASPNSF 345
             KK+++ +TDG+     + +  + Y  E  + G  ++AIGI   I   +     + P   
Sbjct: 1940 SKKVLILLTDGQQTYIPDAKDPVDYAKELAEYGVDIFAIGIGDEINKVDLEDLISKPQHI 1999

Query: 346  YLVENPHSMYDAFSHIGKDIVT 367
            +L ++ +S+    + + KDI T
Sbjct: 2000 FLSDDINSL---ITDLSKDIST 2018


>gi|89091868|ref|ZP_01164823.1| sensory box sensor/GGDEF/EAL domain protein [Oceanospirillum sp.
           MED92]
 gi|89083603|gb|EAR62820.1| sensory box sensor/GGDEF/EAL domain protein [Oceanospirillum sp.
           MED92]
          Length = 735

 Score = 39.3 bits (90), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 38/78 (48%), Gaps = 15/78 (19%)

Query: 260 TPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCN-----E 314
           T  L  A+NQ+F++QG+R  C+T       + +F  D +N       Q L+ C      E
Sbjct: 403 TQSLVGAFNQVFELQGLRLRCSTSIG----LSLFPHDADN------SQELFKCADQALYE 452

Query: 315 AKKRGAIVYAIGIRVIRS 332
           AKK G   YA+    +R+
Sbjct: 453 AKKNGGACYAVFTPRLRT 470


>gi|315122852|ref|YP_004063341.1| hypothetical protein CKC_05540 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496254|gb|ADR52853.1| hypothetical protein CKC_05540 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 494

 Score = 39.3 bits (90), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 64/135 (47%), Gaps = 17/135 (12%)

Query: 11  FFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQI--MNE 68
            F++ KG   +++AI +P + L+LG+++  S+    K  + S  + +L H  + I   N+
Sbjct: 30  LFFSKKGNFAMISAIMIPSLALLLGIVLVTSNYLLHKYSVESASEEALSHGMSLICYQND 89

Query: 69  GNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQN---- 124
              +N  K+   D++  +K           ++N    + D + +++ +DI  +  +    
Sbjct: 90  IERDNLAKIILNDLIVSLK-----------KNNFTKQEADLVAKNSKIDITTLINDSTNV 138

Query: 125 EGYSISAISRYKIPL 139
           + Y     S YK+PL
Sbjct: 139 KSYHFYIKSVYKMPL 153


>gi|47230696|emb|CAF99889.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 1031

 Score = 39.3 bits (90), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 50/215 (23%), Positives = 98/215 (45%), Gaps = 38/215 (17%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV----QSGLVTFS 227
           +D++IVLD S S+  +++     I++        L++  + P     +    Q G++ + 
Sbjct: 110 MDIVIVLDGSNSIYPWYEVQAFLINI--------LQKFYIGPGQIQFLWFTGQVGVLQYG 161

Query: 228 NKI-EEFFLLEW-GVSHLQRKIKYLS-KFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
            K+  EF L ++  V  + ++ + ++ + G  TN+  G+  A +Q F   G R       
Sbjct: 162 EKVVHEFKLSDYKSVEEVVKRARSINQRGGEETNTALGINVACSQAFKHGGRR------- 214

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGI------RVIRSHEFLRA 338
              KK+++ +TDGE+  + + QQ +  C   +K G   YAI +      R I    FL  
Sbjct: 215 -GAKKVMIVITDGESHDSADLQQVIKDC---EKDGITRYAIAVLGYYNRRGINPEAFLNE 270

Query: 339 ----CASPNS--FYLVENPHSMYDAFSHIGKDIVT 367
                + P+   F+ V +  ++ D    +G+ I +
Sbjct: 271 IKYIASDPDDKHFFNVTDEAALKDIVDALGERIFS 305


>gi|39936736|ref|NP_949012.1| hypothetical protein RPA3674 [Rhodopseudomonas palustris CGA009]
 gi|192292562|ref|YP_001993167.1| TadE family protein [Rhodopseudomonas palustris TIE-1]
 gi|39650592|emb|CAE29115.1| conserved hypothetical protein [Rhodopseudomonas palustris
          CGA009]
 gi|192286311|gb|ACF02692.1| TadE family protein [Rhodopseudomonas palustris TIE-1]
          Length = 177

 Score = 39.3 bits (90), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 26/49 (53%)

Query: 9  RNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRS 57
          R F  N KG   +  AI  PI F +L  IIEV+ IFF   VL + +  S
Sbjct: 13 RKFRRNRKGSAAVEFAIVAPIFFALLFAIIEVAMIFFASQVLETAVQDS 61


>gi|198434986|ref|XP_002126110.1| PREDICTED: similar to RIKEN cDNA E330026B02 [Ciona intestinalis]
          Length = 1715

 Score = 38.9 bits (89), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 37/64 (57%), Gaps = 3/64 (4%)

Query: 286 NYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACAS-PNS 344
           N  +II+F+TDG  +   E+ Q++   NE +  GA+VY IG+  + S   LR  AS P S
Sbjct: 348 NVSQIIIFVTDGGVVDDSEESQTIL--NELRFSGALVYTIGVGRMVSRPQLRMIASRPAS 405

Query: 345 FYLV 348
            ++ 
Sbjct: 406 HHVT 409


>gi|308511201|ref|XP_003117783.1| hypothetical protein CRE_00574 [Caenorhabditis remanei]
 gi|308238429|gb|EFO82381.1| hypothetical protein CRE_00574 [Caenorhabditis remanei]
          Length = 566

 Score = 38.9 bits (89), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 46/187 (24%), Positives = 75/187 (40%), Gaps = 33/187 (17%)

Query: 169 DARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
           D R D+ I+ D S S+E  F          +K    ++E++ + P+   V    ++ F+ 
Sbjct: 386 DCRYDIGIIFDSSGSLEKNFQKQ-------LKFATTLVEQMPISPNATRVA---IIQFAG 435

Query: 229 KIEEFFLLEWGVSHLQRKIKYL---SKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDA 285
           K +   L ++       ++K +   S F   T  T G       +F      Q     DA
Sbjct: 436 KTKLRVLADFAQKKSAAELKTIIGRSHFFSGTTFTNGALKTMADLF------QKSKRADA 489

Query: 286 NYKKIIVFMTDGENLS-TKEDQQSLYYCNEAKKRGAIVYAIGIRVIRS-----HEFLRAC 339
             K  +V  TDG +   T E  ++L      K +G +VY +GI   +S      E     
Sbjct: 490 KLK--VVLFTDGYSAEDTSEGAEAL------KSQGVVVYTVGISTEKSTGLNMKELHGMA 541

Query: 340 ASPNSFY 346
            SPN F+
Sbjct: 542 TSPNHFF 548


>gi|73998866|ref|XP_535021.2| PREDICTED: similar to A-domain containing protein similar to
           matrilin and collagen [Canis familiaris]
          Length = 788

 Score = 38.9 bits (89), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 45/201 (22%), Positives = 88/201 (43%), Gaps = 27/201 (13%)

Query: 151 SRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSM-ESFFDSSITKIDMAIKSINAMLEEV 209
           SR  +  I+++ K+  Q  A +D++ ++D S S+ +  F+ S     M   +++   E V
Sbjct: 48  SRETIGKISAASKMM-QCSAAVDILFLIDGSHSVGKGSFERSKHFAIMVCDALDINPERV 106

Query: 210 KLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSH--LQRKIKYLSKFGVSTNSTPGLKYAY 267
           ++          G + FS+     F L+   S   ++ KIK +   G  T +   LKY  
Sbjct: 107 RV----------GAIQFSSAPHLEFPLDSFSSQQEVKAKIKRMVFKGGRTETGLALKYLL 156

Query: 268 NQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGI 327
            + F            +A+  +I++ +TDG     +          + K+RG  ++A+G+
Sbjct: 157 RRGFP--------GGRNASVPQILIVITDG-----RSQGHVAVPTKQLKERGVTIFAVGV 203

Query: 328 RVIRSHEFLRACASPNSFYLV 348
           R  R  E  R  + P   +++
Sbjct: 204 RFPRWEELHRLASEPREQHVL 224


>gi|291388325|ref|XP_002710627.1| PREDICTED: matrilin 3-like [Oryctolagus cuniculus]
          Length = 1109

 Score = 38.9 bits (89), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 40/184 (21%), Positives = 85/184 (46%), Gaps = 23/184 (12%)

Query: 168 TDARLDMMIVLDVSRSM-ESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
           T+  LD++ V+D S+S+ E  F+       +  + + A+++ + + P    V   GL+ +
Sbjct: 803 TEGPLDLVFVIDGSKSLGEDNFE-------IVKQFLTAIIDSLAVSPKAARV---GLLQY 852

Query: 227 SNKIE-EFFLLEWGVSH-LQRKIKYLSKFGVSTNSTPGLKYAYNQIF-DMQGMRQHCNTE 283
           S ++  EF L  +  +  +++ + ++   G  + +   LK+ + + F  ++G R      
Sbjct: 853 STQVRAEFTLRSFSTAKDMKKAVAHMKYMGKGSMTGQALKHMFERSFTQLEGAR----PL 908

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPN 343
            A   ++ +  TDG      +D  S +  N+AK  G  +YA+G+      E     + P 
Sbjct: 909 SARVPRVAIVFTDGR----AQDDVSEWA-NKAKANGITMYAVGVGKAIEEELQEIASEPT 963

Query: 344 SFYL 347
             +L
Sbjct: 964 DKHL 967


>gi|114798549|ref|YP_759188.1| hypothetical protein HNE_0458 [Hyphomonas neptunium ATCC 15444]
 gi|114738723|gb|ABI76848.1| conserved domain protein [Hyphomonas neptunium ATCC 15444]
          Length = 460

 Score = 38.9 bits (89), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/96 (22%), Positives = 46/96 (47%), Gaps = 8/96 (8%)

Query: 283 EDANYKKIIVFMTDGENLSTKEDQ-------QSLYYCNEAKKRGAIVYAIGIRVIRSHEF 335
           ++ +  K+++ M+DG+   T+ +        Q+   C++ K++  ++Y +G       + 
Sbjct: 363 DEPDATKVVIMMSDGQYNETRHNNAYPSSVTQAEAICDKMKEKEVVIYTVGFDAGYGQDV 422

Query: 336 LRACASPNSF-YLVENPHSMYDAFSHIGKDIVTKRI 370
           L  CAS  +F Y   N   + +A+  I + I   RI
Sbjct: 423 LNYCASNPAFAYKPTNGQELTEAYKSIARSISDLRI 458


>gi|75675889|ref|YP_318310.1| hypothetical protein Nwi_1697 [Nitrobacter winogradskyi Nb-255]
 gi|74420759|gb|ABA04958.1| hypothetical protein Nwi_1697 [Nitrobacter winogradskyi Nb-255]
          Length = 605

 Score = 38.5 bits (88), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 62/145 (42%), Gaps = 16/145 (11%)

Query: 241 SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN-YKKIIVFMTDGEN 299
           S L+ +I  +S  G STN   GL + +  +    G       + A  Y+  +V ++DG N
Sbjct: 460 STLKNQIDSMSPSG-STNQAIGLAWGWQTLSTTNGPFPAPAKDKAYVYQDYLVLLSDGLN 518

Query: 300 L-----------STKEDQQSLYYCNEAKKRGAIVYAIGIRVIRS---HEFLRACASPNSF 345
                       S + D +    C + K  G +++ + + V       + L+ CAS  +F
Sbjct: 519 TRNRWSGNGSDHSPEVDVRQALLCQKVKDSGTVIFTVQVNVGNRDPLSQVLQDCASNGNF 578

Query: 346 YLVENPHSMYDAFSHIGKDIVTKRI 370
            ++ + +   DAF +I   I   RI
Sbjct: 579 QMITSANQTADAFQNILTQISQLRI 603


>gi|118086119|ref|XP_426008.2| PREDICTED: similar to alpha 3 type VI collagen [Gallus gallus]
          Length = 2533

 Score = 38.5 bits (88), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 41/181 (22%), Positives = 84/181 (46%), Gaps = 23/181 (12%)

Query: 173  DMMIVLDVSRSM-ESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
            D++ ++D S S+ E+ F +  T +   + S +   ++V+L          G+V +S + +
Sbjct: 1211 DLIFLIDGSESISENSFSTMKTFMKDVVDSFDISRDKVRL----------GVVQYSQEPQ 1260

Query: 232  -EFFLLE-WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
             EF+L E +  + ++ +I  + +   ST +  GL++  +      G R++         +
Sbjct: 1261 REFYLNEFYSDTIIKEQINRIEQLRSSTFTGKGLRFVQSLFESANGGRKN-----QGVSQ 1315

Query: 290  IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVE 349
             +V +TDG +  + +D       N     G  V+A+G+ ++ S E LR        + VE
Sbjct: 1316 NLVVITDGYSADSVDDAAMALRSN-----GIHVFAVGVGIVNSFELLRIAGDARRVFTVE 1370

Query: 350  N 350
            N
Sbjct: 1371 N 1371



 Score = 36.2 bits (82), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 44/194 (22%), Positives = 84/194 (43%), Gaps = 42/194 (21%)

Query: 144 FIPWYTNSRHIVMPITSSV-KVNSQTDARLDMMIVLDVSRSMES--------FFDSSITK 194
           F+  + + +HI   I   V   N   + R D++ ++D S S+ +        F  S + K
Sbjct: 803 FVNDFDSLKHIKHEIVQEVCSTNVCKNVRADIVFLVDSSNSIRAAEFQKIKDFMQSFVIK 862

Query: 195 IDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSK 252
           +D+ + +                 V+ GL+ FS++I E F L+    ++ +QR I+ + +
Sbjct: 863 VDVGLDN-----------------VRIGLIQFSSEIREEFQLDRYSTIADVQRAIQEMQQ 905

Query: 253 FGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYC 312
             + T +   L +A +     +G R          K+ ++ +TDGE       Q S+   
Sbjct: 906 IKLGTLTGKALTFAASYFDRPKGGR-------PELKQYLIVITDGEA------QDSVKSP 952

Query: 313 NEA-KKRGAIVYAI 325
             A + +G  +YAI
Sbjct: 953 ARAIRDKGITIYAI 966


>gi|327269537|ref|XP_003219550.1| PREDICTED: matrilin-2-like [Anolis carolinensis]
          Length = 809

 Score = 38.5 bits (88), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 79/163 (48%), Gaps = 21/163 (12%)

Query: 168 TDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFS 227
           +D RLD++ ++D SRS+  +      K+   I +I   L+ + + PDV  V   GL+ + 
Sbjct: 14  SDKRLDLVFIIDSSRSVRPY---DFEKVKEFILNI---LQFLDIRPDVTRV---GLIQYG 64

Query: 228 NKIE-EFFLLEWGVSH-LQRKIKYLSKFGVSTNSTPGLKYAYNQIF-DMQGMRQHCNTED 284
           + ++ EF L  +     ++R ++ +      T +   +++A N  F + +G R       
Sbjct: 65  STVKNEFSLKTFARKQDMERAVRRMMYLSTGTMTGLAIQFAVNIAFSETEGAR----PLS 120

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGI 327
            N  ++I+ +TDG       +  +     +A+  G +++AIG+
Sbjct: 121 QNVPRVIMIVTDGRPQDPVAEIAA-----KARNSGILIFAIGV 158



 Score = 37.4 bits (85), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 39/183 (21%), Positives = 83/183 (45%), Gaps = 21/183 (11%)

Query: 168 TDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFS 227
           T+  +D++ V+D S+S+       +   ++  + +  +L+ + + P    +   GL+ +S
Sbjct: 572 TEGPVDLVFVIDGSKSL------GVNNFEIVKEFVLGILDSLTISPKAARI---GLLQYS 622

Query: 228 NKIE-EFFLLEWG-VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIF-DMQGMRQHCNTED 284
            ++  EF L ++   + +++ +  +   G  + +   LK    + F + +G R       
Sbjct: 623 TQVRTEFTLKQFSTATDMKKAVSQMKYMGKGSMTGLALKQMTERSFTEAEGARHL----S 678

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNS 344
           A   ++ V  TDG      +D+ S +   +AK+RG  +YAIGI      E     + P  
Sbjct: 679 AKVPRVCVVFTDGR----AQDEVSEWA-AKAKQRGITMYAIGIGKAIEEELREIASDPPE 733

Query: 345 FYL 347
            +L
Sbjct: 734 KHL 736


>gi|118096903|ref|XP_425157.2| PREDICTED: similar to type VII collagen [Gallus gallus]
          Length = 1645

 Score = 38.5 bits (88), Expect = 1.9,   Method: Composition-based stats.
 Identities = 33/119 (27%), Positives = 55/119 (46%), Gaps = 19/119 (15%)

Query: 236 LEWGVSH------LQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
           +E+G S       +Q+ I+ LS  G +T +  GL+Y  +  F    +R           K
Sbjct: 8   VEFGFSQHINGTGIQKAIQQLSYKGGNTRTGAGLRYISDNFFGPTQLR-------PGVPK 60

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP-NSFYL 347
           I + +TDG++    E Q +L      K  G  V+A+GI+     E +R  + P +SF+ 
Sbjct: 61  ICILITDGKSQDDAE-QPAL----RLKSLGIKVFAVGIKNADRQELIRVASLPTDSFFF 114


>gi|221109528|ref|XP_002169888.1| PREDICTED: similar to collagen type VI alpha 6 [Hydra
           magnipapillata]
          Length = 366

 Score = 38.5 bits (88), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 77/167 (46%), Gaps = 24/167 (14%)

Query: 166 SQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVN-NVVQSGLV 224
           S +DA +D+  +LD S S+   +           K++   L+ +    D+  N  Q+G++
Sbjct: 17  SCSDAIVDVGFILDSSGSLRRDY-----------KNLKEFLKTIASFFDIKINGSQAGVI 65

Query: 225 TFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQ-GMRQHCN 281
           TFS++ E    L         ++ +  +   G +T     L+++ N +F  Q G R    
Sbjct: 66  TFSHRSEHSIKLNDFSDGDSFEKAVDKIPLMGSTTRIDKALRHSKNVMFTNQNGGRLEAT 125

Query: 282 TEDANYKKIIVFMTDG-ENLSTKEDQQSLYYCNEAKKRGAIVYAIGI 327
                  K+++ +TDG +  S K++  S+   +E +  G ++ AIGI
Sbjct: 126 -------KLLILLTDGSQTFSAKQEDPSI-IADEIRNDGVLIIAIGI 164


>gi|255526265|ref|ZP_05393182.1| von Willebrand factor type A [Clostridium carboxidivorans P7]
 gi|296186259|ref|ZP_06854663.1| von Willebrand factor type A domain protein [Clostridium
           carboxidivorans P7]
 gi|255510045|gb|EET86368.1| von Willebrand factor type A [Clostridium carboxidivorans P7]
 gi|296049060|gb|EFG88490.1| von Willebrand factor type A domain protein [Clostridium
           carboxidivorans P7]
          Length = 580

 Score = 38.1 bits (87), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 44/172 (25%), Positives = 77/172 (44%), Gaps = 31/172 (18%)

Query: 166 SQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQS--GL 223
           S T + LD++ VLD S SM+      I              E +K+  D++ V  +  GL
Sbjct: 30  SNTSSNLDVVFVLDSSGSMKESDPEEI------------RTEAIKMFLDMSQVQGNKFGL 77

Query: 224 VTFS-NKIEEFFLLEWGVSHLQRKIKYLS---KFGVSTNSTPGLKYAYNQIFDMQGMRQH 279
           V +S N + E  L     +  + +IK ++     G  T++  G+  A N +         
Sbjct: 78  VAYSDNVVREHNLDTINSNDDKERIKNMALNIPLGQKTDTGAGILEAVNLM--------- 128

Query: 280 CNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEA----KKRGAIVYAIGI 327
            +  D N+K +I+ ++DG+N   ++ + SL     +    K +G  VY IG+
Sbjct: 129 NSGHDKNHKPVIILLSDGKNDPQRKTEDSLKDLKSSISTCKDKGYPVYTIGL 180


>gi|319952787|ref|YP_004164054.1| hypothetical protein Celal_1241 [Cellulophaga algicola DSM 14237]
 gi|319421447|gb|ADV48556.1| protein of unknown function DUF58 [Cellulophaga algicola DSM 14237]
          Length = 288

 Score = 38.1 bits (87), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 51/102 (50%), Gaps = 9/102 (8%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
           + +  L MM+V+DVS S    F SS    +  I  I+A L        + N  + GL+ F
Sbjct: 72  EEERELTMMLVVDVSGS--ELFGSSNQFKNEIITEISATL----AFSALQNNDKIGLILF 125

Query: 227 SNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTP---GLKY 265
           S++IE F   + G SH+ R I+ L +F   +N T     LKY
Sbjct: 126 SDQIELFIPPKKGKSHVLRIIRELIEFTPKSNKTDLAVALKY 167


>gi|325286049|ref|YP_004261839.1| hypothetical protein Celly_1140 [Cellulophaga lytica DSM 7489]
 gi|324321503|gb|ADY28968.1| protein of unknown function DUF58 [Cellulophaga lytica DSM 7489]
          Length = 288

 Score = 38.1 bits (87), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 55/105 (52%), Gaps = 9/105 (8%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
           + +  L MM+++DVS S E+F  ++  K D+ I  I+A L        + N  + GL+ F
Sbjct: 72  EEERELTMMLMVDVSGS-ENFGTTNQFKKDI-ITEISATL----AFSALQNNDKVGLILF 125

Query: 227 SNKIEEFFLLEWGVSHLQRKIKYLSKF---GVSTNSTPGLKYAYN 268
           S+++E F   + G SH  R I+ L +F      TN +  LKY  N
Sbjct: 126 SDEVELFIPPKKGKSHALRIIRELLEFTPKSTKTNLSEALKYLTN 170


>gi|297286916|ref|XP_002808380.1| PREDICTED: LOW QUALITY PROTEIN: collagen alpha-5(VI) chain-like
           [Macaca mulatta]
          Length = 2604

 Score = 38.1 bits (87), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 45/199 (22%), Positives = 87/199 (43%), Gaps = 19/199 (9%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ VLD S S++  +   +         IN  +  VK      N VQ G + +S++  
Sbjct: 813 LDVVFVLDHSGSIKKQYQDHM---------INLTIHLVKKADVGRNGVQFGALKYSDQPN 863

Query: 232 EFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
             F L      S +   ++     G ST +   LK+A N +F      +H +    N K+
Sbjct: 864 ILFYLNTYSNRSAIIENLRMRRDTGGSTYTAKALKHA-NALF----TEEHGSRIKENVKQ 918

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVE 349
           +++ +TDG+   + +  Q     +E + +G  + A+G+      E      + N+   V+
Sbjct: 919 MLIVITDGK---SHDHDQLNDTASELRDKGITILAVGVGKANQKELEGMAGNKNNTIYVD 975

Query: 350 NPHSMYDAFSHIGKDIVTK 368
           N   + D F+ + + + T+
Sbjct: 976 NFDKLKDVFTLVQESMCTE 994


>gi|297671961|ref|XP_002814089.1| PREDICTED: collagen alpha-5(VI) chain-like [Pongo abelii]
          Length = 2586

 Score = 38.1 bits (87), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 44/199 (22%), Positives = 88/199 (44%), Gaps = 19/199 (9%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ VLD S S++  +   +         IN  +  VK      N VQ G + +S++  
Sbjct: 813 LDVVFVLDHSGSIKKQYQDHM---------INLTIHLVKKADVGRNRVQFGALKYSDQPN 863

Query: 232 EFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
             F L      S +   ++     G +T +   LK+A N +F      +H +    N K+
Sbjct: 864 ILFYLNTYSNRSAIIENLRMRRDTGGNTYTAKALKHA-NALF----TEKHGSRIKQNVKQ 918

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVE 349
           +++ +TDG+   + +  Q     +E + +G  ++A+G+      E      + N+   V+
Sbjct: 919 VLIVITDGK---SHDHDQLNDTASELRDKGITIFAVGVGKANQKELEGMAGNKNNTIYVD 975

Query: 350 NPHSMYDAFSHIGKDIVTK 368
           N   + D F+ + + + T+
Sbjct: 976 NFDKLKDVFTLVQERMCTE 994


>gi|171742038|ref|ZP_02917845.1| hypothetical protein BIFDEN_01142 [Bifidobacterium dentium ATCC
           27678]
 gi|283456833|ref|YP_003361397.1| hypothetical protein BDP_2000 [Bifidobacterium dentium Bd1]
 gi|171277652|gb|EDT45313.1| hypothetical protein BIFDEN_01142 [Bifidobacterium dentium ATCC
           27678]
 gi|283103467|gb|ADB10573.1| Conserved hypothetical protein containing a von Willebrand factor
           type A (vWA) domain [Bifidobacterium dentium Bd1]
          Length = 967

 Score = 38.1 bits (87), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 67/265 (25%), Positives = 107/265 (40%), Gaps = 46/265 (17%)

Query: 95  RNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHI 154
           +NE +D+   N+ D  VR      + +    G   SA S    P +    I +  N  +I
Sbjct: 172 QNEAKDDETKNNADKTVR------LGIASYRGMLKSASSGLSTP-EHTKSIEYQGNGAYI 224

Query: 155 VM--PITSSVKVNSQTDARLDMMIVLDVSRSMESFFDS--SITKIDMAIKSINAMLEEVK 210
           +    I      ++     +D+ +VLDVS SM   F    S +KI     ++N+ L+E  
Sbjct: 225 LKLNVIGKDASTSTTDTTPIDIALVLDVSGSMNDDFGGRGSPSKISALKTAVNSFLDETA 284

Query: 211 ----LIPDVNNVVQSGLVTFSNKIEEFFLLEW---------GVSHLQRKIKYLS-KFGVS 256
                I D N+ V+  LV ++N+I      +             +  + ++ L+   G+ 
Sbjct: 285 KTNDTIEDDNDKVKVALVKYANQIGTATGADGCRISNSRQSDTGNCTQIVQELTTDAGLL 344

Query: 257 TNSTPGLKYAYNQIFD--MQGMRQHCNTEDANYKKIIVFMTDGE------------NLST 302
             S  GL+ A     D  M+  +Q      A  KK ++F TDGE            N + 
Sbjct: 345 KTSVNGLQAAGATYADAAMEVAQQALAGGRAGAKKYVIFFTDGEPNHWSGFDGDVANAAI 404

Query: 303 KEDQQSLYYCNEAKKRGAIVYAIGI 327
           K+ Q       E K  G  VY+IGI
Sbjct: 405 KKSQ-------ELKNAGTTVYSIGI 422


>gi|260800527|ref|XP_002595180.1| hypothetical protein BRAFLDRAFT_240914 [Branchiostoma floridae]
 gi|229280424|gb|EEN51192.1| hypothetical protein BRAFLDRAFT_240914 [Branchiostoma floridae]
          Length = 419

 Score = 38.1 bits (87), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 55/127 (43%), Gaps = 13/127 (10%)

Query: 219 VQSGLVTFSNKIEEFFLL--EWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGM 276
            Q G++ +SN+ +   LL      + LQ+ I  ++     TN+   L+Y  N  F  +  
Sbjct: 38  TQIGVIQYSNQPQSEILLNDHQDAASLQQAISSINYLQGGTNTGKALRYLANNAFSGK-- 95

Query: 277 RQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFL 336
               N   A   K+ + +TDG     +     +     A K G ++YA+GI     ++ L
Sbjct: 96  ----NGARAGVSKVAIVVTDG-----RSSDDVVRPALNAGKEGIVLYAVGIGGSVDYQEL 146

Query: 337 RACASPN 343
           R  AS +
Sbjct: 147 RDIASSD 153


>gi|163738634|ref|ZP_02146048.1| hypothetical protein RGBS107_11437 [Phaeobacter gallaeciensis
           BS107]
 gi|161387962|gb|EDQ12317.1| hypothetical protein RGBS107_11437 [Phaeobacter gallaeciensis
           BS107]
          Length = 558

 Score = 37.7 bits (86), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 36/73 (49%), Gaps = 2/73 (2%)

Query: 299 NLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSH-EFLRACASPNSFYLVENPHSMYDA 357
           N STK D ++   CN AK +G +VY IG     S    L+ CAS ++ +       + DA
Sbjct: 485 NTSTK-DARTRAVCNAAKNQGIVVYTIGFEAPSSGTAVLKDCASSDAHHFDVRGLEIRDA 543

Query: 358 FSHIGKDIVTKRI 370
           F+ I   I   R+
Sbjct: 544 FASIATSIRQLRL 556


>gi|163742980|ref|ZP_02150363.1| hypothetical protein RG210_01902 [Phaeobacter gallaeciensis 2.10]
 gi|161383663|gb|EDQ08049.1| hypothetical protein RG210_01902 [Phaeobacter gallaeciensis 2.10]
          Length = 560

 Score = 37.7 bits (86), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 36/73 (49%), Gaps = 2/73 (2%)

Query: 299 NLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSH-EFLRACASPNSFYLVENPHSMYDA 357
           N STK D ++   CN AK +G +VY IG     S    L+ CAS ++ +       + DA
Sbjct: 487 NTSTK-DARTRAVCNAAKNQGIVVYTIGFEAPSSGTAVLKDCASSDAHHFDVRGLEIRDA 545

Query: 358 FSHIGKDIVTKRI 370
           F+ I   I   R+
Sbjct: 546 FASIATSIRQLRL 558


>gi|300853770|ref|YP_003778754.1| hypothetical protein CLJU_c05700 [Clostridium ljungdahlii DSM
           13528]
 gi|300433885|gb|ADK13652.1| hypothetical protein CLJU_c05700 [Clostridium ljungdahlii DSM
           13528]
          Length = 484

 Score = 37.7 bits (86), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 77/172 (44%), Gaps = 31/172 (18%)

Query: 166 SQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV--QSGL 223
           S +   +D++ VLD S SM+      I              E +K+  D+  V   ++GL
Sbjct: 30  STSSPNVDVVFVLDSSGSMKQSDPEEI------------RTEAIKMFLDMGQVQGNKAGL 77

Query: 224 VTFSNKI-EEFFLLEWGVSHLQRKIKYLSK---FGVSTNSTPGLKYAYNQIFDMQGMRQH 279
           V +S+ I +E  L        + +I+ ++     G  T+   GL         ++G +  
Sbjct: 78  VAYSDTIIKEHNLDAINSESDKERIEEMASNIPLGQKTDIGRGL---------LEGAKVL 128

Query: 280 CNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEA----KKRGAIVYAIGI 327
            +  D+N + +I+ ++DG+N S +   +SL   N A    K +G  VY IG+
Sbjct: 129 DSGHDSNNRPLIILLSDGKNDSQRSASESLKDLNSAISTCKSKGYPVYTIGL 180


>gi|332232505|ref|XP_003265445.1| PREDICTED: collagen alpha-5(VI) chain [Nomascus leucogenys]
          Length = 2526

 Score = 37.7 bits (86), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 43/199 (21%), Positives = 89/199 (44%), Gaps = 19/199 (9%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ VLD S S++  +   +         IN  +  VK      + VQ G + +S++  
Sbjct: 813 LDVVFVLDHSGSIKKQYQDHM---------INLTIHLVKKADVGRDRVQFGALKYSDQPN 863

Query: 232 EFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
             F L      S +   ++     G +T +   LK+A N +F      +H +  + N K+
Sbjct: 864 ILFYLNTYSNRSAIIENLRMRRDTGGNTYTAKALKHA-NALF----TEEHGSRINQNVKQ 918

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVE 349
           +++ +TDG+   + +  Q     +E + +G  ++A+G+      E      + N+   V+
Sbjct: 919 MLIVITDGK---SHDHDQLNDTASELRDKGITIFAVGVGKANQKELEGMAGNKNNAIYVD 975

Query: 350 NPHSMYDAFSHIGKDIVTK 368
           N   + D F+ + + + T+
Sbjct: 976 NFDKLKDVFTLVQESMCTE 994


>gi|83816834|ref|YP_446668.1| von Willebrand factor type A domain-containing protein
           [Salinibacter ruber DSM 13855]
 gi|83758228|gb|ABC46341.1| von Willebrand factor type A domain protein [Salinibacter ruber DSM
           13855]
          Length = 289

 Score = 37.7 bits (86), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 72/158 (45%), Gaps = 23/158 (14%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           +D+M+VLD S SM++  D   T+ + A ++  A +E       V++ V  GL+ F+ +  
Sbjct: 51  IDIMMVLDASTSMQA-EDFQPTRFEAAREAAGAFVEG-----RVSDRV--GLIVFAAEAY 102

Query: 232 EFFLLEWGVSHLQRKIKYLSKFGVSTNSTPG--LKYAYNQIFDMQGMRQHCNTEDANYKK 289
               L    S LQR ++ +    V   +  G  L  A N++ D +              K
Sbjct: 103 TQAPLTLDYSFLQRMLEDVEVGAVEDGTAVGTALATAVNRLKDSEA-----------ESK 151

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGI 327
           + + +TDG N   + D ++      A+  G  VYAIG+
Sbjct: 152 VAILLTDGRNNRGQIDPRTA--AEVARTMGVRVYAIGV 187


>gi|20089145|ref|NP_615220.1| hypothetical protein MA0247 [Methanosarcina acetivorans C2A]
 gi|19914014|gb|AAM03700.1| hypothetical protein (multi-domain) [Methanosarcina acetivorans
           C2A]
          Length = 589

 Score = 37.7 bits (86), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 47/202 (23%), Positives = 85/202 (42%), Gaps = 26/202 (12%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           +D++  +D S SM+S   S + K   A KS    ++  +          +G+V++ + I+
Sbjct: 81  MDVVFAIDSSGSMQSNDPSGLRK--TAAKSFVDKMDSSRDT--------AGVVSWDDSID 130

Query: 232 EFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKII 291
               L      ++  I  +   G STN   GL+ A + I D        N    N  ++I
Sbjct: 131 FSLPLTNDFPLVKTNIDSVDSSG-STNLNVGLEEAID-ILD-------ANPRTENSVEVI 181

Query: 292 VFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR-ACASPNSFYLVEN 350
           +F+TDG+        Q      EA  +G ++Y+IG+  +        A  +  ++Y   +
Sbjct: 182 IFLTDGQGTYLHSTAQ------EAADKGYVIYSIGLGGVNPTPLQDMATTTGGAYYSSPD 235

Query: 351 PHSMYDAFSHIGKDIVTKRIWY 372
             S+   F  I  ++ T  I Y
Sbjct: 236 ATSLQAIFDDIFSEVTTSTIPY 257


>gi|295132196|ref|YP_003582872.1| hypothetical protein ZPR_0316 [Zunongwangia profunda SM-A87]
 gi|294980211|gb|ADF50676.1| conserved hypothetical protein [Zunongwangia profunda SM-A87]
          Length = 288

 Score = 37.7 bits (86), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 49/105 (46%), Gaps = 9/105 (8%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
           + +  L MM+V+DVS S   FF +        I  I A L          N  + GL+ F
Sbjct: 72  EEERELTMMLVVDVSGS--EFFGTQSQFKKEVITEIAATL----AFSATQNNDKIGLLMF 125

Query: 227 SNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTP---GLKYAYN 268
           S++IE +   + G SH+ R I+ L +F   +  T    GLKY  N
Sbjct: 126 SDQIENYIPPKKGKSHVLRIIRELLEFQPKSKKTDIGLGLKYLSN 170


>gi|315499132|ref|YP_004087936.1| von willebrand factor type a [Asticcacaulis excentricus CB 48]
 gi|315417144|gb|ADU13785.1| von Willebrand factor type A [Asticcacaulis excentricus CB 48]
          Length = 519

 Score = 37.4 bits (85), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 69/170 (40%), Gaps = 15/170 (8%)

Query: 208 EVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKF--GVSTNSTPGLKY 265
           +V + P   +VV S  +  S        +    S       YLS    G +TN T G+++
Sbjct: 346 DVSVAPYATDVVDSNYIAASCSTTALAKVLDLTSDFTSVNTYLSSLSPGGNTNITLGVQF 405

Query: 266 AYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKE-------DQQSLYYCNEAKKR 318
               +   +   +     D + KK ++ +TDG N   +        + ++   C  AK +
Sbjct: 406 GMEMLSPAEPYTKATAFGDTDVKKYMIIVTDGANTQNRWSTSNSAINARTALACTAAKAQ 465

Query: 319 GAIVYAIGIRVIRSHEFLRACASPNSFY-----LVENPHSMYDAFSHIGK 363
           G  ++ + +    S   L ACAS +S+Y       +   +M D F+ I K
Sbjct: 466 GITLFVVRVEDGDS-SLLEACASQSSYYYDLSQASDLTKTMQDIFATINK 514


>gi|313219850|emb|CBY30766.1| unnamed protein product [Oikopleura dioica]
          Length = 1473

 Score = 37.4 bits (85), Expect = 3.7,   Method: Composition-based stats.
 Identities = 52/187 (27%), Positives = 81/187 (43%), Gaps = 29/187 (15%)

Query: 165  NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
            N+    RLD+ IV+D S S+     +S    D  + +    L  +    D  N V+ GL 
Sbjct: 1234 NTTISGRLDIQIVIDTSGSL-----TSAPNKDQVLMNFTNNLANMY---DTINQVKIGLT 1285

Query: 225  TFS-NKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
            +FS + + E  L  +    LQ  +  ++  G  TN T G++ A N   DM       +T 
Sbjct: 1286 SFSESSVLEMPLDFYNQLELQDGVSNMTWQGSFTNITSGVETALN---DM-------DTS 1335

Query: 284  DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPN 343
            DA    +++ +TDG    +          ++AK  G  + A+G       EF  A  SPN
Sbjct: 1336 DA-VDDVMILITDG--FQSTNTTLMFQMIDQAKAEGVRLIALGF----FGEF--AFYSPN 1386

Query: 344  SFYLVEN 350
              YL+ N
Sbjct: 1387 -LYLMTN 1392


>gi|281340555|gb|EFB16139.1| hypothetical protein PANDA_003424 [Ailuropoda melanoleuca]
          Length = 191

 Score = 37.4 bits (85), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 47/98 (47%), Gaps = 14/98 (14%)

Query: 256 STNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK---IIVFMTDGENLSTKEDQQSLYYC 312
           +T+   GL+ A  QI            E+A  KK   +I+ +TDG  L    ++  +   
Sbjct: 74  ATHMQEGLRKANEQI----------EQENAGEKKAPIVILALTDGTLLPFPFEETKME-A 122

Query: 313 NEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVEN 350
            E+++ GA VY IG++  R  + L    SP+  + V+N
Sbjct: 123 EESRRLGATVYCIGVKDYRKDQLLDIADSPDHMFGVDN 160


>gi|294508603|ref|YP_003572662.1| von Willebrand factor type A domain protein [Salinibacter ruber M8]
 gi|294344932|emb|CBH25710.1| von Willebrand factor type A domain protein [Salinibacter ruber M8]
          Length = 317

 Score = 37.4 bits (85), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 72/158 (45%), Gaps = 23/158 (14%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           +D+M+VLD S SM++  D   T+ + A ++  A +E       V++ V  GL+ F+ +  
Sbjct: 79  IDIMMVLDASTSMQA-EDFQPTRFEAAREAAGAFVEG-----RVSDRV--GLIVFAAEAY 130

Query: 232 EFFLLEWGVSHLQRKIKYLSKFGVSTNSTPG--LKYAYNQIFDMQGMRQHCNTEDANYKK 289
               L    S LQR ++ +    V   +  G  L  A N++ D +              K
Sbjct: 131 TQAPLTLDYSFLQRMLEDVEVGAVEDGTAVGTALATAVNRLKDSEA-----------ESK 179

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGI 327
           + + +TDG N   + D ++      A+  G  VYAIG+
Sbjct: 180 VAILLTDGRNNRGQIDPRTA--AEVAQTMGVRVYAIGV 215


>gi|290979997|ref|XP_002672719.1| predicted protein [Naegleria gruberi]
 gi|284086298|gb|EFC39975.1| predicted protein [Naegleria gruberi]
          Length = 859

 Score = 37.0 bits (84), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 45/94 (47%), Gaps = 12/94 (12%)

Query: 251 SKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLY 310
           SK G+ST+ TP + Y +  + D     +HC       K+ ++F+    N S K ++  L 
Sbjct: 597 SKTGISTSQTPKISYLHLLLDDFDP--KHCYFTAEQMKESVLFI----NQSLKNNENILI 650

Query: 311 YCNEAKKRGAIVYA------IGIRVIRSHEFLRA 338
           +C E + R   +        IG ++  S EF+R+
Sbjct: 651 HCQEGRSRSVTIICLYMMINIGWKLSYSLEFMRS 684


>gi|145299821|ref|YP_001142662.1| flp pilus assembly protein FlpL [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|88866595|gb|ABD57363.1| FlpL [Aeromonas salmonicida subsp. salmonicida A449]
 gi|142852593|gb|ABO90914.1| putative flp pilus assembly protein FlpL [Aeromonas salmonicida
           subsp. salmonicida A449]
          Length = 460

 Score = 37.0 bits (84), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 51/119 (42%), Gaps = 17/119 (14%)

Query: 241 SHLQRKIKYLSKF-----GVSTNSTPGLKYAYNQIFDM-QGMRQHCNTE------DANYK 288
           +HL  + +Y           +TN+  G+ + +  +    QG       E       A+ +
Sbjct: 316 AHLSTRAEYRQALDTLYAAFNTNTAEGVMWGWRLLSPQWQGRWGQGAAELPRPYGQADNR 375

Query: 289 KIIVFMTDGENLSTK---EDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNS 344
           KI+V  +DGE++  +    D++ L  C E K++G  VY +         F+  CAS  S
Sbjct: 376 KIMVLFSDGEHMGPEAALRDRKQLLLCREMKRKGIQVYTVAFE--GDARFVAQCASDRS 432


>gi|226315301|ref|YP_002775197.1| hypothetical protein BBR47_57160 [Brevibacillus brevis NBRC 100599]
 gi|226098251|dbj|BAH46693.1| hypothetical protein [Brevibacillus brevis NBRC 100599]
          Length = 597

 Score = 37.0 bits (84), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 73/171 (42%), Gaps = 37/171 (21%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQS--GLVTFSNK 229
           +D ++V+DVS SM     + ++             E +K+  D+ ++  +  G+V +++K
Sbjct: 39  MDAVLVVDVSNSMTQSDKNKVSN------------EAMKMFVDMTSIQANKVGVVAYTDK 86

Query: 230 IE-EFFLLEWGVSHLQRKIKY----LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
           IE E  LLE      +  IK     L K G  T+   G+  A  +I D           +
Sbjct: 87  IEREKALLEINSEEDKNDIKAFIDSLQK-GAYTDIAVGVTEAV-KILDA--------GRN 136

Query: 285 ANYKKIIVFMTDGENL--------STKEDQQSLYYCNEAKKRGAIVYAIGI 327
            N   IIV + DG N           K DQ+      EAK +G  VY IG+
Sbjct: 137 PNNAPIIVLLADGNNFLNKASSRTQAKSDQELQQAVKEAKDKGYPVYTIGL 187


>gi|330995096|ref|ZP_08319013.1| von Willebrand factor type A domain protein [Paraprevotella
           xylaniphila YIT 11841]
 gi|332879554|ref|ZP_08447249.1| von Willebrand factor type A domain protein [Capnocytophaga sp.
           oral taxon 329 str. F0087]
 gi|329576672|gb|EGG58175.1| von Willebrand factor type A domain protein [Paraprevotella
           xylaniphila YIT 11841]
 gi|332682520|gb|EGJ55422.1| von Willebrand factor type A domain protein [Capnocytophaga sp.
           oral taxon 329 str. F0087]
          Length = 289

 Score = 37.0 bits (84), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 50/94 (53%), Gaps = 6/94 (6%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
           + +  L +M+V+DVS S+ SF   S TK +M +  I A L        + N  + G++ F
Sbjct: 72  EEERELTVMLVIDVSGSL-SFGTVSQTKREM-VAEIAATL----AFSAIQNNDKIGVIFF 125

Query: 227 SNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNST 260
           S++IE+F   + G  H+ R I+ L  F   + ST
Sbjct: 126 SDRIEKFIPPKKGRKHILRIIRELLDFTPQSKST 159


>gi|303235711|ref|ZP_07322318.1| von Willebrand factor type A domain protein [Prevotella disiens
           FB035-09AN]
 gi|302484158|gb|EFL47146.1| von Willebrand factor type A domain protein [Prevotella disiens
           FB035-09AN]
          Length = 341

 Score = 36.6 bits (83), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 4/52 (7%)

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGI 327
           + +H  +E AN+ K I+ +TDGEN     ++ +     EA+K+G  V+ +GI
Sbjct: 178 LSEHSFSEKANFGKAIIIITDGENHEKGAEEMA----REAQKQGIRVFILGI 225


>gi|119599630|gb|EAW79224.1| hypothetical protein FLJ35880 [Homo sapiens]
          Length = 2531

 Score = 36.6 bits (83), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 88/199 (44%), Gaps = 19/199 (9%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ VLD S S++  +   +         IN  +  VK      + VQ G + +S++  
Sbjct: 758 LDVVFVLDHSGSIKKQYQDHM---------INLTIHLVKKADVGRDRVQFGALKYSDQPN 808

Query: 232 EFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
             F L      S +   ++     G +T +   LK+A N +F      +H +    N K+
Sbjct: 809 ILFYLNTYSNRSAIIENLRKRRDTGGNTYTAKALKHA-NALF----TEEHGSRIKQNVKQ 863

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVE 349
           +++ +TDGE  S   DQ +     E + +G  ++A+G+      E      + N+   V+
Sbjct: 864 MLIVITDGE--SHDHDQLNDTAL-ELRNKGITIFAVGVGKANQKELEGMAGNKNNTIYVD 920

Query: 350 NPHSMYDAFSHIGKDIVTK 368
           N   + D F+ + + + T+
Sbjct: 921 NFDKLKDVFTLVQERMCTE 939


>gi|147921050|ref|YP_685140.1| hypothetical protein RCIX370 [uncultured methanogenic archaeon RC-I]
 gi|110620536|emb|CAJ35814.1| hypothetical protein RCIX370 [uncultured methanogenic archaeon RC-I]
          Length = 1310

 Score = 36.6 bits (83), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 40/78 (51%), Gaps = 3/78 (3%)

Query: 288  KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYL 347
            K+ I+ +TDG +   + D   L   ++AK +G  ++ IG+ +       +  + P  +Y 
Sbjct: 988  KQYIIVLTDGYSQYPEFD---LIEADKAKAKGYTIFTIGMGMADEDTLKKIASKPEYYYR 1044

Query: 348  VENPHSMYDAFSHIGKDI 365
            V +P  +  A+  IG++I
Sbjct: 1045 VLSPEQLEAAYYDIGQEI 1062


>gi|332817900|ref|XP_526306.3| PREDICTED: collagen alpha-5(VI) chain isoform 2 [Pan troglodytes]
          Length = 2526

 Score = 36.6 bits (83), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 88/199 (44%), Gaps = 19/199 (9%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ VLD S S++  +   +         IN  +  VK      + VQ G + +S++  
Sbjct: 813 LDVVFVLDHSGSIKKQYQDHM---------INLTIHLVKKADVGRDRVQFGALKYSDQPN 863

Query: 232 EFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
             F L      S +   ++     G +T +   LK+A N +F      +H +    N K+
Sbjct: 864 ILFYLNTYSNRSAIIENLRKRRDTGGNTYTAKALKHA-NALF----TEEHGSRIKQNVKQ 918

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVE 349
           +++ +TDGE  S   DQ +     E + +G  ++A+G+      E      + N+   V+
Sbjct: 919 MLIVITDGE--SHDHDQLNDTAL-ELRNKGITIFAVGVGKANQKELEGMAGNKNNTIYVD 975

Query: 350 NPHSMYDAFSHIGKDIVTK 368
           N   + D F+ + + + T+
Sbjct: 976 NFDKLKDVFTLVQERMCTE 994


>gi|183583553|ref|NP_694996.5| collagen alpha-5(VI) chain [Homo sapiens]
          Length = 2526

 Score = 36.6 bits (83), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 88/199 (44%), Gaps = 19/199 (9%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ VLD S S++  +   +         IN  +  VK      + VQ G + +S++  
Sbjct: 813 LDVVFVLDHSGSIKKQYQDHM---------INLTIHLVKKADVGRDRVQFGALKYSDQPN 863

Query: 232 EFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
             F L      S +   ++     G +T +   LK+A N +F      +H +    N K+
Sbjct: 864 ILFYLNTYSNRSAIIENLRKRRDTGGNTYTAKALKHA-NALF----TEEHGSRIKQNVKQ 918

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVE 349
           +++ +TDGE  S   DQ +     E + +G  ++A+G+      E      + N+   V+
Sbjct: 919 MLIVITDGE--SHDHDQLNDTAL-ELRNKGITIFAVGVGKANQKELEGMAGNKNNTIYVD 975

Query: 350 NPHSMYDAFSHIGKDIVTK 368
           N   + D F+ + + + T+
Sbjct: 976 NFDKLKDVFTLVQERMCTE 994


>gi|189082691|sp|A8TX70|CO6A5_HUMAN RecName: Full=Collagen alpha-5(VI) chain; AltName: Full=Collagen
           alpha-1(XXIX) chain; AltName: Full=von Willebrand factor
           A domain-containing protein 4; Flags: Precursor
 gi|158828630|gb|ABW81241.1| collagen XXIX alpha 1 [Homo sapiens]
          Length = 2615

 Score = 36.6 bits (83), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 88/199 (44%), Gaps = 19/199 (9%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ VLD S S++  +   +         IN  +  VK      + VQ G + +S++  
Sbjct: 813 LDVVFVLDHSGSIKKQYQDHM---------INLTIHLVKKADVGRDRVQFGALKYSDQPN 863

Query: 232 EFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
             F L      S +   ++     G +T +   LK+A N +F      +H +    N K+
Sbjct: 864 ILFYLNTYSNRSAIIENLRKRRDTGGNTYTAKALKHA-NALF----TEEHGSRIKQNVKQ 918

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVE 349
           +++ +TDGE  S   DQ +     E + +G  ++A+G+      E      + N+   V+
Sbjct: 919 MLIVITDGE--SHDHDQLNDTAL-ELRNKGITIFAVGVGKANQKELEGMAGNKNNTIYVD 975

Query: 350 NPHSMYDAFSHIGKDIVTK 368
           N   + D F+ + + + T+
Sbjct: 976 NFDKLKDVFTLVQERMCTE 994


>gi|332817898|ref|XP_003310056.1| PREDICTED: collagen alpha-5(VI) chain isoform 1 [Pan troglodytes]
          Length = 2615

 Score = 36.6 bits (83), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 88/199 (44%), Gaps = 19/199 (9%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ VLD S S++  +   +         IN  +  VK      + VQ G + +S++  
Sbjct: 813 LDVVFVLDHSGSIKKQYQDHM---------INLTIHLVKKADVGRDRVQFGALKYSDQPN 863

Query: 232 EFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
             F L      S +   ++     G +T +   LK+A N +F      +H +    N K+
Sbjct: 864 ILFYLNTYSNRSAIIENLRKRRDTGGNTYTAKALKHA-NALF----TEEHGSRIKQNVKQ 918

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVE 349
           +++ +TDGE  S   DQ +     E + +G  ++A+G+      E      + N+   V+
Sbjct: 919 MLIVITDGE--SHDHDQLNDTAL-ELRNKGITIFAVGVGKANQKELEGMAGNKNNTIYVD 975

Query: 350 NPHSMYDAFSHIGKDIVTK 368
           N   + D F+ + + + T+
Sbjct: 976 NFDKLKDVFTLVQERMCTE 994


>gi|83951473|ref|ZP_00960205.1| hypothetical protein ISM_12960 [Roseovarius nubinhibens ISM]
 gi|83836479|gb|EAP75776.1| hypothetical protein ISM_12960 [Roseovarius nubinhibens ISM]
          Length = 550

 Score = 36.6 bits (83), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 3/62 (4%)

Query: 312 CNEAKKRGAIVYAIGIRVIR---SHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTK 368
           C   K  G +V++IG  + +   + + L+ CAS  + Y      ++ DAFS I  ++V  
Sbjct: 487 CTATKNEGVVVFSIGFEIDQGGTAEQVLKNCASSENHYFRAEGININDAFSAIASNVVNL 546

Query: 369 RI 370
           R+
Sbjct: 547 RL 548


>gi|225028486|ref|ZP_03717678.1| hypothetical protein EUBHAL_02763 [Eubacterium hallii DSM 3353]
 gi|224954191|gb|EEG35400.1| hypothetical protein EUBHAL_02763 [Eubacterium hallii DSM 3353]
          Length = 538

 Score = 36.6 bits (83), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 71/159 (44%), Gaps = 23/159 (14%)

Query: 168 TDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFS 227
           T  + D+++ LD+S SM+        K   A K ++++L +   I         GLV++S
Sbjct: 221 TSKKRDIVLTLDISASMDGIPLDETKK--AAAKFVDSILNKNSNI---------GLVSYS 269

Query: 228 NKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287
           ++      +      L+  I  LS    +TN   GL  AY+ +   Q             
Sbjct: 270 DEATSLSGICSNDVFLKNTITSLSS-AENTNIEDGLSRAYSMLQLGQSK----------- 317

Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIG 326
           KK+IV M+DG     K+ ++ + Y  + K +G ++Y +G
Sbjct: 318 KKLIVLMSDGLPTLGKDGEELIKYAEKIKDQGVLIYTLG 356


>gi|149632101|ref|XP_001514410.1| PREDICTED: hypothetical protein [Ornithorhynchus anatinus]
          Length = 2392

 Score = 36.6 bits (83), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 83/197 (42%), Gaps = 21/197 (10%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ V+D S S+    DS+   I  A      M++ VK      N VQ G + +S+  E
Sbjct: 806 LDIVFVIDSSGSI----DSNEYNIMKAF-----MIDLVKKADVGKNQVQFGALKYSDFPE 856

Query: 232 EFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
             F L      S +   I+     G ST +   L ++ +   +  G R H         +
Sbjct: 857 VLFNLNEFSSKSEIISFIQNDHPRGGSTYTAKALAHSAHLFSESLGSRMH-----RGVPQ 911

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEA-KKRGAIVYAIGIRVIRSHEFLRACASPNSFYLV 348
           +++ +TDGE+     D   L     A + +G +V A+GI      E L    S + ++ V
Sbjct: 912 VLIVITDGES----HDAHLLNATARALRDKGILVLAVGIEGANHEELLSMAGSTDRYFFV 967

Query: 349 ENPHSMYDAFSHIGKDI 365
           EN   +   F ++   +
Sbjct: 968 ENFEGLKGIFENVSASV 984


>gi|222529355|ref|YP_002573237.1| von Willebrand factor type A [Caldicellulosiruptor bescii DSM 6725]
 gi|222456202|gb|ACM60464.1| von Willebrand factor type A [Caldicellulosiruptor bescii DSM 6725]
          Length = 1188

 Score = 36.2 bits (82), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 58/242 (23%), Positives = 101/242 (41%), Gaps = 40/242 (16%)

Query: 141 FCTFIPWYTNSRHIV--MPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMA 198
           F TF+ +Y  +   +  +PI    +  +Q    +D++ VLD S SM S+ D +  +   A
Sbjct: 465 FTTFVLFYIPTWKAIWEVPINKGEREINQQVNYIDLVFVLDSSGSM-SWNDPNGYRKIAA 523

Query: 199 IKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTN 258
              ++A+++  +          + +V F N       L      ++  I  +  +G  TN
Sbjct: 524 KSFVDALIQGDR----------AAVVDFDNFGYLLQPLTTDFQAVKNAIDRIDSWG-GTN 572

Query: 259 STPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCN----E 314
              G++ A  Q+          ++ED    K+I+ +TDGE           YY N    E
Sbjct: 573 IAEGIRIANQQLISR-------SSEDR--IKVIILLTDGEG----------YYDNNLTTE 613

Query: 315 AKKRGAIVYAIGIRVIRSHEFLRACASPNS--FYLVENPHSMYDAFSHIGKDIVTKRIWY 372
           AK  G  +Y IG+        LR  A+     ++ V +   +   F  I  +IVT+ I  
Sbjct: 614 AKNNGITIYTIGLGTSVDENLLRDIATQTGGMYFPVSSASQLPQVFKRI-TEIVTEPIDT 672

Query: 373 DK 374
           D+
Sbjct: 673 DE 674


>gi|297462925|ref|XP_608567.5| PREDICTED: collagen type VI alpha 6-like [Bos taurus]
          Length = 2343

 Score = 36.2 bits (82), Expect = 7.6,   Method: Composition-based stats.
 Identities = 49/236 (20%), Positives = 96/236 (40%), Gaps = 44/236 (18%)

Query: 144  FIPWYTNSRHIVMPITSSVKVNSQTDA---RLDMMIVLDVS--------RSMESFFDSSI 192
            F+  +   + I   +++SV  +S+ D    ++D++ ++D S        R M+ F  S I
Sbjct: 964  FVETFGGLKGIFSDVSASVCNSSKVDCEIEKVDLVFLMDGSNSIHPDDFRKMKEFLASVI 1023

Query: 193  TKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYL 250
               D++                 NN V+ G   FS+  +  F L    G   +  +I+ +
Sbjct: 1024 QDFDIS-----------------NNRVRIGAAQFSHTYQPEFPLGMFIGKEEISFQIENI 1066

Query: 251  SKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLY 310
             +    T+    L+   +      G R H  T      ++++ +TDG+  S  E  Q+  
Sbjct: 1067 KQIFGYTHIGAALRQVGHYFRPDMGSRIHAGT-----PQVLLVLTDGQ--SQDEVAQA-- 1117

Query: 311  YCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIV 366
               E + +G  +Y++GI  +   + ++   + N    V N    +D    + K IV
Sbjct: 1118 -AEELRHKGIDIYSVGIGDVDDQQLVQITGTANKKLTVHN----FDELKKVKKRIV 1168


>gi|297471452|ref|XP_002685218.1| PREDICTED: collagen, type VI, alpha 1-like [Bos taurus]
 gi|296490817|gb|DAA32930.1| collagen, type VI, alpha 1-like [Bos taurus]
          Length = 2268

 Score = 36.2 bits (82), Expect = 7.6,   Method: Composition-based stats.
 Identities = 49/236 (20%), Positives = 96/236 (40%), Gaps = 44/236 (18%)

Query: 144  FIPWYTNSRHIVMPITSSVKVNSQTDA---RLDMMIVLDVS--------RSMESFFDSSI 192
            F+  +   + I   +++SV  +S+ D    ++D++ ++D S        R M+ F  S I
Sbjct: 964  FVETFGGLKGIFSDVSASVCNSSKVDCEIEKVDLVFLMDGSNSIHPDDFRKMKEFLASVI 1023

Query: 193  TKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYL 250
               D++                 NN V+ G   FS+  +  F L    G   +  +I+ +
Sbjct: 1024 QDFDIS-----------------NNRVRIGAAQFSHTYQPEFPLGMFIGKEEISFQIENI 1066

Query: 251  SKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLY 310
             +    T+    L+   +      G R H  T      ++++ +TDG+  S  E  Q+  
Sbjct: 1067 KQIFGYTHIGAALRQVGHYFRPDMGSRIHAGT-----PQVLLVLTDGQ--SQDEVAQA-- 1117

Query: 311  YCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIV 366
               E + +G  +Y++GI  +   + ++   + N    V N    +D    + K IV
Sbjct: 1118 -AEELRHKGIDIYSVGIGDVDDQQLVQITGTANKKLTVHN----FDELKKVKKRIV 1168


>gi|149026142|gb|EDL82385.1| rCG29121 [Rattus norvegicus]
          Length = 905

 Score = 36.2 bits (82), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 54/193 (27%), Positives = 83/193 (43%), Gaps = 27/193 (13%)

Query: 174 MMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN-KIEE 232
           + +VLD S SM S     IT++ +  ++      E+ LI  +      GLVTF +  I +
Sbjct: 309 VCLVLDKSGSMSS--GDPITRLTLMNQAA-----ELYLIQILEKESLVGLVTFDSIAIVQ 361

Query: 233 FFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKI 290
             L+      S+L+   K   +    T+   GL+  +  I      +  C +E       
Sbjct: 362 NNLIRMINDSSYLEISAKLPQEAAGGTSICNGLRKGFETITSSD--QSTCGSE------- 412

Query: 291 IVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVY--AIGIRVIRSHEFLRACASPNSFYLV 348
           IV +TDGE+     DQ S  +  E K  GA+++  A+G    R  E L        FY  
Sbjct: 413 IVLLTDGED-----DQISSCF-EEVKHSGAVIHTIALGPDAARELETLSDMTGGRRFYAS 466

Query: 349 ENPHSMYDAFSHI 361
           E  + + DAFS I
Sbjct: 467 EGINGLIDAFSGI 479


>gi|296228122|ref|XP_002759734.1| PREDICTED: collagen alpha-4(VI) chain-like [Callithrix jacchus]
          Length = 2348

 Score = 36.2 bits (82), Expect = 8.0,   Method: Composition-based stats.
 Identities = 47/200 (23%), Positives = 89/200 (44%), Gaps = 35/200 (17%)

Query: 171  RLDMMIVLDVSRSM--ESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
            + D+  ++D S S+  E+F D  +         +N +++  ++ PD    VQ G++ +S+
Sbjct: 841  KADIYFLIDGSGSIYPEAFLDMKVF--------MNEVIKMFQIGPDR---VQFGVIQYSD 889

Query: 229  KIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
            +I+  F+L     V+ L+  I  + + G  T +   L     Q+F         +T   N
Sbjct: 890  EIKSKFVLSQYPTVAELKVAIDNIQQGGGGTTTGEALN-NMTQVF--------ADTARIN 940

Query: 287  YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFY 346
              + ++ +TDG++     D          +  G I+YAIG+R     E L+  A    F+
Sbjct: 941  VARYLIVITDGKSSDPVADA-----AEGLRASGVIIYAIGVREANIDE-LKEIAKDKIFF 994

Query: 347  LVENPHSMYDAFSHIGKDIV 366
            + E     +D    I K++V
Sbjct: 995  VYE-----FDLLKDIQKEVV 1009


>gi|116487355|ref|NP_001070824.1| chloride channel calcium activated 4-like [Rattus norvegicus]
 gi|116013527|dbj|BAF34587.1| calcium-activated chloride channel [Rattus norvegicus]
          Length = 905

 Score = 36.2 bits (82), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 54/193 (27%), Positives = 83/193 (43%), Gaps = 27/193 (13%)

Query: 174 MMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN-KIEE 232
           + +VLD S SM S     IT++ +  ++      E+ LI  +      GLVTF +  I +
Sbjct: 309 VCLVLDKSGSMSS--GDPITRLTLMNQAA-----ELYLIQILEKESLVGLVTFDSIAIVQ 361

Query: 233 FFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKI 290
             L+      S+L+   K   +    T+   GL+  +  I      +  C +E       
Sbjct: 362 NNLIRMINDSSYLEISAKLPQEAAGGTSICNGLRKGFETITSSD--QSTCGSE------- 412

Query: 291 IVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVY--AIGIRVIRSHEFLRACASPNSFYLV 348
           IV +TDGE+     DQ S  +  E K  GA+++  A+G    R  E L        FY  
Sbjct: 413 IVLLTDGED-----DQISSCF-EEVKHSGAVIHTIALGPDAARELETLSDMTGGRRFYAS 466

Query: 349 ENPHSMYDAFSHI 361
           E  + + DAFS I
Sbjct: 467 EGINGLIDAFSGI 479


>gi|45361321|ref|NP_989238.1| matrilin 2 [Xenopus (Silurana) tropicalis]
 gi|39645939|gb|AAH63920.1| matrilin 2 [Xenopus (Silurana) tropicalis]
          Length = 839

 Score = 36.2 bits (82), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 38/184 (20%), Positives = 87/184 (47%), Gaps = 23/184 (12%)

Query: 169 DARLDMMIVLDVSRSM-ESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFS 227
           +  +D++ V+D S+S+ E+ F+       +  + +N +L+ +++     +V   GL+ +S
Sbjct: 567 EGPVDLVFVIDGSKSLGENNFE-------IVKQFVNGILDSLEISQKAAHV---GLIQYS 616

Query: 228 NKIE-EFFLLEWGVSH-LQRKIKYLSKFGVSTNSTPGLKYAYNQIF-DMQGMRQHCNTED 284
             I  EF + ++  +  +++ +  +   G  + +   LK  + + F ++QG R       
Sbjct: 617 THIRTEFTMAQYSSAKDVKKAVSQIKYMGRGSMTGLALKLMHEKSFSEVQGAR----PRA 672

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNS 344
               ++ +  TDG      +D+ S Y   +AK+ G  +YAIG+      E     ++P  
Sbjct: 673 MGVPRVAIVFTDGR----AQDEVSEYA-KKAKQSGITIYAIGVGKAIDEELQEIASAPQE 727

Query: 345 FYLV 348
            +++
Sbjct: 728 KHVI 731


Searching..................................................done


Results from round 2




>gi|254780934|ref|YP_003065347.1| hypothetical protein CLIBASIA_04165 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040611|gb|ACT57407.1| hypothetical protein CLIBASIA_04165 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 374

 Score =  448 bits (1151), Expect = e-123,   Method: Composition-based stats.
 Identities = 374/374 (100%), Positives = 374/374 (100%)

Query: 1   MFSLNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVH 60
           MFSLNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVH
Sbjct: 1   MFSLNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVH 60

Query: 61  AATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVV 120
           AATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVV
Sbjct: 61  AATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVV 120

Query: 121 VPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDV 180
           VPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDV
Sbjct: 121 VPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDV 180

Query: 181 SRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGV 240
           SRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGV
Sbjct: 181 SRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGV 240

Query: 241 SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENL 300
           SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENL
Sbjct: 241 SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENL 300

Query: 301 STKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSH 360
           STKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSH
Sbjct: 301 STKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSH 360

Query: 361 IGKDIVTKRIWYDK 374
           IGKDIVTKRIWYDK
Sbjct: 361 IGKDIVTKRIWYDK 374


>gi|254780833|ref|YP_003065246.1| hypothetical protein CLIBASIA_03630 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040510|gb|ACT57306.1| hypothetical protein CLIBASIA_03630 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 371

 Score =  384 bits (987), Expect = e-104,   Method: Composition-based stats.
 Identities = 203/370 (54%), Positives = 273/370 (73%), Gaps = 3/370 (0%)

Query: 6   LNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQI 65
           LNIRNFFYN KG ++ILTAI LP+IF+V+G++IE SH FF+K  LH ++D SL++ AT+I
Sbjct: 4   LNIRNFFYNCKGSISILTAILLPVIFIVMGLVIETSHKFFVKAKLHYILDHSLLYTATKI 63

Query: 66  MNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNE 125
           +N+ NGNN KK K       IKN W   FRNELR+NGF  DI++I RSTSL I++  Q++
Sbjct: 64  LNQENGNNGKKQKNDFSYRIIKNIWQTDFRNELRENGFAQDINNIERSTSLSIIIDDQHK 123

Query: 126 GYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSME 185
            Y++SA+SRY++P  FCTF PW  NS H  + ITSSVK++S++D  LDMM+VLDVS SM 
Sbjct: 124 DYNLSAVSRYEMPFIFCTF-PWCANSSHAPLLITSSVKISSKSDIGLDMMMVLDVSLSMN 182

Query: 186 SFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQR 245
             F   + K+ +A +SI  ML+ +K IPDVNNVV+SGLVTFS+KI + F L WGV H+Q 
Sbjct: 183 DHFGPGMDKLGVATRSIREMLDIIKSIPDVNNVVRSGLVTFSSKIVQTFPLAWGVQHIQE 242

Query: 246 KIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTK-E 304
           KI  L  FG +T STPGL+YAYN+IFD +   +H      +YKK I+F+TDGEN S   +
Sbjct: 243 KINRLI-FGSTTKSTPGLEYAYNKIFDAKEKLEHIAKGHDDYKKYIIFLTDGENSSPNID 301

Query: 305 DQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKD 364
           +++SL+YCNEAK+RGAIVYAIG++   + +FL+ CASP+ FY V+N   ++DAF  IGK+
Sbjct: 302 NKESLFYCNEAKRRGAIVYAIGVQAEAADQFLKNCASPDRFYSVQNSRKLHDAFLRIGKE 361

Query: 365 IVTKRIWYDK 374
           +V +RI Y+K
Sbjct: 362 MVKQRILYNK 371


>gi|315122347|ref|YP_004062836.1| hypothetical protein CKC_02995 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495749|gb|ADR52348.1| hypothetical protein CKC_02995 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 362

 Score =  287 bits (734), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 114/366 (31%), Positives = 211/366 (57%), Gaps = 19/366 (5%)

Query: 6   LNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQI 65
           + IRNFF N +G +TI +AI  P+I +++ ++ E+S+I+  K  L ++IDR+L+   T I
Sbjct: 4   IKIRNFFQNKRGIITITSAIIFPLIIILMAIVFEMSNIYLEKERLQAVIDRALLDTVTMI 63

Query: 66  MNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNE 125
             +   +  K       +  +   W  + + EL  + F +D+ +++  TS+ +      +
Sbjct: 64  KLKNIEDVVKN------VGPVNTIWTKNLKYELEHSDFSSDVQNVIDDTSMKLESDSNFK 117

Query: 126 GYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSME 185
             SI+AIS+YK+P K C        ++++ +P+ SS+K+     + +D+MIVLDVS SM+
Sbjct: 118 TLSITAISQYKMPFKICNIHLLCPKNKYVTVPVLSSMKIGRNEGSDIDLMIVLDVSSSMD 177

Query: 186 SFF----DSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVS 241
             F    ++  +++++A KSI  MLE+ + +P+  NV ++G V F++ ++    L+ G+ 
Sbjct: 178 DNFMKPEEAPCSRLEVAKKSIRKMLEDFRKVPNYANVFRTGSVGFNDMVQFPMPLKRGLK 237

Query: 242 HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLS 301
            +   IK    FG STNS  G+KYA+ Q++      +       + KKI++F+TDGEN+ 
Sbjct: 238 RIYNDIKKYRAFG-STNSYVGMKYAWEQLYGNPQDTK-------DRKKIVIFLTDGENMI 289

Query: 302 TKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHI 361
               ++++  CN+ KK+ A++Y+I + V  + E L+ C+S  + Y  ++  S+  A+S I
Sbjct: 290 INATRKTIELCNDMKKKKAVIYSIALAV-DNKEVLQGCSSSGNVYAADDAQSLVQAYSLI 348

Query: 362 GKDIVT 367
           GKD++ 
Sbjct: 349 GKDVMK 354


>gi|163760496|ref|ZP_02167578.1| hypothetical protein HPDFL43_04296 [Hoeflea phototrophica DFL-43]
 gi|162282447|gb|EDQ32736.1| hypothetical protein HPDFL43_04296 [Hoeflea phototrophica DFL-43]
          Length = 363

 Score =  286 bits (732), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 72/359 (20%), Positives = 144/359 (40%), Gaps = 19/359 (5%)

Query: 7   NIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIM 66
            IR    N  G   ++ A  +P++F+   + ++ ++   MK  L + +D + +  A ++ 
Sbjct: 9   KIRKLLRNENGNFALIAAAAVPVLFMAGSLAVDTTNAMSMKVRLQNAVDSAALATAARLS 68

Query: 67  NEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGF-VNDIDDIVRSTSLDIVVVPQNE 125
            E N                   + + F N      F   +   +  + ++D V   +  
Sbjct: 69  EEENLT-----------AAQAQAFALKFVNGQVKEDFGAFNGFSVTPTVNIDPV---ETG 114

Query: 126 GYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSME 185
           G ++  ++      +  T +        + + +    +   +      M +VLD S SM+
Sbjct: 115 GRTVWKVAVSMEGSQSLTPMARIMGKDKLTVSVVGKSESAGEAQGAFSMALVLDRSGSMD 174

Query: 186 SFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQR 245
              +    KI++   ++  ++E+ +        V+ G  ++++K+     L W     + 
Sbjct: 175 WNLNGQ-KKINVLKTAVGGLIEQFEEADPERKYVRLGASSYNSKLTGSTKLRWNPGKTKE 233

Query: 246 KIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKED 305
            +  L   G  T+ST    +AY  +   +    H        KK IVFMTDG+N  +  D
Sbjct: 234 FVDALPASG-GTDSTDAFDWAYTAVTHKRENNTHDAKSGQVPKKFIVFMTDGDNNYSSAD 292

Query: 306 QQSLYYCNEAKKRGAIVYAIGIRVI-RSHEFLRACAS-PNSFYLVENPHSMYDAFSHIG 362
             + + C++AK  G  VY +      R  + L  CAS    F+  +N   + +AF +IG
Sbjct: 293 SSTKHLCDDAKDDGIEVYTVAFAAPNRGKQLLSYCASTEEHFFDAQNSAQLIEAFKNIG 351


>gi|190893432|ref|YP_001979974.1| hypothetical protein RHECIAT_CH0003859 [Rhizobium etli CIAT 652]
 gi|190698711|gb|ACE92796.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 410

 Score =  283 bits (723), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 83/412 (20%), Positives = 139/412 (33%), Gaps = 66/412 (16%)

Query: 8   IRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMN 67
           +R  F +  G   I+TAI  P++    GM I+V  +   K  L                +
Sbjct: 10  LRRMFSDRGGNFGIMTAILAPVLLGAAGMAIQVGDMLISKQQLQEAA------------D 57

Query: 68  EGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVV--VPQNE 125
                    L  G I       +  +F      N ++    DI  +T + +       + 
Sbjct: 58  SAALATATALANGTIQTSQAEAFARNFVAGQMAN-YLQSGVDIKSATGVTVQTNTSGNST 116

Query: 126 GYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSM- 184
            Y ++    Y + +        +T ++H+    T+ +  +SQT   + M + LD S SM 
Sbjct: 117 SYQVTVSPSYDLTVNPLMQAVGFT-TQHLSTSGTT-IGGHSQTQGSISMYLALDKSGSMG 174

Query: 185 ---------------------------ESFFDSSI-------TKIDMAIKSINAMLEEVK 210
                                      +  +D+         TKI+    +   +  ++ 
Sbjct: 175 EDTATVNEEDPTESYTYDCNGHYNKKGKWIYDTCTGSRANYYTKIEALKMAAGNLFGQLS 234

Query: 211 LIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQI 270
                   V++G V++         L WG S +   +  L   G  TNS+  +  AY+ +
Sbjct: 235 SADPNAQYVRTGAVSYDIVQYTPSALAWGTSGVSTYVNALQA-GGGTNSSGAMSTAYSSL 293

Query: 271 FDMQ------GMRQHCNTEDANYKKIIVFMTDGENLSTKE-----DQQSLYYCNEAKKRG 319
                         H        KK IVFMTDG+N          D  +   C+ AK +G
Sbjct: 294 TAKNAAGNDAEDAAHKLKTGQTPKKYIVFMTDGDNNDDSSGGRSYDTLTKATCDTAKSKG 353

Query: 320 AIVYAIGIRVIR-SHEFLRACASPNSFYL-VENPHSMYDAFSHIGKDIVTKR 369
             +Y I           L  CAS +S Y   E    +  AF  IG    ++ 
Sbjct: 354 IEIYTIAFMAPEGGQALLHYCASDDSHYFQAEKMEDLLAAFKAIGAKASSQL 405


>gi|150397936|ref|YP_001328403.1| von Willebrand factor type A [Sinorhizobium medicae WSM419]
 gi|150029451|gb|ABR61568.1| von Willebrand factor type A [Sinorhizobium medicae WSM419]
          Length = 419

 Score =  282 bits (720), Expect = 7e-74,   Method: Composition-based stats.
 Identities = 81/405 (20%), Positives = 158/405 (39%), Gaps = 50/405 (12%)

Query: 5   NLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQ 64
            L+      +  G   ++TA+  P++  V G+ ++V+++   K  L    D + + AA+ 
Sbjct: 8   GLSFMRMLRDRGGNFGMMTALVAPLLLAVGGVSVDVANMLMTKNQLQDATDAAALAAASA 67

Query: 65  IMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFV-------NDIDDI------- 110
           ++++   +   +         +K     +  ++L D G         N  D++       
Sbjct: 68  LVSDARPD--IEEAKDLARKFLKTQAAAATASDLPDEGPSIGARGGGNADDEVPATPRWE 125

Query: 111 -VRSTSLDIVVVPQN-EGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQT 168
            V +T +DI   P   +G S       K  L+F   +        I +   S+ +  +++
Sbjct: 126 DVNATEIDITATPNGAKGKSFQVTVANKHLLQF-NAMTRLLGPESIEIETRSTAESATES 184

Query: 169 DARLDMMIVLDVSRSMESFFD----------------------------SSITKIDMAIK 200
              L M +VLD S SM    +                              +TKID    
Sbjct: 185 KNALSMYLVLDRSGSMAWKTNTINTGKAKCPNYTEANWSKYPDLKATGPCYVTKIDALKT 244

Query: 201 SINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNST 260
           ++  +L ++      +  V++G +++++  +    L WG       +  L   G  T S 
Sbjct: 245 AVGDLLAQLVTADPESAYVRTGAISYNSAQDAASSLSWGTRGAAGYVDALVAIG-GTASG 303

Query: 261 PGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGA 320
              K A+ ++ +     +H         K IVFMTDGEN    +D  +  +C+ AK    
Sbjct: 304 NAFKTAFQKVTNAAEDSEHGAKNGQVPTKYIVFMTDGENNHANDDTVTRQWCDTAKASKV 363

Query: 321 IVYAIGIRVI-RSHEFLRACA-SPNSFYLVENPHSMYDAFSHIGK 363
            +Y++      R  + L++CA S + ++  E    +  AF  IG+
Sbjct: 364 QIYSVAFMAPDRGQKLLKSCASSSSHYFEAEEASDLVAAFKAIGE 408


>gi|307945905|ref|ZP_07661241.1| putative von Willebrand factor type A [Roseibium sp. TrichSKD4]
 gi|307771778|gb|EFO31003.1| putative von Willebrand factor type A [Roseibium sp. TrichSKD4]
          Length = 432

 Score =  282 bits (720), Expect = 8e-74,   Method: Composition-based stats.
 Identities = 68/365 (18%), Positives = 137/365 (37%), Gaps = 13/365 (3%)

Query: 7   NIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIM 66
            I N      G +  L  I + ++  V+ + I++S  F  +T L +  D + V     ++
Sbjct: 70  GIPNAHKERDGSILPLFGILIMLLLAVVTIGIDMSQTFGERTRLQTAADMAAVQTGRALL 129

Query: 67  NEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEG 126
            E     +      D   RI +   +S   +      +     +  +  +   V      
Sbjct: 130 AEEITIAQANAYAKDAFNRIAS--GLSASGDGSSGTSIFGTMTVKPAVQITETVDGNTTN 187

Query: 127 YSISAISRYKIPLKFCTFI--PWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSM 184
           Y +      KIP    +F+     T    I +   S     ++  A L M +VLD S SM
Sbjct: 188 YVVKVNGTAKIPASPLSFMFFDGETGKNTISLGFESETTAKAEAGASLSMALVLDRSGSM 247

Query: 185 ESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQ 244
                S +++     K++ ++++E++ +   +   + G   +         L W  + ++
Sbjct: 248 GWERPSRMSE---LKKAVRSLIKELQTVDPDDQFTRLGAYAYHWYYAGKKELTWNKNSVR 304

Query: 245 RKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKE 304
             +  L   G  T + P ++ A N +     +  H N  +      I++MTDG +     
Sbjct: 305 SWVNSLPASG-GTRAAPAIQKAKNDLLTNSELNAHINKNEQEPDLFILYMTDGIDGDPNW 363

Query: 305 DQQSLYYCNEAKKRGAIVYAIGIRVI-RSHEFLRACASPN-SFYLVENPHSMYDAFSHIG 362
              +   C  AK  G  +Y +  +        L+ACA+ +  +Y  +N + +   F  I 
Sbjct: 364 ---AKRECTSAKNAGITIYTVAFKAPASGRNLLKACATSDAHYYDAKNANELNKVFKDIA 420

Query: 363 KDIVT 367
           ++   
Sbjct: 421 RETTK 425


>gi|241206334|ref|YP_002977430.1| hypothetical protein Rleg_3648 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860224|gb|ACS57891.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 400

 Score =  280 bits (715), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 87/400 (21%), Positives = 155/400 (38%), Gaps = 55/400 (13%)

Query: 8   IRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMN 67
           +R    +  G   I+TAI LP++F   GM I+V  +   K  L                +
Sbjct: 11  LRRMLGDRGGNFGIMTAIVLPVLFGAAGMAIQVGDLLLSKQQLQEAA------------D 58

Query: 68  EGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDI--VVVPQNE 125
                    L  G I       +   F      N ++    DI  +T +D+      ++ 
Sbjct: 59  SAALATATALANGTIQTSQAEAFARDFVAGQMAN-YLQSGIDIKSTTGVDVRTTTSGKST 117

Query: 126 GYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSM- 184
            Y ++    Y I +        +T     +   +++   NSQT   + M +VLD S SM 
Sbjct: 118 SYQVTVSPDYNIAVNPLMQTIGFTTQN--ISTSSTTTSGNSQTQGSVSMFLVLDRSGSMG 175

Query: 185 -------------ESFFDSS---------------------ITKIDMAIKSINAMLEEVK 210
                        E  +D S                      TKI+    ++  +  E+ 
Sbjct: 176 EDTATVNASDPTEEYNYDCSEKDRYGNVTKKKTCTDTRPHYYTKIEALKLAVGTLTGELD 235

Query: 211 LIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQI 270
            +      V++G V+++ ++++   L+WG +H+ + +  L+     T+S    K AYN++
Sbjct: 236 AVDPEKEYVRTGAVSYNIEMQKAKALDWGTAHVTKYVNKLTAT-DGTDSGEAFKTAYNKL 294

Query: 271 FDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI 330
            D    + H +       K IVFMTDG+N  T  D ++  +C++A+     VY I     
Sbjct: 295 ADAAEDKAHVDKTGQVPTKYIVFMTDGDNNYTSADTETKTWCDKARDAKMQVYTIAFMAP 354

Query: 331 -RSHEFLRACAS-PNSFYLVENPHSMYDAFSHIGKDIVTK 368
            R    L  CA+ P +++   +  ++  AF  IG     +
Sbjct: 355 ARGQALLSYCATAPGNYFPAGDMTALLKAFKEIGMKASNQ 394


>gi|254781110|ref|YP_003065523.1| von Willebrand factor type A [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040787|gb|ACT57583.1| von Willebrand factor type A [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 420

 Score =  278 bits (711), Expect = 9e-73,   Method: Composition-based stats.
 Identities = 84/405 (20%), Positives = 168/405 (41%), Gaps = 45/405 (11%)

Query: 8   IRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMN 67
            +    + K   +I+ A+ +    L++G +I V    + K  + S  + +++  A+++++
Sbjct: 11  FKKGIASEKANFSIIFALSVMSFLLLIGFLIYVLDWHYKKNSMESANNAAILAGASKMVS 70

Query: 68  ---------EGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVN-DIDDIVRSTSLD 117
                    E   N+ K+    D    IKN    S         F N +I +IV S+ + 
Sbjct: 71  NLSRLGDRFESISNHAKRALIDDAKRFIKNHIKESLSG--YSAVFYNTEIQNIVNSSRIS 128

Query: 118 IVVVPQNE--------GYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTD 169
           +  +  N          Y++  ++ Y   L+F   +     ++ IV  I + +++     
Sbjct: 129 MTHMANNRLDSSNNTIFYNMDVMTSYDYRLQFIEHLLNQRYNQKIVSFIPALLRIEMGER 188

Query: 170 ARLDMMIVLDVSRSMESFFDSSI--------------TKIDMAIKSINAMLEEVKLIPDV 215
               + +V+D+S SM    +S                TK+     ++   L+ + L+  V
Sbjct: 189 PIFLIELVVDLSGSMHCAMNSDPEDVNSAPICQDKKRTKMAALKNALLLFLDSIDLLSHV 248

Query: 216 NNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYL--SKFGVSTNSTPGLKYAYNQIFD- 272
              V  GL+ ++ ++E+     WG   +++ +     S     T+STP +K AY  +   
Sbjct: 249 KEDVYMGLIGYTTRVEKNIEPSWGTEKVRQYVTRDMDSLILKPTDSTPAMKQAYQILTSD 308

Query: 273 ------MQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIG 326
                     RQ        ++K I+F+TDGEN + K +  ++  C++AK+    +  I 
Sbjct: 309 KKRSFFTNFFRQGVKIPSLPFQKFIIFLTDGENNNFKSNVNTIKICDKAKENFIKIVTIS 368

Query: 327 IRV-IRSHEFLRAC-ASPNSFYLVENPHSMYDAFSHIGKDIVTKR 369
           I         L+ C +SP   Y V N  S+   F +I + +V ++
Sbjct: 369 INASPNGQRLLKTCVSSPEYHYNVVNADSLIHVFQNISQLMVHRK 413


>gi|86359182|ref|YP_471074.1| hypothetical protein RHE_CH03592 [Rhizobium etli CFN 42]
 gi|86283284|gb|ABC92347.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 411

 Score =  278 bits (710), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 83/413 (20%), Positives = 143/413 (34%), Gaps = 67/413 (16%)

Query: 8   IRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMN 67
           +R  F +  G   I+TAI  P++    GM I+V  +   K  L                +
Sbjct: 10  LRRMFSDRGGNFGIMTAILAPVLLGAAGMAIQVGDMLLSKQQLQEAA------------D 57

Query: 68  EGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDI--VVVPQNE 125
                    L  G I       +  +F      N ++    DI  +TS+++      ++ 
Sbjct: 58  SAALATATALANGTIQTTEAEAFARNFVAGQMAN-YLQSGTDIKSTTSVNVQTTTSGKST 116

Query: 126 GYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSME 185
            Y ++    Y + +        +T ++H+    T+ +  +SQT   + M + LD S SM 
Sbjct: 117 SYQVTVSPAYVLTVNPLMQAVGFT-TQHLSTSGTT-IGGHSQTQGSISMFLALDKSGSMG 174

Query: 186 S--------------FFDSSI----------------------TKIDMAIKSINAMLEEV 209
                           +D ++                      TKI+    +   +  ++
Sbjct: 175 EDTATVNEESPTESYTYDCNLHYNTKNNKWVYDKCTGSRTNYYTKIEALKMAAGNLFSQL 234

Query: 210 KLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQ 269
                    V++G V++         L WG++ +   +  L   G  TNS+  +  AY  
Sbjct: 235 NSADPNAQYVRTGAVSYDINQYAPSSLAWGITGVSSYVNALQANG-GTNSSGAMNTAYTS 293

Query: 270 IFDMQ------GMRQHCNTEDANYKKIIVFMTDGENLSTKE-----DQQSLYYCNEAKKR 318
           +              H        KK IVFMTDG+N +        D  +   C++AK +
Sbjct: 294 LTAKNAAGNDVENSAHQQKTGQVPKKYIVFMTDGDNNNDPSGGRSYDTATKKTCDDAKSK 353

Query: 319 GAIVYAIGIRVIR-SHEFLRACASPNSFYL-VENPHSMYDAFSHIGKDIVTKR 369
           G  +Y I           L  CAS +S Y   E    +  AF  IG     + 
Sbjct: 354 GIEIYTIAFMAPAGGQALLHYCASDDSHYFQAEKMEDLLAAFQAIGAKASAQL 406


>gi|327189644|gb|EGE56794.1| hypothetical protein RHECNPAF_570041 [Rhizobium etli CNPAF512]
          Length = 415

 Score =  278 bits (710), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 80/416 (19%), Positives = 140/416 (33%), Gaps = 69/416 (16%)

Query: 8   IRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMN 67
           +R  F +  G   I+TAI  P++    G+ I+V  +   K  L                +
Sbjct: 10  LRRMFSDRGGNFGIMTAILAPVLLGAAGLAIQVGDMLLSKQQLQEAA------------D 57

Query: 68  EGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVV--PQNE 125
                    L  G I       +  +F      N   N + DI  +T++++      ++ 
Sbjct: 58  SAALATATALGNGTIQTSQAEAFARNFVAGQMANYLQNGV-DIKNATAVNVQTSNSGKSA 116

Query: 126 GYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITS----SVKVNSQTDARLDMMIVLDVS 181
            Y ++    Y + +        + +++H+    T+    S    S +   + M + LD S
Sbjct: 117 SYQVTVTPSYDLTVNPLMQAVGF-STQHLSTSSTTVSGPSQTPGSNSQGSVSMFLALDKS 175

Query: 182 RSM----------------------------ESFFDSSI-------TKIDMAIKSINAML 206
            SM                            +  +D+         TKI+    +   + 
Sbjct: 176 GSMGDPTETVNKDQPTETFTYDCNPHLNKKGKWVYDTCTGSRTNYYTKIEALKMAAGNLF 235

Query: 207 EEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYA 266
            ++         V++G V++         L WG S +   +  L   G  TNS+  +  A
Sbjct: 236 GQLTSADPDAQYVRTGAVSYDIDQYTPSTLAWGTSGVSSYVNALQA-GGGTNSSGAMGTA 294

Query: 267 YNQIFDMQ------GMRQHCNTEDANYKKIIVFMTDGENLSTKE-----DQQSLYYCNEA 315
           Y+ +              H        KK IVFMTDG+N +        D  +   C+ A
Sbjct: 295 YSSLTAKNAAGNDAEDAAHKLKTGQIPKKYIVFMTDGDNNNDSSGGRSYDTLTKATCDTA 354

Query: 316 KKRGAIVYAIGIRV-IRSHEFLRACASPNSFYL-VENPHSMYDAFSHIGKDIVTKR 369
           K +G  +Y I           L+ CAS  + Y   E    +  AF  IG     + 
Sbjct: 355 KSKGIEIYTIAFMAPPGGQALLQYCASDAAHYFQAEQMEDLLAAFKAIGAKASAQL 410


>gi|209550922|ref|YP_002282839.1| von Willebrand factor type A [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209536678|gb|ACI56613.1| von Willebrand factor type A [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 411

 Score =  274 bits (700), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 83/412 (20%), Positives = 139/412 (33%), Gaps = 67/412 (16%)

Query: 8   IRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMN 67
           +R  F +  G   I+TAI  P++  V G+ I+V  +   K  L                +
Sbjct: 10  LRRMFSDRGGNFGIMTAIMAPVLLGVAGVAIQVGDMMLSKQQLQEAA------------D 57

Query: 68  EGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDI--VVVPQNE 125
                    L  G I       +  +F      N +V    D    TS+++      ++ 
Sbjct: 58  SAALATATALANGTIQTSQAEAFAQNFVAGQMAN-YVQSGVDFKSGTSVNVQTSTSGKST 116

Query: 126 GYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSME 185
            Y ++    Y + +        +  ++H+    T+ V  +SQT   + M + LD S SM 
Sbjct: 117 SYQVTVSPSYDLTVNPLMQAVGF-KTQHLSTSGTT-VGGHSQTQGSISMFLALDKSGSMG 174

Query: 186 S--------------FFDSSI----------------------TKIDMAIKSINAMLEEV 209
                           +D ++                      TKI+    +   +  ++
Sbjct: 175 EATATVNADDPTESYTYDCNLHYNSKNNKWVYDKCTGSRTNYYTKIEALKIAAGNLFGQL 234

Query: 210 KLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQ 269
                    V++G V++         L WG + +   +  L   G  TNS+  +  AY+ 
Sbjct: 235 NSADPNAEYVRTGAVSYDINQYTPSNLAWGTAGVTSYVNALQANG-GTNSSGAMSTAYSS 293

Query: 270 IFDMQ------GMRQHCNTEDANYKKIIVFMTDGENLSTKE-----DQQSLYYCNEAKKR 318
           +              H        KK IVFMTDG+N          D  +   C+ AK +
Sbjct: 294 LTAKNAAGNDAEDSAHKLKTGQTPKKYIVFMTDGDNNDDSSGGRSYDTLTKATCDTAKSK 353

Query: 319 GAIVYAIGIRVIR-SHEFLRACASPNSFYL-VENPHSMYDAFSHIGKDIVTK 368
           G  +Y I           L  CAS +S Y   E    +  AF  IG     +
Sbjct: 354 GIEIYTIAFMAPAGGQTLLHYCASDDSHYFQAEKMEDLLAAFKAIGAKASAQ 405


>gi|315122479|ref|YP_004062968.1| von Willebrand factor type A [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495881|gb|ADR52480.1| von Willebrand factor type A [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 427

 Score =  256 bits (654), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 84/416 (20%), Positives = 165/416 (39%), Gaps = 57/416 (13%)

Query: 8   IRNFFYNYK-------GGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVH 60
           +R F +N+K          +IL ++ L  I L +G++I V   +  K  + +    +++ 
Sbjct: 4   LRTFLFNFKKIILSPKANFSILFSVILISILLFIGILIYVLDYYHKKNAMENANTSAILS 63

Query: 61  AATQIMNEGN--GNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDD---IVRSTS 115
            A++I++  +  G+N        I+  +        +  L  +  V DI +   I +++ 
Sbjct: 64  GASKIISRISYFGDNMSSHTHRAIVDDVTRFIKSYIKESLLMDSSVFDISEKNIISQNSK 123

Query: 116 LDIVVVP----------------QNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPIT 159
           + I   P                +   Y IS  + Y   +KF   +     +  I+  + 
Sbjct: 124 VSITREPHPNVFHEFNNQSILQNKKTFYHISVETFYDYHIKFFDNLLNKKINSKIISFVP 183

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSI---------------TKIDMAIKSINA 204
           + VK+++       + +V+D+S SM    +S                 +K+D   K++  
Sbjct: 184 ALVKIDTGEHPFFFVQLVVDLSASMSCLMNSDPEHATEFSVCGKSKKNSKMDALKKAVLL 243

Query: 205 MLEEVKLI-PDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKY---LSKFGVSTNST 260
            L+ V        +    GL  ++ ++E+     WG   +++ I     ++  G  T+ST
Sbjct: 244 FLDSVDRGSKTQKDTHYIGLTGYTTRVEKNIEPSWGTGKVRKYIVEEIDVNMLGQ-TDST 302

Query: 261 PGLKYAYNQIFDMQGMR-------QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCN 313
           P +K AY  +   +          +        ++K ++F+TDGEN   K D +++  C 
Sbjct: 303 PAMKKAYQILTSDKKRNFIRNILHKRIKIPPLPFQKFLIFLTDGENNDPKSDVKTIKICE 362

Query: 314 EAKKRGAIVYAIGIRV-IRSHEFLRACAS-PNSFYLVENPHSMYDAFSHIGKDIVT 367
           +AKK    +  I I         L+ C S P  +Y V +  S+   F  I   I  
Sbjct: 363 KAKKNSIKILTISINASANGKRLLKKCVSAPEYYYNVVDTGSLLRVFQDISTLITH 418


>gi|315122473|ref|YP_004062962.1| von Willebrand factor type A [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495875|gb|ADR52474.1| von Willebrand factor type A [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 403

 Score =  249 bits (635), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 76/401 (18%), Positives = 161/401 (40%), Gaps = 60/401 (14%)

Query: 11  FFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGN 70
           F  N  G   I++A  + +  + +  +I+++H+  MK  + S +D +++   + ++++  
Sbjct: 16  FSKNKSGVFHIMSASIIFVCLIFVSFVIDITHLLHMKNHIQSSLDNAIISGCSIVVSDPK 75

Query: 71  GNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSIS 130
            N+              N      R+ ++ N +VN + +     +  I+   +N   S S
Sbjct: 76  INDL-------------NPQEERIRDVIKKNAYVNMVQNFPAEHAAYII---ENANISFS 119

Query: 131 AISRYKIPLKFCTFIPWYTNSRHIVM------------PITSSVKVNSQTDARLDMMIVL 178
                K   K         + ++ ++             I++ +           + +VL
Sbjct: 120 KDLTNKYEYKITMEAKHQLSGKNFILGFLMPNVITHISSISTGIIQKPSDKKAFSVEMVL 179

Query: 179 DVSRSM--------------------ESFFDSSITKIDMAIKS----INAMLEEVKLIPD 214
           D S SM                        +   +KI     +    +N + E V+  P 
Sbjct: 180 DCSGSMLDSMQESCDLSSGRGGYYFYSKNNNKPKSKIYALKTASSDFVNLIQETVQTFPQ 239

Query: 215 VNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM- 273
           ++   + GL+TF++ I +   L    + +++ I  +   G  T++   +  AY  + ++ 
Sbjct: 240 IS--ARIGLITFNHYIMQDSKLSNNFNVIKKTISRMKPKG-GTDTFLPMNAAYEYLNNIP 296

Query: 274 QGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR-- 331
              + H  +++   K+ I+ MTDGEN     D +++  C+ A+K G I+Y+I +      
Sbjct: 297 NETKAHNISDNVPLKRYIILMTDGENNHPSYDLKTINVCDNARKNGIIIYSIFLNYYEYT 356

Query: 332 -SHEFLRACASPN-SFYLVENPHSMYDAFSHIGKDIVTKRI 370
             +E  R CAS    F+   N  ++ D+F  I   I  K +
Sbjct: 357 DGYELARKCASSEKHFFYANNTKALLDSFKSIAHAIQDKAV 397


>gi|15891094|ref|NP_356766.1| hypothetical protein Atu3868 [Agrobacterium tumefaciens str. C58]
 gi|15159433|gb|AAK89551.1| hypothetical protein Atu3868 [Agrobacterium tumefaciens str. C58]
          Length = 412

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 73/405 (18%), Positives = 152/405 (37%), Gaps = 62/405 (15%)

Query: 9   RNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQI-MN 67
           R F  +  G   ++TAI LP++  V G  +E++++  +K  + +  D + + AAT+  + 
Sbjct: 11  RRFLADTSGNFGMMTAILLPVLLGVAGAGMELANVMQVKADMQNTADSAALAAATEARLR 70

Query: 68  EGNGNNR--KKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNE 125
           EG  ++   K++    I  +++       + EL  N            T +      + +
Sbjct: 71  EGKLSDEQIKEIAKNFIAAQMEKNLTAEEKIELEKNSP----------TRVTTTENARGK 120

Query: 126 GYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSME 185
            Y++    +++I L     +  +  ++ + + +T + K      A + M + LD S SM 
Sbjct: 121 TYAVETTIKHQIQLNP---MLGFIGAKTLDLSVTGTAKSTINKGAPISMYLALDRSGSMS 177

Query: 186 ----------------------------SFFDSSITKIDMAIKSINAMLEEVKLIPDV-- 215
                                             + K      ++  ++  +        
Sbjct: 178 FKTDTVDTTKTSCQNYTSDNWSKYPNLAKTSPCYVNKAASLKTAVGFLVATLNKADPTYT 237

Query: 216 ----NNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKF--GVSTNSTPGLKYAYNQ 269
               + +V++G   ++++      + WG S +   +           T++   L  AYN 
Sbjct: 238 VNGGSELVRTGASVYTHETYVAQSIGWGTSGVTSYVDKQIPEFPSGGTDARSSLNAAYNA 297

Query: 270 I--FDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKE------DQQSLYYCNEAKKRGAI 321
           +   +    R H      ++++ IV MTDGE            DQ     C  AKK G  
Sbjct: 298 LKKANPDEARYHKEKGSESFERYIVLMTDGEMTGNSAAWNSSIDQSVRTTCETAKKDGIK 357

Query: 322 VYAIGIRVI-RSHEFLRACASP-NSFYLVENPHSMYDAFSHIGKD 364
           ++++      +    L+ CAS  +++Y  EN   +  AF  I + 
Sbjct: 358 IFSVAFMAPDKGKSLLQYCASSADNYYAPENMEQIVTAFGEIARK 402


>gi|15966595|ref|NP_386948.1| hypothetical protein SMc04059 [Sinorhizobium meliloti 1021]
 gi|307300370|ref|ZP_07580150.1| TadE family protein [Sinorhizobium meliloti BL225C]
 gi|307319653|ref|ZP_07599079.1| TadE family protein [Sinorhizobium meliloti AK83]
 gi|15075867|emb|CAC47421.1| Hypothetical protein SMc04059 [Sinorhizobium meliloti 1021]
 gi|306894775|gb|EFN25535.1| TadE family protein [Sinorhizobium meliloti AK83]
 gi|306904536|gb|EFN35120.1| TadE family protein [Sinorhizobium meliloti BL225C]
          Length = 410

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 76/400 (19%), Positives = 152/400 (38%), Gaps = 48/400 (12%)

Query: 11  FFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNE-- 68
              +  G   ++TA+  P++  V G+ ++V+++   K  L    D + + AA+ ++++  
Sbjct: 3   MLRDRGGNFGMMTALIAPLLLAVGGVSVDVANMLMTKNQLQDATDAAALAAASALVSDAR 62

Query: 69  GNGNNRKKLKGGDILCRIKNTWNMSFRNE----LRDNGFVNDIDDIVRSTSLDIVVVPQ- 123
            +    K +    +  ++  T +     E    +   G      D V ++ + IV  P  
Sbjct: 63  PDIEEAKAIARKFLKTQMAATSSADVPGEAVGTMAAAGSTAPSWDDVNTSEVVIVETPNG 122

Query: 124 NEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRS 183
            +G S       K  L+F   +        I +   S+    +++   + M +VLD S S
Sbjct: 123 TKGKSFQVSVANKHLLQF-NAMTRLLGKESIELETRSTADSATESKNAISMYLVLDRSGS 181

Query: 184 MESFFD---------------------------SSITKIDMAIKSINAMLEEVKLIPDVN 216
           M    D                             + KI     +++ +   +  +   N
Sbjct: 182 MAWKTDTVDTSRPRCINWTASNWGESNVRATSPCYVDKITTLKSAVDKLFTPLAKMDPGN 241

Query: 217 NVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGM 276
             +++G  +++++ +    L WG  +    ++ L   G  T+S+     A  ++      
Sbjct: 242 EYLRAGAASYNDRQDRASKLTWGTKNASAHVQGLDATG-GTDSSSAFAAAVEELLLDGEN 300

Query: 277 RQHCNTEDANYKKIIVFMTDGENLS----------TKEDQQSLYYCNEAKKRGAIVYAIG 326
             H        +K IVFMTDGEN S           K D  +   C  AK  G  ++ + 
Sbjct: 301 EAHLAKNGQTPEKYIVFMTDGENTSYNGKTSPRDLEKADSVTKAACTTAKNNGIAIFTVA 360

Query: 327 IRVI-RSHEFLRACA-SPNSFYLVENPHSMYDAFSHIGKD 364
                R  + L+ACA SP+ +   ++  ++   F  IG+ 
Sbjct: 361 FMAPQRGKDLLKACATSPDHYKEADDAAALVSEFEKIGQK 400


>gi|332716587|ref|YP_004444053.1| hypothetical protein AGROH133_12352 [Agrobacterium sp. H13-3]
 gi|325063272|gb|ADY66962.1| hypothetical protein AGROH133_12352 [Agrobacterium sp. H13-3]
          Length = 412

 Score =  246 bits (629), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 75/405 (18%), Positives = 152/405 (37%), Gaps = 62/405 (15%)

Query: 9   RNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQI-MN 67
           R F  +  G   ++TAI LP++    G  +E++++  +K  L +  D + + AAT+  + 
Sbjct: 11  RRFLADTGGNFGMMTAILLPVLLGFAGAGMELANVMQVKADLQNTADSAALAAATEARLK 70

Query: 68  EGNGNNR--KKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNE 125
           EG   +   K++    I  +++ T     +  L  N  VN          +      + +
Sbjct: 71  EGALTDEQIKEIAKAFIASQMEKTLTEEEKKALEKNSPVN----------IGTTDDARGK 120

Query: 126 GYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSME 185
            Y+I     Y++ L        +  ++ + +  T +        A + M +VLD S SM 
Sbjct: 121 TYTIQTTINYQMQLNPL---LGFFGAKTLDLAATGTAVSTVNKGAPISMYLVLDRSGSMS 177

Query: 186 SFFD----------------------------SSITKIDMAIKSINAMLEEVKLIPDV-- 215
              D                              + K      ++  ++  +        
Sbjct: 178 FKTDTLNTKKTSCQNYTVDNWGSYPNLKNTSPCYVNKATSLKTAVGYLVATLNKADPTYT 237

Query: 216 ----NNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKF--GVSTNSTPGLKYAYNQ 269
               + +V++G   ++++      + WG S +   +           T++   L  AYN 
Sbjct: 238 ANGGSELVRTGASVYTHETYAAQPITWGTSSVATYVDKQIPEFPSGGTDARSSLNAAYNA 297

Query: 270 IFDMQ--GMRQHCNTEDANYKKIIVFMTDGENLSTKE------DQQSLYYCNEAKKRGAI 321
           +        ++H + +  ++++ IV MTDGE            DQ     C+ AKK G  
Sbjct: 298 LKKANTVEAKEHKDKKSESFERYIVLMTDGEMTGNSSSWSSSIDQTVRNTCDTAKKDGIK 357

Query: 322 VYAIGIRVI-RSHEFLRACASP-NSFYLVENPHSMYDAFSHIGKD 364
           ++++      +    L+ CAS  +++Y  EN   +  AF  I + 
Sbjct: 358 IFSVAFMAPDKGKSLLQHCASSLDNYYAPENMEQIVTAFGEIARK 402


>gi|227823417|ref|YP_002827390.1| hypothetical protein NGR_c28930 [Sinorhizobium fredii NGR234]
 gi|227342419|gb|ACP26637.1| hypothetical protein NGR_c28930 [Sinorhizobium fredii NGR234]
          Length = 413

 Score =  243 bits (620), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 71/398 (17%), Positives = 146/398 (36%), Gaps = 40/398 (10%)

Query: 4   LNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAAT 63
           +  +      +  G   ++TA+  P++    G+ I+++++   K  L    D + + AA+
Sbjct: 7   IGRSFITMLKDRGGNFGMMTAVAAPLLLAAGGVSIDMANMLMTKNQLQDATDAAALAAAS 66

Query: 64  QIMNEGN--GNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDI-----VRSTSL 116
            ++++        K++    +  +   T       +  +               V +  +
Sbjct: 67  ALVSDEQPDIAAAKEIARKFLKTQAGGTTTPDAPADSGEGASSGAASSTPDWDDVNTLEV 126

Query: 117 DIVVVPQ-NEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMM 175
           +I   P   +G         K   +F   +     +  I +  +S+ +  +++   L M 
Sbjct: 127 NITETPNGTKGKIFQVTVINKRVTEF-NAMTRLLGTDSIELEASSTAESATESKNALSMY 185

Query: 176 IVLDVSRSMESFFD----------------------------SSITKIDMAIKSINAMLE 207
           +VLD S SM    +                              +TKID    ++  +L 
Sbjct: 186 LVLDRSGSMAWKTNTINAAKKSCPNYTESNWSRYPNLWASSPCYVTKIDALKTAVTDLLA 245

Query: 208 EVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAY 267
           ++ +       V++  +++++  +    L WG S     +  L   G  T S    K AY
Sbjct: 246 QLLVADPDQIYVRTAAISYNSVQDTAGTLAWGTSGAAAYVNALVATG-GTASAGAFKTAY 304

Query: 268 NQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGI 327
            ++        H         K +VFMTDGEN    +D  +  +C+ AK     +Y++  
Sbjct: 305 QKVIAATENTAHAAKNGQVPSKYMVFMTDGENNYANDDTVTKQWCDTAKANKVEIYSVAF 364

Query: 328 RVI-RSHEFLRACA-SPNSFYLVENPHSMYDAFSHIGK 363
               R    L+ CA S + ++  E    +  AF  IG+
Sbjct: 365 MAPERGQALLKYCASSSSHYFEAEEVTDLVAAFKAIGE 402


>gi|218662625|ref|ZP_03518555.1| hypothetical protein RetlI_26027 [Rhizobium etli IE4771]
          Length = 389

 Score =  242 bits (618), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 76/398 (19%), Positives = 129/398 (32%), Gaps = 67/398 (16%)

Query: 23  TAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDI 82
           TAI  P++    GM + V  +   K  L                +         L  G I
Sbjct: 1   TAILAPVLLGAAGMAVHVGDMLLSKQQLQEAA------------DSAALATATALANGKI 48

Query: 83  LCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVV--VPQNEGYSISAISRYKIPLK 140
                  +  +F      N ++    DI  +T + +       +  Y ++    Y + + 
Sbjct: 49  QTSEAEAYARNFVAGQMAN-YLQSGVDIKSATGVSVQTNTSGNSTSYQVTVSPSYDLTVN 107

Query: 141 FCTFIPWYTNSRHIVMPITSSVKVNSQTDAR--LDMMIVLDVSRSMES------------ 186
                  +T ++H+    T+    +SQT  +  + M + LD S SM              
Sbjct: 108 PLMQAVGFT-TQHLSTSGTTIGGGHSQTQGQGSISMYLALDKSGSMGEDTATVNEEDPTE 166

Query: 187 --FFDSSI---------------------TKIDMAIKSINAMLEEVKLIPDVNNVVQSGL 223
              +  +                      TKI+    +   +  ++         V++G 
Sbjct: 167 SYTYPCNPHYNRKGKEVWDTCTGSRANYYTKIEALKMAAGNLFAQLSGADPNAQYVRTGA 226

Query: 224 VTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQ------GMR 277
           V++         L WG   +   +  L   G  TNS+  +  AY  +             
Sbjct: 227 VSYDIVQYAPSSLAWGAIGVSSYVNALQA-GGGTNSSGAMSTAYLSLTAKNAAGNDAEDS 285

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKE-----DQQSLYYCNEAKKRGAIVYAIGIRV-IR 331
            H        +K IVFMTDG+N +        D  +   C+ AK +G  +Y I       
Sbjct: 286 AHKLKSGQIPQKYIVFMTDGDNNNDSSGGRSYDTLTKATCDTAKSKGIEIYTIAFMAPPG 345

Query: 332 SHEFLRACASPNSFYL-VENPHSMYDAFSHIGKDIVTK 368
               L+ CAS  S Y   E    ++ AF  IG    T+
Sbjct: 346 GQALLQYCASDASHYFQAEKMEDLFAAFKAIGAKASTQ 383


>gi|254781108|ref|YP_003065521.1| von Willebrand factor type A [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040785|gb|ACT57581.1| von Willebrand factor type A [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 398

 Score =  237 bits (604), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 75/400 (18%), Positives = 168/400 (42%), Gaps = 59/400 (14%)

Query: 22  LTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGD 81
           +TAI + + FL +   I+++HI +++  + S +D +++     I+++    +    K   
Sbjct: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKD-- 58

Query: 82  ILCRIKNTWNMSFRNELRDNGFVND-IDDIVRSTSLDIVVVPQNE-GYSISAISRYKIPL 139
              +    +    +  L+   ++ +   DI +   ++I     N   Y   + ++Y+IP 
Sbjct: 59  ---QTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPT 115

Query: 140 KFCTFIPWYTNS-RHIVMPITSSVKVNSQTDARLDMMIVLDVSRSME------------- 185
           +         ++  ++ +  T  ++ +S+  A + + +VLDVSRSME             
Sbjct: 116 ENLFLKGLIPSALTNLSLRSTGIIERSSENLA-ISICMVLDVSRSMEDLYLQKHNDNNNM 174

Query: 186 -------------SFFDSSITK-------------IDMAIKSINAMLEEVKLI--PDVNN 217
                        SF+  + TK             ID+ I+S   ++  ++       N 
Sbjct: 175 TSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNL 234

Query: 218 VVQSGLVTFSNKI--EEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQG 275
            V+ G + ++  I   +   L   ++ ++ ++  L+ +  +TN+ P + +AY ++++ + 
Sbjct: 235 SVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY-ENTNTYPAMHHAYRELYNEKE 293

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQ---QSLYYCNEAKKRGAIVYAIGIRV-IR 331
              H        KK ++F+TDGEN      Q    +L  C   +  G  +Y++ +     
Sbjct: 294 -SSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPE 352

Query: 332 SHEFLRACA-SPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
             + LR C  S   F+ V +   + ++F  I   I  + +
Sbjct: 353 GQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392


>gi|218515283|ref|ZP_03512123.1| hypothetical protein Retl8_17130 [Rhizobium etli 8C-3]
          Length = 329

 Score =  219 bits (557), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 66/328 (20%), Positives = 113/328 (34%), Gaps = 54/328 (16%)

Query: 92  MSFRNELRDNGFVNDIDDIVRSTSLDIVV--VPQNEGYSISAISRYKIPLKFCTFIPWYT 149
            +F      N ++    DI  +T + +       +  Y ++    Y + +        +T
Sbjct: 1   RNFVAGQMAN-YLQSGVDIKSATGVTVQTNTSGNSTSYQVTVSPSYDLTVNPLMQAVGFT 59

Query: 150 NSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSM------------------------- 184
            ++H+    T+ +  +SQT   + M + LD S SM                         
Sbjct: 60  -TQHLSTSGTT-IGGHSQTQGSISMYLALDKSGSMGEDTATVNEEDPTESYTYDCNGHYN 117

Query: 185 ---ESFFDSSI-------TKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFF 234
              +  +D+         TKI+    +   +  ++         V++G V++        
Sbjct: 118 KKGKWIYDTCTGSRANYYTKIEALKMAAGNLFGQLSSADPNAQYVRTGAVSYDIVQYTPS 177

Query: 235 LLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQ------GMRQHCNTEDANYK 288
            L WG S +   +  L   G  TNS+  +  AY+ +              H        K
Sbjct: 178 ALAWGTSGVSTYVNALQA-GGGTNSSGAMSTAYSSLTAKNAAGNDAEDAAHKLKTGQTPK 236

Query: 289 KIIVFMTDGENLSTKE-----DQQSLYYCNEAKKRGAIVYAIGIRVIR-SHEFLRACASP 342
           K IVFMTDG+N          D  +   C+ AK +G  +Y I           L  CAS 
Sbjct: 237 KYIVFMTDGDNNDDSSGGRSYDTLTKATCDTAKSKGIEIYTIAFMAPEGGQALLHYCASD 296

Query: 343 NSFYL-VENPHSMYDAFSHIGKDIVTKR 369
           +S Y   E    +  AF  IG    ++ 
Sbjct: 297 DSHYFQAEKMEDLLAAFKAIGAKASSQL 324


>gi|116253849|ref|YP_769687.1| hypothetical protein RL4112 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115258497|emb|CAK09601.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 398

 Score =  205 bits (520), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 76/393 (19%), Positives = 142/393 (36%), Gaps = 50/393 (12%)

Query: 8   IRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMN 67
           +R    +  G   I+TAI +P++    G+ I+ S++   K  L                +
Sbjct: 10  LRRMLGDRGGNFGIMTAIMMPVLLGAAGLAIDYSNMALSKRELQEAT-----------DS 58

Query: 68  EGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGF-VNDIDDIVRSTSLDI--VVVPQN 124
                      G              F +    N    + I  I   TS+DI       +
Sbjct: 59  AALAAATALASGAASTTADAEAIAKDFVSGQMANYVDTDAISSIKAGTSVDIDVSATATS 118

Query: 125 EGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSM 184
           + Y ++  + Y I       +  Y      +   TS+    S T   L M +VLD S SM
Sbjct: 119 KSYKVTVATSYGIAATPFMSVLGYKTLN--IGASTSTSSGTSDTKTALSMELVLDQSGSM 176

Query: 185 ESFFDSS-----------ITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN----- 228
                +            +TKID   K+ +A+ + +      +++V++G  +++N     
Sbjct: 177 GEKTTTCATYNGKNCKTYVTKIDALKKAADALFDALDTADPDHSLVRTGAYSYNNGLIYN 236

Query: 229 ----KIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQ-----GMRQH 279
               +I+    + WG +     +  ++  G  T++T  ++ A   I           + H
Sbjct: 237 SQKTQIKSMSGMAWGTATTATYVSGITASG-GTDATEPMRQATLSIAKASDGSDVETQAH 295

Query: 280 CNTEDANYKKIIVFMTDGENLSTKE------DQQSLYYCNEAKKRGAIVYAIGIRVI-RS 332
               +    + I+ MTDGE            DQ     C+  K  G  ++ +      + 
Sbjct: 296 AVKGNTIVSRYIILMTDGEMTGNTGVWQSSFDQNVRNQCDATKTAGIKIFTVAFMAPDKG 355

Query: 333 HEFLRACASP-NSFYLVENPHSMYDAFSHIGKD 364
            + L+ CASP  ++Y  E    +  +F+ I K+
Sbjct: 356 KQLLQYCASPGGNYYEAETMEKLVASFTSIAKE 388


>gi|222087111|ref|YP_002545646.1| hypothetical protein Arad_3867 [Agrobacterium radiobacter K84]
 gi|221724559|gb|ACM27715.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 401

 Score =  202 bits (514), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 72/404 (17%), Positives = 144/404 (35%), Gaps = 48/404 (11%)

Query: 7   NIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIM 66
           ++    ++  G   ILTAI +P++    G+ ++V+++    + L             Q  
Sbjct: 10  SLIQLIHDRTGNFGILTAIAIPVVAATAGVAVDVTNMTVSNSQLQ------------QAT 57

Query: 67  NEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGF---VNDIDDIVRSTSLDIVVVPQ 123
           +         L  G+            F      N      N  D +   T+ ++     
Sbjct: 58  DAAALATATALANGNATTSNAQQLATQFVTGQMSNYLSGDTNTADALKAGTTANVTSATN 117

Query: 124 ---NEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDV 180
                 Y+++  + Y + +   + +             ++S    +   A L M I LD 
Sbjct: 118 SSGGTSYTVAVNASYDMSVNGMSQLLGIKTMHVSAASTSTSGSAAAAKQAALSMEIALDK 177

Query: 181 SRSM----------------------------ESFFDSSITKIDMAIKSINAMLEEVKLI 212
           S SM                            ++     I KI     ++  +L+++   
Sbjct: 178 SGSMLLNTDVIDTSQKSCTQYYTEGNYLYQYPKAKSPCYIKKIAALKTAVGTLLDQLDSA 237

Query: 213 PDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFD 272
              +  V++  + +S++++    L WG +  +  +         T S+  +  AY  +  
Sbjct: 238 DPKSQYVRTAAIAWSSEVDSSSALAWGTTTTRSNVISGLNANGGTESSAPMALAYKNVSA 297

Query: 273 MQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI-R 331
                      +  ++KIIV MTDGEN +T  D ++L  C  AK  G ++Y++      R
Sbjct: 298 SSEATAQAAKGNTTFQKIIVLMTDGENNATSSDTKTLATCKAAKDAGVLIYSVAFMAPDR 357

Query: 332 SHEFLRACA-SPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYDK 374
               L+ CA SP++++  +    +  AF  IG     +     K
Sbjct: 358 GQTLLKNCASSPSNYFDAQQMSDLIAAFKTIGNQASKQITLLTK 401


>gi|222149754|ref|YP_002550711.1| hypothetical protein Avi_3756 [Agrobacterium vitis S4]
 gi|221736736|gb|ACM37699.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 437

 Score =  192 bits (488), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 72/396 (18%), Positives = 142/396 (35%), Gaps = 50/396 (12%)

Query: 10  NFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEG 69
               +  G   ++TA+ LP+   V G+ ++ + +   ++ L S +D + + AA+ + N  
Sbjct: 41  RLLRHSGGNFGMMTAVLLPVSIGVAGLAMDATEMVQSRSALQSSVDAAALAAASAMSNGM 100

Query: 70  NGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIV-VVPQNEGYS 128
           +  +   L    +  ++ NT          +   V+ I       S+    V   +  Y 
Sbjct: 101 SEADAIALAKSFLSSQLANTMARD-----ENTSSVDQITQAEPDISVKTTQVNSSSTSYD 155

Query: 129 ISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVK-VNSQTDARLDMMIVLDVSRSMESF 187
           +     Y I +   +          + +      +   + +++ L M +VLD S SM   
Sbjct: 156 VELTGSYTITMNPLS---RVLGWETVTLKAYGKAQAATTASESPLSMYLVLDRSGSMNDE 212

Query: 188 FD-----------------------------SSITKIDMAIKSINAMLEEVKLIPDVNNV 218
                                           + TKI+    ++  +  ++K     +  
Sbjct: 213 TATTYTGTCTKTTTSGYGWNKKTTTTSYSCTKNYTKIESLKLAVADLAAQLKKADPNSEY 272

Query: 219 VQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQ--GM 276
           V++G  +++   +    + WG +++   +  LS  G  T++   L  AY+ +       +
Sbjct: 273 VRTGADSYNASADTAQAMSWGTANVVTYVNALSATG-GTDARGALSAAYSALQTSNKTEI 331

Query: 277 RQHCNTEDANYKKIIVFMTDGENLST------KEDQQSLYYCNEAKKRGAIVYAIGIRVI 330
             H  +  +   + IVFMTDGE            D      C   K  G  +Y +     
Sbjct: 332 TAHNVSSVSKIGRYIVFMTDGEMTGNSSSWSSSIDSAVRSQCTSIKADGIQIYTVAFMAP 391

Query: 331 -RSHEFLRACASP-NSFYLVENPHSMYDAFSHIGKD 364
                 L ACAS  + +Y   +  S+  AF  IGK 
Sbjct: 392 ANGKSLLSACASDASHYYEATDAASLVAAFGEIGKK 427


>gi|254780388|ref|YP_003064801.1| hypothetical protein CLIBASIA_01365 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040065|gb|ACT56861.1| hypothetical protein CLIBASIA_01365 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 458

 Score =  179 bits (454), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 86/449 (19%), Positives = 160/449 (35%), Gaps = 85/449 (18%)

Query: 9   RNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIM-- 66
           +    +  G   I+TA+ +P++  V GM+++V    + +  L      +++ A+  ++  
Sbjct: 12  KKLIKSCTGHFFIITALLMPVMLGVGGMLVDVVRWSYYEHALKQAAQTAIITASVPLIQS 71

Query: 67  -------NEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIV 119
                   + +    K+     ++   +N    +F +    +   +   ++    S   V
Sbjct: 72  LEEVSSRAKNSFTFPKQKIEEYLIRNFENNLKKNFTDREVRDIVRDTAVEMNPRKSAYQV 131

Query: 120 VVP------------------------QNEGYSISAISRY-------------------K 136
           V+                         Q +  + +    Y                    
Sbjct: 132 VLSSRYDLLLNPLSLFLRSMGIKSWLIQTKAEAETVSRSYHKEHGVSIQWVIDFSRSMLD 191

Query: 137 IPLKFCTFIPWYTN--SRHIVMPITSSVKVNSQTDARLDMMIV--------------LDV 180
                           +   V   +S        D +L   +V              LD 
Sbjct: 192 YQRDSEGQPLNCFGQPADRTVKSYSSQNGKVGIRDEKLSPYMVSCNKSLYYMLYPGPLDP 251

Query: 181 SRSMESFFDSS-----ITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFL 235
           S S E F DSS     I K  +   ++ +++  +K I +VN+ V+ G   F++++     
Sbjct: 252 SLSEEHFVDSSSLRHVIKKKHLVRDALASVIRSIKKIDNVNDTVRMGATFFNDRVISDPS 311

Query: 236 LEWGVSHLQRKIKYLSKF----GVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKII 291
             WGV  L R I            ST     ++ AY+ I        H    +   KK I
Sbjct: 312 FSWGVHKLIRTIVKTFAIDENEMGSTAINDAMQTAYDTIISSNEDEVHRMKNNLEAKKYI 371

Query: 292 VFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHE-----FLRACASPNSFY 346
           V +TDGEN   +++++ +  CN+AK +G  +  I   V ++ +     FL  CASPNSF+
Sbjct: 372 VLLTDGENT--QDNEEGIAICNKAKSQGIRIMTIAFSVNKTQQEKARYFLSNCASPNSFF 429

Query: 347 LVENPHSMYDAF-SHIGKDIVTKRIWYDK 374
              + H +   F   IG +I  + I   K
Sbjct: 430 EANSTHELNKIFRDRIGNEIFERVIRITK 458


>gi|218506715|ref|ZP_03504593.1| hypothetical protein RetlB5_03444 [Rhizobium etli Brasil 5]
          Length = 269

 Score =  177 bits (449), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 54/257 (21%), Positives = 85/257 (33%), Gaps = 50/257 (19%)

Query: 161 SVKVNSQTDARLDMMIVLDVSRSMES--------------FFDSSI-------------- 192
           +V  +SQ+   + M + LD S SM                 +D +               
Sbjct: 8   TVSGHSQSQGSISMFLALDKSGSMGDPTATVNADDPTEPFTYDCNPHLNKKGTKIIYDTC 67

Query: 193 --------TKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQ 244
                   TKI+    +   +  ++         V++G V++         L WG++ + 
Sbjct: 68  TGSRAHYYTKIEALKIAAGNLFSQLNSADPNAEYVRTGAVSYDLVEYTPSKLAWGITAVT 127

Query: 245 RKIKYLSKFGVSTNSTPGLKYAYNQIFDMQ------GMRQHCNTEDANYKKIIVFMTDGE 298
             +  L   G  TNS+  +  AY  +              H        KK IVFMTDG+
Sbjct: 128 SYVNALES-GGGTNSSGAVNTAYTSLTAKNAAGNDAEDAAHKLKTGQLPKKYIVFMTDGD 186

Query: 299 NLST-----KEDQQSLYYCNEAKKRGAIVYAIGIRVIR-SHEFLRACASPNSFYL-VENP 351
           N          D  +   C+ AK +G   Y I           L  CAS ++ Y   E  
Sbjct: 187 NNDDSRGGRSYDTLTKATCDTAKAKGIETYTIAFMAPEGGQALLHYCASDDAHYFQAEKM 246

Query: 352 HSMYDAFSHIGKDIVTK 368
             +  AF  IG     +
Sbjct: 247 EDLLAAFKAIGAKASAQ 263


>gi|315122199|ref|YP_004062688.1| hypothetical protein CKC_02245 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495601|gb|ADR52200.1| hypothetical protein CKC_02245 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 463

 Score =  156 bits (395), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 43/189 (22%), Positives = 87/189 (46%), Gaps = 10/189 (5%)

Query: 192 ITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIK--- 248
           I K  +   ++   ++ V+ I ++ + ++   + F+ +I+ +F + WG+   ++++    
Sbjct: 271 IRKRYLVRDALATFIKRVRKIDNLKDKLRMSFMYFNERIDHYFPMTWGIKEFKQEVSSHY 330

Query: 249 YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDG-ENLSTKEDQQ 307
                  +T+  P L+ AYN++       +H        KK IV +TDG +N        
Sbjct: 331 KRKHENTATDIHPILQEAYNKLHSKNEDDEHKKKNSVEVKKFIVLLTDGAQNEGVHSVDS 390

Query: 308 SLYYCNEAKKRGAIVYAIGIRV-----IRSHEFLRACASPNSFYLVENPHSMYDAFS-HI 361
            L  C+ AK+ G  ++ I   V      ++++FL  CASP+ F+   +   +   F  HI
Sbjct: 391 VLKICDAAKEEGIKIFTISYSVDSSERKKANDFLSRCASPDKFFEAYDADKLNMIFKEHI 450

Query: 362 GKDIVTKRI 370
           G  I  + +
Sbjct: 451 GDAIFERLV 459



 Score = 77.9 bits (190), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 42/193 (21%), Positives = 85/193 (44%), Gaps = 8/193 (4%)

Query: 3   SLNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAA 62
           SL  N +     Y G   +++A+ LP+IF+V+G++I++    +    L   ++ + + A+
Sbjct: 6   SLFFNFKRLKKCYNGSFFVISALLLPVIFMVIGLLIDLVRWGYYHNSLVQAVNTAALSAS 65

Query: 63  TQIMNE-GNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVV 121
            Q++N   + +  K L        IK     + +  L +N    D   I++ T ++I   
Sbjct: 66  VQLLNSVEDKSKEKALSSVLGENNIKQYLLNNLKISLYNNFGEMDSQRIIQHTKVNIYN- 124

Query: 122 PQNEGYSISAISRYKIPLKFCT-FIPWYTNSRHIVMPITSSVKVNSQ----TDARLDMMI 176
            +   + I+  S Y +PL   + F     N +   +      +V S+     +  + +  
Sbjct: 125 -RKGTHIINVYSHYNLPLNPFSLFFMNLINIKSWPITTVGEAEVTSKKNYHKEEGVSVQW 183

Query: 177 VLDVSRSMESFFD 189
           ++D S SM S  D
Sbjct: 184 LIDDSGSMGSIID 196


>gi|297482040|ref|XP_002692521.1| PREDICTED: matrilin 4 [Bos taurus]
 gi|296480952|gb|DAA23067.1| matrilin 4 [Bos taurus]
          Length = 584

 Score =  142 bits (357), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 50/233 (21%), Positives = 97/233 (41%), Gaps = 36/233 (15%)

Query: 146 PWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAM 205
           PW T  + +  P  SS          LD++ V+D SRS+  F      + +   + +  +
Sbjct: 18  PWETQLQ-LAGPRCSS--------GPLDLVFVIDSSRSVRPF------EFETMRQFLVGL 62

Query: 206 LEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGL 263
           L  + + P+     + G++ +S++++  F L        ++R I+ +      T +   +
Sbjct: 63  LRSLDVGPNA---TRVGVIQYSSQVQSVFPLRAFSRREDMERAIRAVVPLAQGTMTGLAI 119

Query: 264 KYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVY 323
           +YA N  F +          +A+  ++ V +TDG         +      +A+ RG  +Y
Sbjct: 120 QYAMNVAFSVAE---GARPPEAHVPRVAVIVTDGRPQD-----RVAEVAAQARARGIEIY 171

Query: 324 AIGIRVIRSHEFLRACASP---NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
           A+G++       LRA ASP      +LVE+    +D     G+    +    D
Sbjct: 172 AVGVQRADVGS-LRAMASPPLNEHVFLVES----FDLIQEFGRQFQGRLCTLD 219



 Score = 82.9 bits (203), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 30/180 (16%), Positives = 75/180 (41%), Gaps = 19/180 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           +   +  +D+++++D S+S+           ++  + +N +++ + + P+     + GLV
Sbjct: 339 SRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQIVDFLDVSPEG---TRVGLV 389

Query: 225 TFSNKIEEFFLL-EWGVS-HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS+++   F L  +G +  +++ +  +      T +   L++     F      Q    
Sbjct: 390 QFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMERGTMTGLALRHMVEHSFSEA---QGARP 446

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
              N  ++ +  TDG +           +   AK+ G ++YA+G+      E     + P
Sbjct: 447 RALNVPRVGLVFTDGRSQDNIS-----VWAARAKEEGIVMYAVGVGKAVEEELREIASEP 501


>gi|300796915|ref|NP_001178240.1| matrilin-4 [Bos taurus]
          Length = 584

 Score =  142 bits (357), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 50/233 (21%), Positives = 97/233 (41%), Gaps = 36/233 (15%)

Query: 146 PWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAM 205
           PW T  + +  P  SS          LD++ V+D SRS+  F      + +   + +  +
Sbjct: 18  PWETQLQ-LAGPRCSS--------GPLDLVFVIDSSRSVRPF------EFETMRQFLVGL 62

Query: 206 LEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGL 263
           L  + + P+     + G++ +S++++  F L        ++R I+ +      T +   +
Sbjct: 63  LRSLDVGPNA---TRVGVIQYSSQVQSVFPLRAFSRREDMERAIRAVVPLAQGTMTGLAI 119

Query: 264 KYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVY 323
           +YA N  F +          +A+  ++ V +TDG         +      +A+ RG  +Y
Sbjct: 120 QYAMNVAFSVAE---GARPPEAHVPRVAVIVTDGRPQD-----RVAEVAAQARARGIEIY 171

Query: 324 AIGIRVIRSHEFLRACASP---NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
           A+G++       LRA ASP      +LVE+    +D     G+    +    D
Sbjct: 172 AVGVQRADVGS-LRAMASPPLNEHVFLVES----FDLIQEFGRQFQGRLCTLD 219



 Score = 82.9 bits (203), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 30/180 (16%), Positives = 75/180 (41%), Gaps = 19/180 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           +   +  +D+++++D S+S+           ++  + +N +++ + + P+     + GLV
Sbjct: 339 SRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQIVDFLDVSPEG---TRVGLV 389

Query: 225 TFSNKIEEFFLL-EWGVS-HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS+++   F L  +G +  +++ +  +      T +   L++     F      Q    
Sbjct: 390 QFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMERGTMTGLALRHMVEHSFSEA---QGARP 446

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
              N  ++ +  TDG +           +   AK+ G ++YA+G+      E     + P
Sbjct: 447 RALNVPRVGLVFTDGRSQDNIS-----VWAARAKEEGIVMYAVGVGKAVEEELREIASEP 501


>gi|194224466|ref|XP_001500626.2| PREDICTED: matrilin 4 [Equus caballus]
          Length = 542

 Score =  134 bits (338), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 44/213 (20%), Positives = 87/213 (40%), Gaps = 27/213 (12%)

Query: 166 SQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVT 225
                 LD++ V+D SRS+  F      + +   + +  +L  + + P+     + G++ 
Sbjct: 29  GCRAGPLDLVFVIDSSRSVRPF------EFETMRQFLVGLLRSLDVGPNA---TRVGVIQ 79

Query: 226 FSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           +S++++  F L        ++R I+ L      T +   ++YA N  F +          
Sbjct: 80  YSSQVQSVFPLSAFSRREDMERAIRALVPLAQGTMTGLAIQYAMNVAFSVAE---GARPP 136

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP- 342
           +A   ++ V +TDG         +      +A+ RG  +YA+G++       LRA ASP 
Sbjct: 137 EARVPRVAVIVTDGRPQD-----RVAEVAAQARARGIEIYAVGVQRADVGS-LRAMASPP 190

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
                +LV++    +D     G     +    D
Sbjct: 191 LDEHVFLVDS----FDLIQEFGLQFQGQLCAID 219



 Score = 84.4 bits (207), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 31/180 (17%), Positives = 76/180 (42%), Gaps = 19/180 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           N   +  +D+++++D S+S+           ++  + +N +++ + + P+     + GLV
Sbjct: 298 NRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQIVDFLDVSPEG---TRVGLV 348

Query: 225 TFSNKIEEFFLL-EWGVS-HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS+++   F L  +G +  +++ +  +      T +   L++     F      Q    
Sbjct: 349 QFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMERGTMTGLALRHMVEHSFSEA---QGARP 405

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
              N  ++ +  TDG +           +   AK+ G ++YA+G+      E  +  + P
Sbjct: 406 RALNVPRVGLVFTDGRSQDDIS-----VWAARAKEEGIVMYAVGVGKAVEEELRKIASEP 460


>gi|311274909|ref|XP_003134506.1| PREDICTED: matrilin-4-like [Sus scrofa]
          Length = 721

 Score =  134 bits (336), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 43/213 (20%), Positives = 87/213 (40%), Gaps = 27/213 (12%)

Query: 166 SQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVT 225
                 LD++ V+D SRS+  F      + +   + +  +L  + + P+     + G++ 
Sbjct: 167 RCRTGPLDLVFVIDSSRSVRPF------EFETMRQFLVGLLRSLDVGPNA---TRVGVIQ 217

Query: 226 FSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           +S++++  F L        ++  I+ L      T +   ++YA N  F +          
Sbjct: 218 YSSQVQSVFPLGAFSRREDMEGAIRALVPLAQGTMTGLAIQYAMNVAFSVAE---GARPP 274

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP- 342
           +A   ++ V +TDG         +      +A+ RG  +YA+G++       LRA ASP 
Sbjct: 275 EARVPRVAVIVTDGRPQD-----RVAEVAAQARARGIEIYAVGVQRADVGS-LRAMASPP 328

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
                +LVE+    +D     G+    +    +
Sbjct: 329 LDEHVFLVES----FDLIQEFGQQFQGRLCPIN 357



 Score = 83.3 bits (204), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 31/180 (17%), Positives = 74/180 (41%), Gaps = 19/180 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           N   +  +D+++++D S+S+           ++  + +N +++ + + P+     + GLV
Sbjct: 477 NRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQIVDFLDVSPEG---TRVGLV 527

Query: 225 TFSNKIEEFFLL-EWGVS-HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS+++   F L  +G +  +++ +  +      T +   L++     F      Q    
Sbjct: 528 QFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMERGTMTGLALRHMVEHSFSEA---QGARP 584

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
              N  ++ +  TDG             +   AK+ G ++YA+G+      E     + P
Sbjct: 585 RALNVPRVGLVFTDGR-----SQDDVSVWAARAKEEGIVMYAVGVGKAVEEELREIASEP 639


>gi|301764008|ref|XP_002917404.1| PREDICTED: matrilin-4-like [Ailuropoda melanoleuca]
          Length = 594

 Score =  132 bits (332), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 50/242 (20%), Positives = 96/242 (39%), Gaps = 36/242 (14%)

Query: 137 IPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKID 196
           +P+      PW T  + +  P   +          LD++ V+D SRS+  F      + +
Sbjct: 9   LPMLLFLLQPWETQLQ-LAGPRCRT--------GPLDLVFVIDSSRSVRPF------EFE 53

Query: 197 MAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWG--VSHLQRKIKYLSKFG 254
              + +  +L  + + P+     + G++ +S++++  F L        ++  I+ L    
Sbjct: 54  TMRQFLVGLLRGLDVGPNA---TRVGVIQYSSQVQSVFPLGAFARREDMEHAIRALVPLA 110

Query: 255 VSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNE 314
             T +   ++YA N  F +          +A   +I V +TDG         +      +
Sbjct: 111 QGTMTGLAIQYAMNVAFSVAE---GARPPEARVPRIAVIVTDGRPQD-----RVAEVAAQ 162

Query: 315 AKKRGAIVYAIGIRVIRSHEFLRACASP---NSFYLVENPHSMYDAFSHIGKDIVTKRIW 371
           A+ RG  +YA+G++       LRA ASP      +LVE+    +D     G     +   
Sbjct: 163 ARARGIEIYAVGVQRADVGS-LRAMASPPLDEHVFLVES----FDLIQEFGLQFQGRLCA 217

Query: 372 YD 373
            D
Sbjct: 218 ID 219



 Score = 83.7 bits (205), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 31/180 (17%), Positives = 76/180 (42%), Gaps = 19/180 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           N   +  +D+++++D S+S+           ++  + +N +++ + + P+     + GLV
Sbjct: 339 NRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQIVDFLDVSPEG---TRVGLV 389

Query: 225 TFSNKIEEFFLL-EWGVS-HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS+++   F L  +G +  +++ +  +      T +   L++     F      Q    
Sbjct: 390 QFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMERGTMTGLALRHMVEHSFSEA---QGARP 446

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
              N  ++ +  TDG +           +   AK+ G ++YA+G+      E  +  + P
Sbjct: 447 RALNVPRVGLVFTDGRSQDDIS-----VWAARAKEEGIVMYAVGVGKAVEEELRQIASEP 501


>gi|73992503|ref|XP_543015.2| PREDICTED: similar to Matrilin-4 precursor [Canis familiaris]
          Length = 624

 Score =  131 bits (330), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 50/242 (20%), Positives = 96/242 (39%), Gaps = 36/242 (14%)

Query: 137 IPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKID 196
           +P+      PW T       P   +          LD++ V+D SRS+  F      + +
Sbjct: 9   LPVLLFLLQPWET-LSQFAGPRCRT--------GPLDLVFVIDSSRSVRPF------EFE 53

Query: 197 MAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFG 254
              + +  +L  + + P+     + G++ +S++++  F L        ++R I+ L    
Sbjct: 54  TMRQFLVGLLRGLDVGPNA---TRVGVIQYSSQVQSVFPLGAFSRREDMERAIRALVPLA 110

Query: 255 VSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNE 314
             T +   ++YA N  F +          +A   +I V +TDG         +      +
Sbjct: 111 QGTMTGLAIQYAMNVAFSVAE---GARPPEARVPRIAVIVTDGRPQD-----RVAEVAAQ 162

Query: 315 AKKRGAIVYAIGIRVIRSHEFLRACASP---NSFYLVENPHSMYDAFSHIGKDIVTKRIW 371
           A+ RG  +YA+G++       LRA ASP      +LVE+    ++     G+    +   
Sbjct: 163 ARARGIEIYAVGVQRADVGS-LRAMASPPLDEHVFLVES----FNLIQEFGQQFRGRLCG 217

Query: 372 YD 373
            D
Sbjct: 218 KD 219



 Score = 83.7 bits (205), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 31/180 (17%), Positives = 76/180 (42%), Gaps = 19/180 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           N   +  +D+++++D S+S+           ++  + +N +++ + + P+     + GLV
Sbjct: 380 NRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQIVDFLDVSPEG---TRVGLV 430

Query: 225 TFSNKIEEFFLL-EWGVS-HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS+++   F L  +G +  +++ +  +      T +   L++     F      Q    
Sbjct: 431 QFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMERGTMTGLALRHMVEHSFSEA---QGARP 487

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
              N  ++ +  TDG +           +   AK+ G ++YA+G+      E  +  + P
Sbjct: 488 RALNVPRVGLVFTDGRSQDDIS-----VWARRAKEEGIVMYAVGVGKAVEEELRQIASEP 542


>gi|281345581|gb|EFB21165.1| hypothetical protein PANDA_005644 [Ailuropoda melanoleuca]
          Length = 581

 Score =  131 bits (328), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 46/217 (21%), Positives = 88/217 (40%), Gaps = 27/217 (12%)

Query: 162 VKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQS 221
           +K        LD++ V+D SRS+  F      + +   + +  +L  + + P+     + 
Sbjct: 1   LKGPRCRTGPLDLVFVIDSSRSVRPF------EFETMRQFLVGLLRGLDVGPNA---TRV 51

Query: 222 GLVTFSNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQH 279
           G++ +S++++  F L        ++  I+ L      T +   ++YA N  F +      
Sbjct: 52  GVIQYSSQVQSVFPLGAFARREDMEHAIRALVPLAQGTMTGLAIQYAMNVAFSVAE---G 108

Query: 280 CNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRAC 339
               +A   +I V +TDG         +      +A+ RG  +YA+G++       LRA 
Sbjct: 109 ARPPEARVPRIAVIVTDGRPQD-----RVAEVAAQARARGIEIYAVGVQRADVGS-LRAM 162

Query: 340 ASP---NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
           ASP      +LVE+    +D     G     +    D
Sbjct: 163 ASPPLDEHVFLVES----FDLIQEFGLQFQGRLCGKD 195



 Score = 83.7 bits (205), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 31/180 (17%), Positives = 76/180 (42%), Gaps = 19/180 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           N   +  +D+++++D S+S+           ++  + +N +++ + + P+     + GLV
Sbjct: 356 NRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQIVDFLDVSPEG---TRVGLV 406

Query: 225 TFSNKIEEFFLL-EWGVS-HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS+++   F L  +G +  +++ +  +      T +   L++     F      Q    
Sbjct: 407 QFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMERGTMTGLALRHMVEHSFSEA---QGARP 463

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
              N  ++ +  TDG +           +   AK+ G ++YA+G+      E  +  + P
Sbjct: 464 RALNVPRVGLVFTDGRSQDDIS-----VWAARAKEEGIVMYAVGVGKAVEEELRQIASEP 518


>gi|91203253|emb|CAJ72892.1| hypothetical protein kustd2147 [Candidatus Kuenenia
           stuttgartiensis]
          Length = 701

 Score =  130 bits (326), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 53/208 (25%), Positives = 94/208 (45%), Gaps = 23/208 (11%)

Query: 166 SQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVT 225
           +Q D +L +MIVLD S SM    +  IT++ ++ K          LI  +N+  Q G+V 
Sbjct: 318 TQDDFQLQVMIVLDYSASMYEK-NGDITRMALSAK---------DLIESLNDTHQVGVVE 367

Query: 226 FSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM--QGMRQHCNTE 283
           F    E   +L+   ++    I+ +S+F     S+  +   ++  +D   +G++Q     
Sbjct: 368 FHRPDEPPAILQDFTTYKNAAIEAVSQF-----SSGKIYRDFSSCWDAVLKGLKQFPEKP 422

Query: 284 DANYKKIIVFMTDG-ENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA-- 340
           D +  K +VF++DG +N S       +     AK+R   +Y +GI      E L+  A  
Sbjct: 423 DPDIFKTLVFLSDGFDNSSFSTPGNVISL---AKERDVHIYILGIGRGSEEEVLKNIALE 479

Query: 341 SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
           +  ++   EN     + F    KDI  +
Sbjct: 480 TGGTYVHAENIAVFRERFKQTIKDIKGQ 507


>gi|306823858|ref|ZP_07457232.1| conserved hypothetical protein [Bifidobacterium dentium ATCC 27679]
 gi|309802423|ref|ZP_07696530.1| conserved repeat protein [Bifidobacterium dentium JCVIHMP022]
 gi|304552856|gb|EFM40769.1| conserved hypothetical protein [Bifidobacterium dentium ATCC 27679]
 gi|308221023|gb|EFO77328.1| conserved repeat protein [Bifidobacterium dentium JCVIHMP022]
          Length = 1136

 Score =  129 bits (325), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 74/351 (21%), Positives = 126/351 (35%), Gaps = 59/351 (16%)

Query: 65  IMNEGNGNNRKKLKGGDILCRIKN---TWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVV 121
           ++N+ N  +     G     +      T  ++      +  F N        T  +IV  
Sbjct: 491 VVNDPNITDVSCGTGTLASNQQTTCSGTLTLTEGMVGSEGHFTNTATATGTDTDGNIVNS 550

Query: 122 PQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTD-ARLDMMIVLDV 180
           P+    +I AI     P K         N+  + + +T +   ++ T    +D  +VLDV
Sbjct: 551 PE-ASVTIKAIKPLGAPEKHKRIKKNADNTYTVNVDVTGAASSSTITTTQPVDFTLVLDV 609

Query: 181 SRSMESFFDSSITKIDMAIKSINAMLEEVKLI----PDVNNVVQSGLVTFSNKI-----E 231
           S SM      S+TK+     ++N  L+E   I       +  V+ GLV F+         
Sbjct: 610 SGSMRENM-GSVTKLQALQSAVNNFLDEAAKINKGAQSGSEPVRVGLVKFAGNATKKIGN 668

Query: 232 EFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR-----QHCNT---- 282
           + +  +W   +  + +K L      T  T GLK   N++      R     QH  T    
Sbjct: 669 KTYQDKWNTYNYSQIVKKL------TADTDGLKNEVNKLTAGGATRADYGFQHAFTVMSE 722

Query: 283 EDANYKKIIVFMTDGENLSTKE-----DQQSLYYCNEAKKRGAIVYAIGI--------RV 329
                KK+++F TDG+  S K         ++ Y  + K  GAIVY+IG+          
Sbjct: 723 ARTEAKKVVIFFTDGKPTSEKTFDGKVANDAVEYAKQLKDSGAIVYSIGVFDGANPASTA 782

Query: 330 IRSHEFLRACAS----------------PNSFYLVENPHSMYDAFSHIGKD 364
              ++F+ A +S                   +    +   +   F  I K 
Sbjct: 783 TSENKFMHAVSSNYPNAANYEDLSEGSNAGYYKTATDASGLNSIFEEIRKS 833


>gi|134093078|gb|ABO52938.1| matrilin 4 isoform 1 precursor [Colobus guereza]
          Length = 581

 Score =  129 bits (325), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 43/213 (20%), Positives = 87/213 (40%), Gaps = 27/213 (12%)

Query: 166 SQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVT 225
                 LD++ V+D SRS+  F      + +   + +  ++  + + P+     + G++ 
Sbjct: 27  RCHTGPLDLVFVIDSSRSVRPF------EFETMRQFLVGLVRGLNVGPNA---TRVGVIQ 77

Query: 226 FSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           +S++++  F L        ++R I+ L      T +   ++YA N  F +          
Sbjct: 78  YSSQVQSVFPLRAFSRREDMERAIRDLVPLAQGTMTGLAIQYAMNVAFSVAE---GARPP 134

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP- 342
           +    ++ V +TDG         +      +A+ RG  +YA+G++       LRA ASP 
Sbjct: 135 EERVPRVAVIVTDGRPQD-----RVAEVAAQARARGIEIYAVGVQRADVGS-LRAMASPP 188

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
                +LVE+    +D     G    ++    D
Sbjct: 189 LDEHVFLVES----FDVIQEFGLQFQSRLCAID 217



 Score = 81.4 bits (199), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 30/180 (16%), Positives = 75/180 (41%), Gaps = 19/180 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           +   +  +D+++++D S+S+           ++  + +N +++ + + P+     + GLV
Sbjct: 337 DRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQIVDFLDVSPEG---TRVGLV 387

Query: 225 TFSNKIEEFFLL-EWGVS-HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS+++   F L  +G +  +++ +  +      T +   L++     F      Q    
Sbjct: 388 QFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMERGTMTGLALRHMVEHSFSEA---QGARP 444

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
              N  ++ +  TDG +           +   AK+ G ++YA+G+      E     + P
Sbjct: 445 RALNVPRVGLVFTDGRSQDDIS-----VWAARAKEEGIVMYAVGVGKAVEAELREIASEP 499


>gi|274320027|ref|NP_001162099.1| matrilin-4 [Macaca mulatta]
 gi|134093113|gb|ABO52973.1| matrilin 4 isoform 1 precursor [Macaca mulatta]
          Length = 581

 Score =  129 bits (325), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 44/213 (20%), Positives = 87/213 (40%), Gaps = 27/213 (12%)

Query: 166 SQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVT 225
                 LD++ V+D SRS+  F      + +   + +  +L  + + P+     + G++ 
Sbjct: 27  RCHTGPLDLVFVIDSSRSVRPF------EFETMRQFLVGLLRGLNVGPNA---TRVGVIQ 77

Query: 226 FSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           +S++++  F L        ++R I+ L      T +   ++YA N  F +          
Sbjct: 78  YSSQVQSVFPLRAFSRREDMERAIRDLVPLAQGTMTGLAIQYAMNVAFSVAE---GARPP 134

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP- 342
           +    ++ V +TDG         +      +A+ RG  +YA+G++       LRA ASP 
Sbjct: 135 EERVPRVAVIVTDGRPQD-----RVAEVAAQARARGIEIYAVGVQRADVGS-LRAMASPP 188

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
                +LVE+    +D     G    ++    D
Sbjct: 189 LDEHVFLVES----FDLIQEFGLQFQSRLCAID 217



 Score = 81.0 bits (198), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 30/180 (16%), Positives = 74/180 (41%), Gaps = 19/180 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           +   +  +D+++++D S+S+           ++  + +N +++ + + P+     + GLV
Sbjct: 337 DRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQIVDFLDVSPEG---TRVGLV 387

Query: 225 TFSNKIEEFFLL-EWGVS-HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS+++   F L  +G +  +++ +  +      T +   L++     F      Q    
Sbjct: 388 QFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMERGTMTGLALRHMVEHSFSEA---QGARP 444

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
              N  ++ +  TDG +           +   AK+ G  +YA+G+      E     + P
Sbjct: 445 RALNVPRVGLVFTDGRSQDDIS-----VWAARAKEEGIAMYAVGVGKAVEAELREIASEP 499


>gi|281183022|ref|NP_001162498.1| matrilin-4 [Papio anubis]
 gi|134093054|gb|ABO52914.1| matrilin 4 isoform 1 precursor [Papio anubis]
          Length = 581

 Score =  129 bits (325), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 44/213 (20%), Positives = 87/213 (40%), Gaps = 27/213 (12%)

Query: 166 SQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVT 225
                 LD++ V+D SRS+  F      + +   + +  +L  + + P+     + G++ 
Sbjct: 27  RCHTGPLDLVFVIDSSRSVRPF------EFETMRQFLVGLLRGLNVGPNA---TRVGVIQ 77

Query: 226 FSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           +S++++  F L        ++R I+ L      T +   ++YA N  F +          
Sbjct: 78  YSSQVQSVFPLRAFSRREDMERAIRDLVPLAQGTMTGLAIQYAMNVAFSVAE---GARPP 134

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP- 342
           +    ++ V +TDG         +      +A+ RG  +YA+G++       LRA ASP 
Sbjct: 135 EERVPRVAVIVTDGRPQD-----RVAEVAAQARARGIEIYAVGVQRADVGS-LRAMASPP 188

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
                +LVE+    +D     G    ++    D
Sbjct: 189 LDEHVFLVES----FDLIQEFGLQFQSRLCAID 217



 Score = 81.4 bits (199), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 30/180 (16%), Positives = 75/180 (41%), Gaps = 19/180 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           +   +  +D+++++D S+S+           ++  + +N +++ + + P+     + GLV
Sbjct: 337 DRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQIVDFLDVSPEG---TRVGLV 387

Query: 225 TFSNKIEEFFLL-EWGVS-HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS+++   F L  +G +  +++ +  +      T +   L++     F      Q    
Sbjct: 388 QFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMERGTMTGLALRHMVEHSFSEA---QGARP 444

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
              N  ++ +  TDG +           +   AK+ G ++YA+G+      E     + P
Sbjct: 445 RALNVPRVGLVFTDGRSQDDIS-----VWAARAKEEGIVMYAVGVGKAVEAELREIASEP 499


>gi|193786651|dbj|BAG51974.1| unnamed protein product [Homo sapiens]
          Length = 581

 Score =  129 bits (325), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 44/217 (20%), Positives = 88/217 (40%), Gaps = 27/217 (12%)

Query: 162 VKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQS 221
           +         LD++ V+D SRS+  F      + +   + +  +L  + + P+     + 
Sbjct: 23  LTGPRCHTGPLDLVFVIDSSRSVRPF------EFETMRQFLMGLLRGLNVGPNA---TRV 73

Query: 222 GLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQH 279
           G++ +S++++  F L        ++R I+ L      T +   ++YA N  F +      
Sbjct: 74  GVIQYSSQVQSVFPLRAFSRREDMERAIRDLVPLAQGTMTGLAIQYAMNVAFSVAE---G 130

Query: 280 CNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRAC 339
               +    ++ V +TDG         +      +A+ RG  +YA+G++       LRA 
Sbjct: 131 ARPPEERVPRVAVIVTDGRPQD-----RVAEVAAQARARGIEIYAVGVQRADVGS-LRAM 184

Query: 340 ASP---NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
           ASP      +LVE+    +D     G    ++    D
Sbjct: 185 ASPPLDEHVFLVES----FDLIQEFGLQFQSRLCAID 217



 Score = 81.4 bits (199), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 31/180 (17%), Positives = 75/180 (41%), Gaps = 19/180 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           N   +  +D+++++D S+S+           ++  + +N +++ + + P+     + GLV
Sbjct: 337 NRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQIVDFLDVSPEG---TRVGLV 387

Query: 225 TFSNKIEEFFLL-EWGVS-HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS+++   F L  +G +  +++ +  +      T +   L++     F      Q    
Sbjct: 388 QFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMERGTMTGLALRHMVEHSFSEA---QGARP 444

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
              N  ++ +  TDG +           +   AK+ G ++YA+G+      E     + P
Sbjct: 445 RALNVPRVGLVFTDGRSQDDIS-----VWAARAKEEGIVMYAVGVGKAVEAELREIASEP 499


>gi|13699830|ref|NP_003824.2| matrilin-4 isoform 1 precursor [Homo sapiens]
 gi|4499937|emb|CAB39280.1| matrilin 4 [Homo sapiens]
          Length = 581

 Score =  129 bits (325), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 44/217 (20%), Positives = 88/217 (40%), Gaps = 27/217 (12%)

Query: 162 VKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQS 221
           +         LD++ V+D SRS+  F      + +   + +  +L  + + P+     + 
Sbjct: 23  LTGPRCHTGPLDLVFVIDSSRSVRPF------EFETMRQFLMGLLRGLNVGPNA---TRV 73

Query: 222 GLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQH 279
           G++ +S++++  F L        ++R I+ L      T +   ++YA N  F +      
Sbjct: 74  GVIQYSSQVQSVFPLRAFSRREDMERAIRDLVPLAQGTMTGLAIQYAMNVAFSVAE---G 130

Query: 280 CNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRAC 339
               +    ++ V +TDG         +      +A+ RG  +YA+G++       LRA 
Sbjct: 131 ARPPEERVPRVAVIVTDGRPQD-----RVAEVAAQARARGIEIYAVGVQRADVGS-LRAM 184

Query: 340 ASP---NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
           ASP      +LVE+    +D     G    ++    D
Sbjct: 185 ASPPLDEHVFLVES----FDLIQEFGLQFQSRLCAID 217



 Score = 81.4 bits (199), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 31/180 (17%), Positives = 75/180 (41%), Gaps = 19/180 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           N   +  +D+++++D S+S+           ++  + +N +++ + + P+     + GLV
Sbjct: 337 NRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQIVDFLDVSPEG---TRVGLV 387

Query: 225 TFSNKIEEFFLL-EWGVS-HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS+++   F L  +G +  +++ +  +      T +   L++     F      Q    
Sbjct: 388 QFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMERGTMTGLALRHMVEHSFSEA---QGARP 444

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
              N  ++ +  TDG +           +   AK+ G ++YA+G+      E     + P
Sbjct: 445 RALNVPRVGLVFTDGRSQDDIS-----VWAARAKEEGIVMYAVGVGKAVEAELREIASEP 499


>gi|13699834|ref|NP_085080.1| matrilin-4 isoform 2 precursor [Homo sapiens]
 gi|119596274|gb|EAW75868.1| matrilin 4, isoform CRA_c [Homo sapiens]
          Length = 540

 Score =  129 bits (325), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 44/217 (20%), Positives = 88/217 (40%), Gaps = 27/217 (12%)

Query: 162 VKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQS 221
           +         LD++ V+D SRS+  F      + +   + +  +L  + + P+     + 
Sbjct: 23  LTGPRCHTGPLDLVFVIDSSRSVRPF------EFETMRQFLMGLLRGLNVGPNA---TRV 73

Query: 222 GLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQH 279
           G++ +S++++  F L        ++R I+ L      T +   ++YA N  F +      
Sbjct: 74  GVIQYSSQVQSVFPLRAFSRREDMERAIRDLVPLAQGTMTGLAIQYAMNVAFSVAE---G 130

Query: 280 CNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRAC 339
               +    ++ V +TDG         +      +A+ RG  +YA+G++       LRA 
Sbjct: 131 ARPPEERVPRVAVIVTDGRPQD-----RVAEVAAQARARGIEIYAVGVQRADVGS-LRAM 184

Query: 340 ASP---NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
           ASP      +LVE+    +D     G    ++    D
Sbjct: 185 ASPPLDEHVFLVES----FDLIQEFGLQFQSRLCAID 217



 Score = 81.4 bits (199), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 31/180 (17%), Positives = 75/180 (41%), Gaps = 19/180 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           N   +  +D+++++D S+S+           ++  + +N +++ + + P+     + GLV
Sbjct: 296 NRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQIVDFLDVSPEG---TRVGLV 346

Query: 225 TFSNKIEEFFLL-EWGVS-HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS+++   F L  +G +  +++ +  +      T +   L++     F      Q    
Sbjct: 347 QFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMERGTMTGLALRHMVEHSFSEA---QGARP 403

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
              N  ++ +  TDG +           +   AK+ G ++YA+G+      E     + P
Sbjct: 404 RALNVPRVGLVFTDGRSQDDIS-----VWAARAKEEGIVMYAVGVGKAVEAELREIASEP 458


>gi|13699836|ref|NP_085095.1| matrilin-4 isoform 3 precursor [Homo sapiens]
          Length = 499

 Score =  129 bits (324), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 44/217 (20%), Positives = 88/217 (40%), Gaps = 27/217 (12%)

Query: 162 VKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQS 221
           +         LD++ V+D SRS+  F      + +   + +  +L  + + P+     + 
Sbjct: 23  LTGPRCHTGPLDLVFVIDSSRSVRPF------EFETMRQFLMGLLRGLNVGPNA---TRV 73

Query: 222 GLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQH 279
           G++ +S++++  F L        ++R I+ L      T +   ++YA N  F +      
Sbjct: 74  GVIQYSSQVQSVFPLRAFSRREDMERAIRDLVPLAQGTMTGLAIQYAMNVAFSVAE---G 130

Query: 280 CNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRAC 339
               +    ++ V +TDG         +      +A+ RG  +YA+G++       LRA 
Sbjct: 131 ARPPEERVPRVAVIVTDGRPQD-----RVAEVAAQARARGIEIYAVGVQRADVGS-LRAM 184

Query: 340 ASP---NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
           ASP      +LVE+    +D     G    ++    D
Sbjct: 185 ASPPLDEHVFLVES----FDLIQEFGLQFQSRLCVRD 217



 Score = 81.4 bits (199), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 31/180 (17%), Positives = 75/180 (41%), Gaps = 19/180 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           N   +  +D+++++D S+S+           ++  + +N +++ + + P+     + GLV
Sbjct: 255 NRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQIVDFLDVSPEG---TRVGLV 305

Query: 225 TFSNKIEEFFLL-EWGVS-HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS+++   F L  +G +  +++ +  +      T +   L++     F      Q    
Sbjct: 306 QFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMERGTMTGLALRHMVEHSFSEA---QGARP 362

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
              N  ++ +  TDG +           +   AK+ G ++YA+G+      E     + P
Sbjct: 363 RALNVPRVGLVFTDGRSQDDIS-----VWAARAKEEGIVMYAVGVGKAVEAELREIASEP 417


>gi|332208765|ref|XP_003253479.1| PREDICTED: LOW QUALITY PROTEIN: matrilin-4-like [Nomascus
           leucogenys]
          Length = 448

 Score =  129 bits (324), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 44/213 (20%), Positives = 87/213 (40%), Gaps = 27/213 (12%)

Query: 166 SQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVT 225
                 LD++ V+D SRS+  F      + +   + +  +L  + + P+     + G++ 
Sbjct: 27  RCHTGPLDLVFVIDSSRSVRPF------EFETMRQFLMGLLRGLNVGPNA---TRVGVIQ 77

Query: 226 FSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           +S++++  F L        ++R I+ L      T +   ++YA N  F +          
Sbjct: 78  YSSQVQSVFPLRAFSRREDMERAIRDLVPLAQGTMTGLAIQYAMNVAFSVAE---GARPP 134

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP- 342
           +    ++ V +TDG         +      +A+ RG  +YA+G++       LRA ASP 
Sbjct: 135 EERVPRVAVIVTDGRPQD-----RVAEVAAQARARGIEIYAVGVQRADVGS-LRAMASPP 188

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
                +LVE+    +D     G    ++    D
Sbjct: 189 LDEHVFLVES----FDLIQEFGLQFQSRLCAID 217


>gi|281182610|ref|NP_001162037.1| matrilin-4 [Pongo abelii]
 gi|134093133|gb|ABO52993.1| matrilin 4 isoform 1 precursor [Pongo abelii]
          Length = 581

 Score =  129 bits (324), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 44/213 (20%), Positives = 87/213 (40%), Gaps = 27/213 (12%)

Query: 166 SQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVT 225
                 LD++ V+D SRS+  F      + +   + +  +L  + + P+     + G++ 
Sbjct: 27  RCHTGPLDLVFVIDSSRSVRPF------EFETMRQFLMGLLRGLNVGPNA---TRVGVIQ 77

Query: 226 FSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           +S++++  F L        ++R I+ L      T +   ++YA N  F +          
Sbjct: 78  YSSQVQSVFPLRAFSRSEDMERAIRDLVPLAQGTMTGLAIQYAMNVAFSVAE---GARPP 134

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP- 342
           +    ++ V +TDG         +      +A+ RG  +YA+G++       LRA ASP 
Sbjct: 135 EERVPRVAVIVTDGRPQD-----RVAEVAAQARARGIEIYAVGVQRADVGS-LRAMASPP 188

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
                +LVE+    +D     G    ++    D
Sbjct: 189 LDEHVFLVES----FDLIQEFGLQFQSRLCAID 217



 Score = 81.4 bits (199), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 31/180 (17%), Positives = 75/180 (41%), Gaps = 19/180 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           N   +  +D+++++D S+S+           ++  + +N +++ + + P+     + GLV
Sbjct: 337 NRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQIVDFLDVSPEG---TRVGLV 387

Query: 225 TFSNKIEEFFLL-EWGVS-HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS+++   F L  +G +  +++ +  +      T +   L++     F      Q    
Sbjct: 388 QFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMERGTMTGLALRHMVEHSFSEA---QGARP 444

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
              N  ++ +  TDG +           +   AK+ G ++YA+G+      E     + P
Sbjct: 445 RALNVPRVGLVFTDGRSQDDIS-----VWAARAKEEGIVMYAVGVGKAVEAELREIASKP 499


>gi|146327011|gb|AAI41812.1| Matrilin 4 [Homo sapiens]
          Length = 540

 Score =  129 bits (324), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 43/217 (19%), Positives = 87/217 (40%), Gaps = 27/217 (12%)

Query: 162 VKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQS 221
           +         LD++ V+D SRS+  F      + +   + +  +L  + + P+     + 
Sbjct: 23  LTGPRCHTGPLDLVFVIDSSRSVRPF------EFETMRQFLMGLLRGLNVGPNA---TRV 73

Query: 222 GLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQH 279
           G++ +S++++  F L        ++R I+ L      T +   ++YA N  F +      
Sbjct: 74  GVIQYSSQVQSVFPLRAFSRREDMERAIRDLVPLAQGTMTGLAIQYAMNVAFSVAE---G 130

Query: 280 CNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRAC 339
               +    ++ V +TDG         +      +A+  G  +YA+G++       LRA 
Sbjct: 131 ARPPEERVPRVAVIVTDGRPQD-----RVAEVAAQARASGIEIYAVGVQRADVGS-LRAM 184

Query: 340 ASP---NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
           ASP      +LVE+    +D     G    ++    D
Sbjct: 185 ASPPLDEHVFLVES----FDLIQEFGLQFQSRLCAID 217



 Score = 81.4 bits (199), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 31/180 (17%), Positives = 75/180 (41%), Gaps = 19/180 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           N   +  +D+++++D S+S+           ++  + +N +++ + + P+     + GLV
Sbjct: 296 NRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQIVDFLDVSPEG---TRVGLV 346

Query: 225 TFSNKIEEFFLL-EWGVS-HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS+++   F L  +G +  +++ +  +      T +   L++     F      Q    
Sbjct: 347 QFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMERGTMTGLALRHMVEHSFSEA---QGARP 403

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
              N  ++ +  TDG +           +   AK+ G ++YA+G+      E     + P
Sbjct: 404 RALNVPRVGLVFTDGRSQDDIS-----VWAARAKEEGIVMYAVGVGKAVEAELREIASEP 458


>gi|3927992|emb|CAA07569.1| matrilin-4 [Homo sapiens]
 gi|124297520|gb|AAI31764.1| Matrilin 4 [Homo sapiens]
 gi|153217472|gb|AAI51220.1| Matrilin 4 [Homo sapiens]
          Length = 581

 Score =  129 bits (324), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 43/217 (19%), Positives = 87/217 (40%), Gaps = 27/217 (12%)

Query: 162 VKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQS 221
           +         LD++ V+D SRS+  F      + +   + +  +L  + + P+     + 
Sbjct: 23  LTGPRCHTGPLDLVFVIDSSRSVRPF------EFETMRQFLMGLLRGLNVGPNA---TRV 73

Query: 222 GLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQH 279
           G++ +S++++  F L        ++R I+ L      T +   ++YA N  F +      
Sbjct: 74  GVIQYSSQVQSVFPLRAFSRREDMERAIRDLVPLAQGTMTGLAIQYAMNVAFSVAE---G 130

Query: 280 CNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRAC 339
               +    ++ V +TDG         +      +A+  G  +YA+G++       LRA 
Sbjct: 131 ARPPEERVPRVAVIVTDGRPQD-----RVAEVAAQARASGIEIYAVGVQRADVGS-LRAM 184

Query: 340 ASP---NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
           ASP      +LVE+    +D     G    ++    D
Sbjct: 185 ASPPLDEHVFLVES----FDLIQEFGLQFQSRLCAID 217



 Score = 81.4 bits (199), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 31/180 (17%), Positives = 75/180 (41%), Gaps = 19/180 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           N   +  +D+++++D S+S+           ++  + +N +++ + + P+     + GLV
Sbjct: 337 NRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQIVDFLDVSPEG---TRVGLV 387

Query: 225 TFSNKIEEFFLL-EWGVS-HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS+++   F L  +G +  +++ +  +      T +   L++     F      Q    
Sbjct: 388 QFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMERGTMTGLALRHMVEHSFSEA---QGARP 444

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
              N  ++ +  TDG +           +   AK+ G ++YA+G+      E     + P
Sbjct: 445 RALNVPRVGLVFTDGRSQDDIS-----VWAARAKEEGIVMYAVGVGKAVEAELREIASEP 499


>gi|119596273|gb|EAW75867.1| matrilin 4, isoform CRA_b [Homo sapiens]
          Length = 620

 Score =  129 bits (324), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 44/218 (20%), Positives = 89/218 (40%), Gaps = 27/218 (12%)

Query: 162 VKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQS 221
           +         LD++ V+D SRS+  F      + +   + +  +L  + + P+     + 
Sbjct: 23  LTGPRCHTGPLDLVFVIDSSRSVRPF------EFETMRQFLMGLLRGLNVGPNA---TRV 73

Query: 222 GLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQH 279
           G++ +S++++  F L        ++R I+ L      T +   ++YA N  F +      
Sbjct: 74  GVIQYSSQVQSVFPLRAFSRREDMERAIRDLVPLAQGTMTGLAIQYAMNVAFSVAE---G 130

Query: 280 CNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRAC 339
               +    ++ V +TDG         +      +A+ RG  +YA+G++       LRA 
Sbjct: 131 ARPPEERVPRVAVIVTDGRPQD-----RVAEVAAQARARGIEIYAVGVQRADVGS-LRAM 184

Query: 340 ASP---NSFYLVENPHSMYDAFSHIGKDIVTKRIWYDK 374
           ASP      +LVE+    +D     G    ++    D+
Sbjct: 185 ASPPLDEHVFLVES----FDLIQEFGLQFQSRLCGKDQ 218



 Score = 81.4 bits (199), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 31/180 (17%), Positives = 75/180 (41%), Gaps = 19/180 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           N   +  +D+++++D S+S+           ++  + +N +++ + + P+     + GLV
Sbjct: 376 NRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQIVDFLDVSPEG---TRVGLV 426

Query: 225 TFSNKIEEFFLL-EWGVS-HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS+++   F L  +G +  +++ +  +      T +   L++     F      Q    
Sbjct: 427 QFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMERGTMTGLALRHMVEHSFSEA---QGARP 483

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
              N  ++ +  TDG +           +   AK+ G ++YA+G+      E     + P
Sbjct: 484 RALNVPRVGLVFTDGRSQDDIS-----VWAARAKEEGIVMYAVGVGKAVEAELREIASEP 538


>gi|73920229|sp|O95460|MATN4_HUMAN RecName: Full=Matrilin-4; Flags: Precursor
 gi|5419632|emb|CAB46380.1| matrilin 4 [Homo sapiens]
          Length = 622

 Score =  129 bits (324), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 44/218 (20%), Positives = 89/218 (40%), Gaps = 27/218 (12%)

Query: 162 VKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQS 221
           +         LD++ V+D SRS+  F      + +   + +  +L  + + P+     + 
Sbjct: 23  LTGPRCHTGPLDLVFVIDSSRSVRPF------EFETMRQFLMGLLRGLNVGPNA---TRV 73

Query: 222 GLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQH 279
           G++ +S++++  F L        ++R I+ L      T +   ++YA N  F +      
Sbjct: 74  GVIQYSSQVQSVFPLRAFSRREDMERAIRDLVPLAQGTMTGLAIQYAMNVAFSVAE---G 130

Query: 280 CNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRAC 339
               +    ++ V +TDG         +      +A+ RG  +YA+G++       LRA 
Sbjct: 131 ARPPEERVPRVAVIVTDGRPQD-----RVAEVAAQARARGIEIYAVGVQRADVGS-LRAM 184

Query: 340 ASP---NSFYLVENPHSMYDAFSHIGKDIVTKRIWYDK 374
           ASP      +LVE+    +D     G    ++    D+
Sbjct: 185 ASPPLDEHVFLVES----FDLIQEFGLQFQSRLCGKDQ 218



 Score = 81.4 bits (199), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 31/180 (17%), Positives = 75/180 (41%), Gaps = 19/180 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           N   +  +D+++++D S+S+           ++  + +N +++ + + P+     + GLV
Sbjct: 378 NRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQIVDFLDVSPEG---TRVGLV 428

Query: 225 TFSNKIEEFFLL-EWGVS-HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS+++   F L  +G +  +++ +  +      T +   L++     F      Q    
Sbjct: 429 QFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMERGTMTGLALRHMVEHSFSEA---QGARP 485

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
              N  ++ +  TDG +           +   AK+ G ++YA+G+      E     + P
Sbjct: 486 RALNVPRVGLVFTDGRSQDDIS-----VWAARAKEEGIVMYAVGVGKAVEAELREIASEP 540


>gi|134093095|gb|ABO52955.1| matrilin 4 isoform 1 precursor [Gorilla gorilla gorilla]
          Length = 581

 Score =  129 bits (323), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 44/217 (20%), Positives = 88/217 (40%), Gaps = 27/217 (12%)

Query: 162 VKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQS 221
           +         LD++ V+D SRS+  F      + +   + +  +L  + + P+     + 
Sbjct: 23  LTGPRCHTGPLDLVFVIDSSRSVRPF------EFETVRQFLMGLLRGLNVGPNA---TRV 73

Query: 222 GLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQH 279
           G++ +S++++  F L        ++R I+ L      T +   ++YA N  F +      
Sbjct: 74  GVIQYSSQVQSVFPLRAFSRREDMERAIRDLVPLAQGTMTGLAIQYAMNVAFSVAE---G 130

Query: 280 CNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRAC 339
               +    ++ V +TDG         +      +A+ RG  +YA+G++       LRA 
Sbjct: 131 ARPPEERVPRVAVIVTDGRPQD-----RVAEVAAQARARGIEIYAVGVQRADVGS-LRAM 184

Query: 340 ASP---NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
           ASP      +LVE+    +D     G    ++    D
Sbjct: 185 ASPPLDEHVFLVES----FDLIQEFGLQFQSRLCAID 217



 Score = 81.4 bits (199), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 31/180 (17%), Positives = 75/180 (41%), Gaps = 19/180 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           N   +  +D+++++D S+S+           ++  + +N +++ + + P+     + GLV
Sbjct: 337 NRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQIVDFLDVSPEG---TRVGLV 387

Query: 225 TFSNKIEEFFLL-EWGVS-HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS+++   F L  +G +  +++ +  +      T +   L++     F      Q    
Sbjct: 388 QFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMERGTMTGLALRHMVEHSFSEA---QGARP 444

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
              N  ++ +  TDG +           +   AK+ G ++YA+G+      E     + P
Sbjct: 445 RALNVPRVGLVFTDGRSQDDIS-----VWAARAKEEGIVMYAVGVGKAVEAELREIASEP 499


>gi|22760140|dbj|BAC11083.1| unnamed protein product [Homo sapiens]
          Length = 540

 Score =  129 bits (323), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 44/217 (20%), Positives = 88/217 (40%), Gaps = 27/217 (12%)

Query: 162 VKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQS 221
           +         LD++ V+D SRS+  F      + +   + +  +L  + + P+     + 
Sbjct: 23  LTGPRCHTGPLDLVFVIDSSRSVRPF------EFETMRQFLMGLLRGLNVGPNA---TRV 73

Query: 222 GLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQH 279
           G++ +S++++  F L        ++R I+ L      T +   ++YA N  F +      
Sbjct: 74  GVIQYSSQVQSVFPLRAFSRREDMERAIRDLVPLAQGTMTGLAIQYAMNVAFSVAE---G 130

Query: 280 CNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRAC 339
               +    ++ V +TDG         +      +A+ RG  +YA+G++       LRA 
Sbjct: 131 ARPPEERVPRVAVIVTDGRPQD-----RVAEVAAQARARGIEIYAVGLQRADVGS-LRAM 184

Query: 340 ASP---NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
           ASP      +LVE+    +D     G    ++    D
Sbjct: 185 ASPPLDEHVFLVES----FDLIQEFGLQFQSRLCAID 217



 Score = 81.4 bits (199), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 31/180 (17%), Positives = 75/180 (41%), Gaps = 19/180 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           N   +  +D+++++D S+S+           ++  + +N +++ + + P+     + GLV
Sbjct: 296 NRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQIVDFLDVSPEG---TRVGLV 346

Query: 225 TFSNKIEEFFLL-EWGVS-HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS+++   F L  +G +  +++ +  +      T +   L++     F      Q    
Sbjct: 347 QFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMERGTMTGLALRHMVEHSFSEA---QGARP 403

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
              N  ++ +  TDG +           +   AK+ G ++YA+G+      E     + P
Sbjct: 404 RALNVPRVGLVFTDGRSQDDIS-----VWAARAKEEGIVMYAVGVGKAVEAELREIASEP 458


>gi|326931809|ref|XP_003212016.1| PREDICTED: matrilin-4-like, partial [Meleagris gallopavo]
          Length = 465

 Score =  128 bits (322), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 44/212 (20%), Positives = 87/212 (41%), Gaps = 27/212 (12%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
                LD++ V+D SRS+  F      + +   + +  ++  + + P+     + G++ +
Sbjct: 28  CRTGPLDIVFVIDSSRSVRPF------EFETMRRFMIDIIGNLDVGPNA---TRVGVIQY 78

Query: 227 SNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
           S++++  F L+   +   ++R I  +      T +   ++YA N  F +Q          
Sbjct: 79  SSQVQNIFSLKTFFTRAEMERAINSIVPLAQGTMTGLAIQYAMNVAFTVQE---GARPPH 135

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP-- 342
               +I + +TDG         +       A+  G  +YA+GI+    +  LRA ASP  
Sbjct: 136 KKIPRIAIIVTDGRPQD-----RVSEVAAHARNAGIEIYAVGIQRADMNS-LRAMASPPL 189

Query: 343 -NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
               +LVE+    ++     GK    K    D
Sbjct: 190 EEHVFLVES----FELIQQFGKQFQDKLCAID 217



 Score = 64.8 bits (156), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 23/138 (16%), Positives = 55/138 (39%), Gaps = 14/138 (10%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
                +D+++V+D S+S+           ++  + +N +++ +++ PD     + GLV +
Sbjct: 339 CGAGHVDLVMVIDGSKSVRP------QNFELVKQFVNRIVDLLEVSPDG---TRVGLVQY 389

Query: 227 SNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
           S+++   F L        ++  +  +      T +   LK+     F      +      
Sbjct: 390 SSRVRTEFPLNKYHSAEEIKEAVMKMEYMEKGTMTGLALKHMVEHSFS---ELEGARPLS 446

Query: 285 ANYKKIIVFMTDGENLST 302
            N  +I +  TDG +   
Sbjct: 447 HNVPRIGLVFTDGRSQDD 464


>gi|118100589|ref|XP_425698.2| PREDICTED: similar to matrilin-4 [Gallus gallus]
          Length = 564

 Score =  128 bits (322), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 44/212 (20%), Positives = 87/212 (41%), Gaps = 27/212 (12%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
                LD++ V+D SRS+  F      + +   + +  ++  + + P+     + G++ +
Sbjct: 28  CRTGPLDIVFVIDSSRSVRPF------EFETMRRFMIDIIGNLDVGPNA---TRVGVIQY 78

Query: 227 SNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
           S++++  F L+   +   ++R I  +      T +   ++YA N  F +Q          
Sbjct: 79  SSQVQNIFSLKTFFTRAEMERAINSIVPLAQGTMTGLAIQYAMNVAFTVQE---GARPPH 135

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP-- 342
               +I + +TDG         +       A+  G  +YA+GI+    +  LRA ASP  
Sbjct: 136 KKIPRIAIIVTDGRPQD-----RVSEVAAHARNAGIEIYAVGIQRADMNS-LRAMASPPL 189

Query: 343 -NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
               +LVE+    ++     GK    K    D
Sbjct: 190 EEHVFLVES----FELIQQFGKQFQDKLCAID 217



 Score = 83.3 bits (204), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 36/203 (17%), Positives = 79/203 (38%), Gaps = 26/203 (12%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           +      +D+++V+D S+S+           ++  + +N +++ +++ PD  +V   GLV
Sbjct: 337 SKCGAGHVDLVMVIDGSKSVRP------QNFELVKQFVNRIVDLLEVSPDGTHV---GLV 387

Query: 225 TFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S+++   F L        ++  +  +      T +   LK+     F      +    
Sbjct: 388 QYSSRVRTEFPLNKYHSAEEIKAAVMKMEYMEKGTMTGLALKHMVEHSFS---ELEGARP 444

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
              N  +I +  TDG +           +   AK+ G +++A+G+      E LRA AS 
Sbjct: 445 LSHNVPRIGLVFTDGRSQDDIS-----EWAQRAKESGIVMFAVGVGKAVEEE-LRAIASE 498

Query: 343 --NSFY----LVENPHSMYDAFS 359
                +           + + F 
Sbjct: 499 PVEQHFSYSADFTTMTHLVENFK 521


>gi|114682165|ref|XP_001154021.1| PREDICTED: matrilin 4 isoform 4 [Pan troglodytes]
 gi|114682167|ref|XP_001154256.1| PREDICTED: matrilin 4 isoform 7 [Pan troglodytes]
 gi|114682175|ref|XP_514674.2| PREDICTED: matrilin 4 isoform 9 [Pan troglodytes]
 gi|114682177|ref|XP_001154315.1| PREDICTED: matrilin-4 isoform 8 [Pan troglodytes]
          Length = 581

 Score =  128 bits (322), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 44/217 (20%), Positives = 88/217 (40%), Gaps = 27/217 (12%)

Query: 162 VKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQS 221
           +         LD++ V+D SRS+  F      + +   + +  +L  + + P+     + 
Sbjct: 23  LTGPRCHTGPLDLVFVIDSSRSVRPF------EFETMRQFLMGLLPGLNVGPNA---TRV 73

Query: 222 GLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQH 279
           G++ +S++++  F L        ++R I+ L      T +   ++YA N  F +      
Sbjct: 74  GVIQYSSQVQSVFPLRAFSRREDMERAIRDLVPLAQGTMTGLAIQYAMNVAFSVAE---G 130

Query: 280 CNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRAC 339
               +    ++ V +TDG         +      +A+ RG  +YA+G++       LRA 
Sbjct: 131 ARPPEERVPRVAVIVTDGRPQD-----RVAEVAAQARARGIEIYAVGVQRADVGS-LRAM 184

Query: 340 ASP---NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
           ASP      +LVE+    +D     G    ++    D
Sbjct: 185 ASPPLDEHVFLVES----FDLIQEFGLQFQSRLCAID 217



 Score = 82.9 bits (203), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 32/180 (17%), Positives = 75/180 (41%), Gaps = 19/180 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           N   +  +D+++++D S+S+           ++  + +N +++ + + P+     + GLV
Sbjct: 337 NRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQIVDFLDVSPEG---TRVGLV 387

Query: 225 TFSNKIEEFFLL-EWGVS-HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS+++   F L  +G +  +++ +  +      T +   L++     F      Q    
Sbjct: 388 QFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMERGTMTGLALRHMVEHSFSEA---QGARP 444

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
              N  ++ +  TDG +           +   AK+ G +VYA+G+      E     + P
Sbjct: 445 RALNVPRVGLVFTDGRSQDDIS-----VWAARAKEEGIVVYAVGVGKAVEAELREIASEP 499


>gi|114682169|ref|XP_001154082.1| PREDICTED: matrilin 4 isoform 5 [Pan troglodytes]
 gi|114682179|ref|XP_001154207.1| PREDICTED: matrilin-4 isoform 6 [Pan troglodytes]
          Length = 540

 Score =  128 bits (322), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 44/217 (20%), Positives = 88/217 (40%), Gaps = 27/217 (12%)

Query: 162 VKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQS 221
           +         LD++ V+D SRS+  F      + +   + +  +L  + + P+     + 
Sbjct: 23  LTGPRCHTGPLDLVFVIDSSRSVRPF------EFETMRQFLMGLLPGLNVGPNA---TRV 73

Query: 222 GLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQH 279
           G++ +S++++  F L        ++R I+ L      T +   ++YA N  F +      
Sbjct: 74  GVIQYSSQVQSVFPLRAFSRREDMERAIRDLVPLAQGTMTGLAIQYAMNVAFSVAE---G 130

Query: 280 CNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRAC 339
               +    ++ V +TDG         +      +A+ RG  +YA+G++       LRA 
Sbjct: 131 ARPPEERVPRVAVIVTDGRPQD-----RVAEVAAQARARGIEIYAVGVQRADVGS-LRAM 184

Query: 340 ASP---NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
           ASP      +LVE+    +D     G    ++    D
Sbjct: 185 ASPPLDEHVFLVES----FDLIQEFGLQFQSRLCAID 217



 Score = 82.9 bits (203), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 32/180 (17%), Positives = 75/180 (41%), Gaps = 19/180 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           N   +  +D+++++D S+S+           ++  + +N +++ + + P+     + GLV
Sbjct: 296 NRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQIVDFLDVSPEG---TRVGLV 346

Query: 225 TFSNKIEEFFLL-EWGVS-HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS+++   F L  +G +  +++ +  +      T +   L++     F      Q    
Sbjct: 347 QFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMERGTMTGLALRHMVEHSFSEA---QGARP 403

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
              N  ++ +  TDG +           +   AK+ G +VYA+G+      E     + P
Sbjct: 404 RALNVPRVGLVFTDGRSQDDIS-----VWAARAKEEGIVVYAVGVGKAVEAELREIASEP 458


>gi|114682171|ref|XP_001153893.1| PREDICTED: matrilin 4 isoform 2 [Pan troglodytes]
 gi|114682181|ref|XP_001153957.1| PREDICTED: matrilin-4 isoform 3 [Pan troglodytes]
          Length = 499

 Score =  128 bits (321), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 44/217 (20%), Positives = 88/217 (40%), Gaps = 27/217 (12%)

Query: 162 VKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQS 221
           +         LD++ V+D SRS+  F      + +   + +  +L  + + P+     + 
Sbjct: 23  LTGPRCHTGPLDLVFVIDSSRSVRPF------EFETMRQFLMGLLPGLNVGPNA---TRV 73

Query: 222 GLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQH 279
           G++ +S++++  F L        ++R I+ L      T +   ++YA N  F +      
Sbjct: 74  GVIQYSSQVQSVFPLRAFSRREDMERAIRDLVPLAQGTMTGLAIQYAMNVAFSVAE---G 130

Query: 280 CNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRAC 339
               +    ++ V +TDG         +      +A+ RG  +YA+G++       LRA 
Sbjct: 131 ARPPEERVPRVAVIVTDGRPQD-----RVAEVAAQARARGIEIYAVGVQRADVGS-LRAM 184

Query: 340 ASP---NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
           ASP      +LVE+    +D     G    ++    D
Sbjct: 185 ASPPLDEHVFLVES----FDLIQEFGLQFQSRLCVRD 217



 Score = 82.9 bits (203), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 32/180 (17%), Positives = 75/180 (41%), Gaps = 19/180 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           N   +  +D+++++D S+S+           ++  + +N +++ + + P+     + GLV
Sbjct: 255 NRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQIVDFLDVSPEG---TRVGLV 305

Query: 225 TFSNKIEEFFLL-EWGVS-HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS+++   F L  +G +  +++ +  +      T +   L++     F      Q    
Sbjct: 306 QFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMERGTMTGLALRHMVEHSFSEA---QGARP 362

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
              N  ++ +  TDG +           +   AK+ G +VYA+G+      E     + P
Sbjct: 363 RALNVPRVGLVFTDGRSQDDIS-----VWAARAKEEGIVVYAVGVGKAVEAELREIASEP 417


>gi|126303381|ref|XP_001379571.1| PREDICTED: similar to matrilin-4 [Monodelphis domestica]
          Length = 623

 Score =  128 bits (321), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 46/241 (19%), Positives = 93/241 (38%), Gaps = 31/241 (12%)

Query: 138 PLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDM 197
           P     FI        +   + ++   +      LD++ V+D SRS+  F      + + 
Sbjct: 5   PYAPLLFILLV----SLNAELQATPAGSKCRTGPLDLVFVIDSSRSVRPF------EFET 54

Query: 198 AIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGV 255
             + +  ++  + + P+     + G++ +S++++  F L        ++R I  +     
Sbjct: 55  MRRFLVNIIRGLDIGPNA---TRVGVIQYSSQVQSVFPLGAFSRREDMERAIHAIVPLAQ 111

Query: 256 STNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEA 315
            T +   ++YA N  F +           A   ++ V +TDG         +      +A
Sbjct: 112 GTMTGLAIQYAMNVAFSVAE---GARPSQARVPRVAVIVTDGRPQD-----RVTEVAAQA 163

Query: 316 KKRGAIVYAIGIRVIRSHEFLRACASP---NSFYLVENPHSMYDAFSHIGKDIVTKRIWY 372
           + RG  +YA+G++       LRA ASP      +LVE+    +D     G     +    
Sbjct: 164 RNRGIEIYAVGVQRADVGS-LRAMASPPLDEHVFLVES----FDLIQQFGFHFQGRLCGV 218

Query: 373 D 373
           D
Sbjct: 219 D 219



 Score = 87.1 bits (214), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 35/187 (18%), Positives = 77/187 (41%), Gaps = 22/187 (11%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           +      +D+++V+D S+S+           ++  + +N +++ + + P+     + GLV
Sbjct: 380 DRCRTGHVDLVLVIDGSKSVRP------QNFELVKRFVNQIVDFLDVSPEG---TRVGLV 430

Query: 225 TFSNKIEEFFLL-EWGVS-HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S+++   F L  +G +  +++ +  +      T +   L++     F      Q    
Sbjct: 431 QYSSRVRTEFPLGRYGTADEVKQAVLAVEYMEKGTMTGLALRHLVEHSFSEA---QGARP 487

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACAS- 341
              N  ++ +  TDG +           +   AK+ G I+YA+G+      E LR  AS 
Sbjct: 488 RAQNVPRVGLVFTDGRSQDDIS-----VWAARAKEEGIIMYAVGVGKAVEEE-LREIASD 541

Query: 342 -PNSFYL 347
            P     
Sbjct: 542 PPEQHVS 548


>gi|134093121|gb|ABO52981.1| matrilin 4 isoform 1 precursor [Callithrix jacchus]
          Length = 580

 Score =  127 bits (320), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 43/213 (20%), Positives = 85/213 (39%), Gaps = 27/213 (12%)

Query: 166 SQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVT 225
                 LD++ V+D SRS+  F      + +   + +  ++  + + P+     + G++ 
Sbjct: 26  RCHTGPLDLVFVIDSSRSVRPF------EFETMRQFLVGLVRGLNVGPNA---TRVGVIQ 76

Query: 226 FSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           +S++++  F L        + R I+ L      T +   ++YA N  F +          
Sbjct: 77  YSSQVQSVFPLRAFSRREDMVRAIRDLVPLAQGTMTGLAIQYAMNVAFSVAE---GARPP 133

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP- 342
           +    ++ V +TDG         +      +A+ RG  +YA+G++       LRA ASP 
Sbjct: 134 EERVPRVAVIVTDGRPQD-----RVAEVAAQARARGIEIYAVGVQRADVGS-LRAMASPP 187

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
                +LVE+    +D     G     +    D
Sbjct: 188 LEEHVFLVES----FDLIQEFGLQFQGRLCAID 216



 Score = 80.2 bits (196), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 28/166 (16%), Positives = 72/166 (43%), Gaps = 19/166 (11%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           +   +  +D+++++D S+S+           ++  + +N +++ + + P+     + GLV
Sbjct: 336 SRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQIVDFLDVSPEG---TRVGLV 386

Query: 225 TFSNKIEEFFLL-EWGVS-HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS+++   F L  +G +  +++ +  +      T +   L++     F      Q    
Sbjct: 387 QFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMERGTMTGLALRHMVEHSFSEA---QGARP 443

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR 328
              N  ++ +  TDG +           +   AK+ G ++YA+G+ 
Sbjct: 444 RALNVPRVGLVFTDGRSQDDIS-----VWAARAKEEGIVMYAVGVG 484


>gi|134093103|gb|ABO52963.1| matrilin 4 isoform 1 precursor [Lemur catta]
          Length = 583

 Score =  127 bits (320), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 44/217 (20%), Positives = 86/217 (39%), Gaps = 27/217 (12%)

Query: 162 VKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQS 221
           V         LD++ V+D SRS+  F      + +   + +  +L  + + P+     + 
Sbjct: 25  VAGPRCHTGPLDLVFVIDSSRSVRPF------EFETVRQFLVGLLHGLNVGPNA---TRV 75

Query: 222 GLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQH 279
           G++ +S++++  F L        ++R I+ L      T +   ++YA N  F +      
Sbjct: 76  GVIQYSSQVQSVFPLGAFSRPEDMERAIRALVPLAQGTMTGLAIQYAMNVAFSVAE---G 132

Query: 280 CNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRAC 339
               +    ++ V +TDG         +      +A+ RG  +YA+G++       LRA 
Sbjct: 133 ARPPEERVPRVAVIVTDGRPQD-----RVAEVAAQARARGIEIYAVGVQRADVGS-LRAM 186

Query: 340 AS---PNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
           AS       +LVE+    +D     G     +    D
Sbjct: 187 ASHPLDEHVFLVES----FDLIQEFGLQFQGRLCAID 219



 Score = 83.7 bits (205), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 32/180 (17%), Positives = 75/180 (41%), Gaps = 19/180 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           N   +  +D+++++D S+S+           ++  + +N +++ + + PD     + GLV
Sbjct: 339 NRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQIVDFLDVSPDG---TRVGLV 389

Query: 225 TFSNKIEEFFLL-EWGVS-HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS+++   F L  +G +  +++ +  +      T +   L++     F      Q    
Sbjct: 390 QFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMERGTMTGLALRHMVEHSFSEA---QGARP 446

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
              N  ++ +  TDG +           +   AK+ G ++YA+G+      E     + P
Sbjct: 447 RALNVPRVGLVFTDGRSQDDIS-----VWAARAKEEGIVMYAVGVGKAVEEELREIASEP 501


>gi|291409921|ref|XP_002721255.1| PREDICTED: matrilin 4 [Oryctolagus cuniculus]
          Length = 346

 Score =  127 bits (319), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 40/209 (19%), Positives = 85/209 (40%), Gaps = 27/209 (12%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
                LD++ V+D SRS+         + +   + +  ++  + + P+     + G++ +
Sbjct: 30  CHTGPLDLVFVIDSSRSVRPL------EFETMRRFLVGLVRSLDVGPNA---TRVGVIQY 80

Query: 227 SNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
           S++++  F L        ++R ++ L      T +   ++YA N  F +          +
Sbjct: 81  SSQVQSVFPLGAFSRREDMERALRTLVPLAQGTMTGLAIQYAMNVAFSVAE---GARPPE 137

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP-- 342
               ++ V +TDG         +      +A+ RG  +YA+G++       LRA ASP  
Sbjct: 138 ERVPRVAVIVTDGRPQD-----RVAEVAAQARARGIEIYAVGVQRADVGS-LRAMASPPL 191

Query: 343 -NSFYLVENPHSMYDAFSHIGKDIVTKRI 370
               +LVE+    +D     G+    +  
Sbjct: 192 DEHVFLVES----FDLIQEFGRQFRGRLC 216


>gi|296200542|ref|XP_002747689.1| PREDICTED: matrilin-4 [Callithrix jacchus]
          Length = 770

 Score =  127 bits (318), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 43/213 (20%), Positives = 85/213 (39%), Gaps = 27/213 (12%)

Query: 166 SQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVT 225
                 LD++ V+D SRS+  F      + +   + +  ++  + + P+     + G++ 
Sbjct: 26  RCHTGPLDLVFVIDSSRSVRPF------EFETMRQFLVGLVRGLNVGPNA---TRVGVIQ 76

Query: 226 FSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           +S++++  F L        + R I+ L      T +   ++YA N  F +          
Sbjct: 77  YSSQVQSVFPLRAFSRREDMVRAIRDLVPLAQGTMTGLAIQYAMNVAFSVAE---GARPP 133

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP- 342
           +    ++ V +TDG         +      +A+ RG  +YA+G++       LRA ASP 
Sbjct: 134 EERVPRVAVIVTDGRPQD-----RVAEVAAQARARGIEIYAVGVQRADVGS-LRAMASPP 187

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
                +LVE+    +D     G     +    D
Sbjct: 188 LEEHVFLVES----FDLIQEFGLQFQGRLCGKD 216



 Score = 81.7 bits (200), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 30/180 (16%), Positives = 75/180 (41%), Gaps = 19/180 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           +   +  +D+++++D S+S+           ++  + +N +++ + + P+     + GLV
Sbjct: 377 SRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQIVDFLDVSPEG---TRVGLV 427

Query: 225 TFSNKIEEFFLL-EWGVS-HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS+++   F L  +G +  +++ +  +      T +   L++     F      Q    
Sbjct: 428 QFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMERGTMTGLALRHMVEHSFSEA---QGARP 484

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
              N  ++ +  TDG +           +   AK+ G ++YA+G+      E     + P
Sbjct: 485 RALNVPRVGLVFTDGRSQDDIS-----VWAARAKEEGIVMYAVGVGKAVEAELREIASEP 539


>gi|224077994|ref|XP_002192008.1| PREDICTED: similar to matrilin 4 [Taeniopygia guttata]
          Length = 580

 Score =  126 bits (317), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 43/212 (20%), Positives = 86/212 (40%), Gaps = 27/212 (12%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
                LD++ V+D SRS+  F      + +   + +  ++  + + P+     + G++ +
Sbjct: 28  CRTGPLDIVFVIDSSRSVRPF------EFETMRRFMMDIIGNLDVGPNA---TRVGVIQY 78

Query: 227 SNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
           S++++  F L+   +   ++R I  +      T +   ++YA N  F  Q          
Sbjct: 79  SSQVQNIFSLKTFFTRADMERAINSIIPLAQGTMTGLAIQYAMNVAFTTQE---GARPLH 135

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP-- 342
               +I + +TDG         +      +A+  G  +YA+GI+    +  LRA ASP  
Sbjct: 136 KRIPRIAIVVTDGRPQD-----RVTEVATQARNAGIEIYAVGIQRADMNS-LRAMASPPL 189

Query: 343 -NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
               +LVE+    ++      K    K    D
Sbjct: 190 EEHVFLVES----FELIQQFAKQFQDKLCAID 217



 Score = 81.0 bits (198), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 35/203 (17%), Positives = 79/203 (38%), Gaps = 26/203 (12%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           +      +D+++V+D S+S+           ++  + +N +++ +++ P      + GLV
Sbjct: 337 SKCGAGHVDLVMVIDGSKSVRP------QNFELVKQFVNRIVDLLEVSPHG---TRVGLV 387

Query: 225 TFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S+++   F L        +++ +  +      T +   LK+     F      +    
Sbjct: 388 QYSSRVRTEFPLNKYHSADEIKKAVMDVEYMEKGTMTGLALKHMVEHSFS---ELEGARP 444

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
              N  +I +  TDG +           +   AK+ G +++A+G+      E LRA AS 
Sbjct: 445 LSYNIPRIGLVFTDGRSQDDIS-----EWARRAKESGIVMFAVGVGKAVEEE-LRAIASE 498

Query: 343 --NSFY----LVENPHSMYDAFS 359
                +           + + FS
Sbjct: 499 PVEQHFSYSADFTTMTHLVENFS 521


>gi|134093165|gb|ABO53025.1| matrilin 4 isoform 1 precursor, 5 prime [Chlorocebus aethiops]
          Length = 214

 Score =  124 bits (312), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 43/210 (20%), Positives = 85/210 (40%), Gaps = 27/210 (12%)

Query: 166 SQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVT 225
                 LD++ V+D SRS+  F      + +   + +  +L  +K+     N  + G++ 
Sbjct: 27  RCHTGPLDLVFVIDSSRSVRPF------EFETMRQFLVGLLRGLKV---GANATRVGVIQ 77

Query: 226 FSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           +S++++  F L        ++R I+ L      T +   ++Y  N  F +          
Sbjct: 78  YSSQVQSVFPLRAFSRREDMERAIRDLVPLAQGTMTGLAIQYVMNVAFSVAE---GARPP 134

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP- 342
           +    ++ V +TDG         +      +A+ RG  +YA+G++       LRA ASP 
Sbjct: 135 EERVPRVAVIVTDGRPQD-----RVAEVAAQARARGIEIYAVGVQRADVGS-LRAMASPP 188

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVTKRI 370
                +LVE+    +D     G    ++  
Sbjct: 189 LDEHVFLVES----FDLIQEFGLQFQSRLC 214


>gi|327271798|ref|XP_003220674.1| PREDICTED: matrilin-4-like [Anolis carolinensis]
          Length = 592

 Score =  124 bits (311), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 43/222 (19%), Positives = 90/222 (40%), Gaps = 27/222 (12%)

Query: 157 PITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVN 216
           P  +  + +      LD++ V+D SRS+  F      + +   + +  ++  + + P+  
Sbjct: 30  PYGTGSQQSKCKTGPLDIVFVIDSSRSVRPF------EFETMRRFMIDIIHNLDIGPNA- 82

Query: 217 NVVQSGLVTFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQ 274
              + G++ +S++++  F L+   +   +++ I  +      T +   ++Y  N  F  Q
Sbjct: 83  --TRVGVIQYSSQVQNVFSLKSFFTRAEMEKAINNIVPLAQGTMTGLAIQYVMNVAFTTQ 140

Query: 275 GMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHE 334
                         ++ V +TDG         +      +A+  G  +YA+G++    + 
Sbjct: 141 E---GARPLHKKIPRVAVIVTDGRPQD-----RVTEVSAQARAAGIEIYAVGVQRADMNS 192

Query: 335 FLRACASP---NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
            LRA ASP      +LVE+    +D     GK    K    D
Sbjct: 193 -LRAMASPALEEHVFLVES----FDLIQQFGKQFQDKLCVID 229



 Score = 88.3 bits (217), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 30/184 (16%), Positives = 72/184 (39%), Gaps = 20/184 (10%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
                +D+++V+D S+S+           ++  + +N +++ + + P      + GLV +
Sbjct: 351 CKAGHIDLVLVIDGSKSVRP------QNFELVKQFVNQIVDFLDVSPHG---TRVGLVQY 401

Query: 227 SNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
           S+++   F L    +   L++ ++ +      T +   LK+     F             
Sbjct: 402 SSRVRTEFPLNKFTTAADLKKAVQRVQYMEKGTMTGLALKHMLEHSFTEAE---GARPLS 458

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP-N 343
            N  +I +  TDG +           +   +K+ G I++A+G+      E     + P +
Sbjct: 459 QNVPRIGLVFTDGRSQDDIS-----EWARRSKEAGIIMFAVGVGKAVESELREIASEPVD 513

Query: 344 SFYL 347
             + 
Sbjct: 514 KHFS 517


>gi|149042955|gb|EDL96529.1| matrilin 4 (predicted), isoform CRA_a [Rattus norvegicus]
          Length = 637

 Score =  124 bits (310), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 41/213 (19%), Positives = 85/213 (39%), Gaps = 27/213 (12%)

Query: 166 SQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVT 225
                 LD++ ++D SRS+  F      + +   + +  +L  + +  +     + G++ 
Sbjct: 42  RCYTGPLDLVFMIDSSRSVRPF------EFETMRQFLVGLLHSLDVGLNA---TRVGVIQ 92

Query: 226 FSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           +S++++  F L        ++R I+ +      T +   ++YA N  F            
Sbjct: 93  YSSQVQSVFPLGAFSNREDMERAIRAVVPLAQGTMTGLAIQYAMNVAFSEAE---GARPS 149

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP- 342
           +    +++V +TDG         +      +A+ RG  +YA+G++       LRA ASP 
Sbjct: 150 EERVPRVLVIVTDGRPQD-----RVAEVAAQARARGIEIYAVGVQRADVGS-LRAMASPP 203

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
                +LVE+    +D     G     +    D
Sbjct: 204 LDQHVFLVES----FDLIQEFGLQFQGRLCGKD 232



 Score = 83.7 bits (205), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 36/194 (18%), Positives = 80/194 (41%), Gaps = 20/194 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           +   +  +D+++++D S+S+           ++  + +N +++ + + P+     + GLV
Sbjct: 393 DRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQIVDFLDVSPEG---TRVGLV 443

Query: 225 TFSNKIEEFFLL-EWGVS-HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS+++   F L  +G +  +++ +  +      T +   L++     F      Q    
Sbjct: 444 QFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMERGTMTGLALRHMVEHSFS---EVQGARP 500

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
            D N  ++ +  TDG +           +   AK+ G ++YA+G+      E LR  AS 
Sbjct: 501 RDLNVPRVGLVFTDGRSQDDIS-----VWAARAKEEGIVMYAVGVGKAVEEE-LREIASE 554

Query: 343 NSFYLVENPHSMYD 356
            S   V        
Sbjct: 555 PSELHVSYSPDFNT 568


>gi|157818269|ref|NP_001100009.1| matrilin-4 [Rattus norvegicus]
 gi|149042956|gb|EDL96530.1| matrilin 4 (predicted), isoform CRA_b [Rattus norvegicus]
          Length = 624

 Score =  124 bits (310), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 41/213 (19%), Positives = 85/213 (39%), Gaps = 27/213 (12%)

Query: 166 SQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVT 225
                 LD++ ++D SRS+  F      + +   + +  +L  + +  +     + G++ 
Sbjct: 29  RCYTGPLDLVFMIDSSRSVRPF------EFETMRQFLVGLLHSLDVGLNA---TRVGVIQ 79

Query: 226 FSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           +S++++  F L        ++R I+ +      T +   ++YA N  F            
Sbjct: 80  YSSQVQSVFPLGAFSNREDMERAIRAVVPLAQGTMTGLAIQYAMNVAFSEAE---GARPS 136

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP- 342
           +    +++V +TDG         +      +A+ RG  +YA+G++       LRA ASP 
Sbjct: 137 EERVPRVLVIVTDGRPQD-----RVAEVAAQARARGIEIYAVGVQRADVGS-LRAMASPP 190

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
                +LVE+    +D     G     +    D
Sbjct: 191 LDQHVFLVES----FDLIQEFGLQFQGRLCGKD 219



 Score = 83.7 bits (205), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 36/194 (18%), Positives = 80/194 (41%), Gaps = 20/194 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           +   +  +D+++++D S+S+           ++  + +N +++ + + P+     + GLV
Sbjct: 380 DRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQIVDFLDVSPEG---TRVGLV 430

Query: 225 TFSNKIEEFFLL-EWGVS-HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS+++   F L  +G +  +++ +  +      T +   L++     F      Q    
Sbjct: 431 QFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMERGTMTGLALRHMVEHSFS---EVQGARP 487

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
            D N  ++ +  TDG +           +   AK+ G ++YA+G+      E LR  AS 
Sbjct: 488 RDLNVPRVGLVFTDGRSQDDIS-----VWAARAKEEGIVMYAVGVGKAVEEE-LREIASE 541

Query: 343 NSFYLVENPHSMYD 356
            S   V        
Sbjct: 542 PSELHVSYSPDFNT 555


>gi|224967060|ref|NP_038620.2| matrilin-4 precursor [Mus musculus]
          Length = 624

 Score =  123 bits (308), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 40/209 (19%), Positives = 84/209 (40%), Gaps = 27/209 (12%)

Query: 170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229
             LD++ ++D SRS+  F      + +   + +  +L  + +  +     + G++ +S++
Sbjct: 33  GPLDLVFMIDSSRSVRPF------EFETMRQFLVGLLRSLDVGLNA---TRVGVIQYSSQ 83

Query: 230 IEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287
           ++  F L        ++R I+ +      T +   ++YA N  F            +   
Sbjct: 84  VQSVFPLGAFSRREDMERAIRAVVPLAQGTMTGLAIQYAMNVAFSEAE---GARPSEERV 140

Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NS 344
            +++V +TDG         +      +A+ RG  +YA+G++       LR  ASP     
Sbjct: 141 PRVLVIVTDGRPQD-----RVAEVAAQARARGIEIYAVGVQRADVGS-LRTMASPPLDQH 194

Query: 345 FYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
            +LVE+    +D     G     +    D
Sbjct: 195 VFLVES----FDLIQEFGLQFQGRLCGKD 219



 Score = 84.1 bits (206), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 31/181 (17%), Positives = 77/181 (42%), Gaps = 19/181 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           +   +  +D+++++D S+S+           ++  + +N +++ + + P+     + GLV
Sbjct: 380 DRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQIVDFLDVSPEG---TRVGLV 430

Query: 225 TFSNKIEEFFLL-EWGVS-HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS+++   F L  +G +  +++ +  +      T +   L++     F      Q    
Sbjct: 431 QFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMERGTMTGLALRHMVEHSFSEA---QGARP 487

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
            D N  ++ +  TDG +           +   AK+ G ++YA+G+      E     + P
Sbjct: 488 RDLNVPRVGLVFTDGRSQDDIS-----VWAARAKEEGIVMYAVGVGKAVEEELREIASEP 542

Query: 343 N 343
           +
Sbjct: 543 S 543


>gi|14548116|sp|O89029|MATN4_MOUSE RecName: Full=Matrilin-4; Short=MAT-4; Flags: Precursor
 gi|3766288|emb|CAA06889.1| matrilin-4 precursor [Mus musculus]
 gi|22477196|gb|AAH36558.1| Matrilin 4 [Mus musculus]
 gi|148674433|gb|EDL06380.1| matrilin 4, isoform CRA_a [Mus musculus]
 gi|148674434|gb|EDL06381.1| matrilin 4, isoform CRA_a [Mus musculus]
          Length = 624

 Score =  123 bits (308), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 40/209 (19%), Positives = 84/209 (40%), Gaps = 27/209 (12%)

Query: 170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229
             LD++ ++D SRS+  F      + +   + +  +L  + +  +     + G++ +S++
Sbjct: 33  GPLDLVFMIDSSRSVRPF------EFETMRQFLVGLLRSLDVGLNA---TRVGVIQYSSQ 83

Query: 230 IEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287
           ++  F L        ++R I+ +      T +   ++YA N  F            +   
Sbjct: 84  VQSVFPLGAFSRREDMERAIRAVVPLAQGTMTGLAIQYAMNVAFSEAE---GARPSEERV 140

Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NS 344
            +++V +TDG         +      +A+ RG  +YA+G++       LR  ASP     
Sbjct: 141 PRVLVIVTDGRPQD-----RVAEVAAQARARGIEIYAVGVQRADVGS-LRTMASPPLDQH 194

Query: 345 FYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
            +LVE+    +D     G     +    D
Sbjct: 195 VFLVES----FDLIQEFGLQFQGRLCGKD 219



 Score = 84.1 bits (206), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 31/181 (17%), Positives = 77/181 (42%), Gaps = 19/181 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           +   +  +D+++++D S+S+           ++  + +N +++ + + P+     + GLV
Sbjct: 380 DRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQIVDFLDVSPEG---TRVGLV 430

Query: 225 TFSNKIEEFFLL-EWGVS-HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS+++   F L  +G +  +++ +  +      T +   L++     F      Q    
Sbjct: 431 QFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMERGTMTGLALRHMVEHSFSEA---QGARP 487

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
            D N  ++ +  TDG +           +   AK+ G ++YA+G+      E     + P
Sbjct: 488 RDLNVPRVGLVFTDGRSQDDIS-----VWAARAKEEGIVMYAVGVGKAVEEELREIASEP 542

Query: 343 N 343
           +
Sbjct: 543 S 543


>gi|301617277|ref|XP_002938060.1| PREDICTED: matrilin-4-like [Xenopus (Silurana) tropicalis]
          Length = 721

 Score =  120 bits (300), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 40/215 (18%), Positives = 87/215 (40%), Gaps = 27/215 (12%)

Query: 164 VNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGL 223
           V       +D++ ++D SRS+  F      + +   K +  ++  +++        + G+
Sbjct: 23  VQKCKSGPMDLVFIIDSSRSVRPF------EFETMRKFMIDIINSLEVGLS---TTRVGV 73

Query: 224 VTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCN 281
           V +S++++  F L+     S +++ I  +      T +   ++YA N  F  +       
Sbjct: 74  VQYSSQVQTVFSLKTFSNKSDMEKAINEIIPLAQGTMTGLAIQYAMNVAFTEEE---GAR 130

Query: 282 TEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACAS 341
               N  ++ + +TDG         +      +A++ G  +YA+G++       LRA AS
Sbjct: 131 PLSKNIPRVAIIVTDGRPQD-----RVTEVAVQAREAGIEIYAVGVQRADVSS-LRAMAS 184

Query: 342 ---PNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
               +  + VE+    +D   H+      K    D
Sbjct: 185 HPLDDHVFHVES----FDLIQHLSIQFQDKLSCVD 215



 Score = 84.4 bits (207), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 43/244 (17%), Positives = 84/244 (34%), Gaps = 38/244 (15%)

Query: 124 NEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPIT-------------SSVKVNSQTDA 170
           NEGY++ A  +  +    C  +      + +  P +                  N  +  
Sbjct: 404 NEGYTLQADGKTCVADDMCNIVDHGCEFKCVSTPGSYYCICPEGQELQADGKTCNKCSTG 463

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
            +D++ V+D S+S+           ++  + +   +  V            GLV +S+++
Sbjct: 464 YIDLVFVIDGSKSVRP------QNFELVKEFV---INIVDSSAISAQGTHIGLVQYSSRV 514

Query: 231 EEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
              F L        ++  +K +      T +   LK+   Q F              N  
Sbjct: 515 RTEFPLSQYTNGQDIKTAVKNIQYMEKGTMTGLALKHMVEQSFSEAE------GARKNVP 568

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NSF 345
           KI +  TDG +           +  +AK+ G  +YA+G+      E     + P   +SF
Sbjct: 569 KIGLVFTDGRSQDDIS-----EWAKKAKEAGITMYAVGVGKAVEDELNEIASDPVNKHSF 623

Query: 346 YLVE 349
           Y  +
Sbjct: 624 YTAD 627


>gi|301626452|ref|XP_002942405.1| PREDICTED: collagen alpha-6(VI) chain-like [Xenopus (Silurana)
            tropicalis]
          Length = 2615

 Score =  119 bits (297), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 52/208 (25%), Positives = 92/208 (44%), Gaps = 29/208 (13%)

Query: 166  SQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVT 225
            + +  +LD++ ++D S S+ S   S+ T     +K I      V       N V+ G+  
Sbjct: 1396 ACSHEQLDLVFLIDGSASITS---SNFTSAKTFMKEI------VDSFTISENRVRIGVAQ 1446

Query: 226  FSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
            +S   ++ F L   +  S ++++I  +S+   +T +  GL++   Q FD        N  
Sbjct: 1447 YSANPKKEFFLNEYYSSSDMKKQIDSISQLKATTYTGKGLRF-VKQFFD------PANGG 1499

Query: 284  DANYKKIIVFMTDG-ENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
              N  + ++ MTDG  N S  ED  +L      +  G  +++IGI +  S E +    SP
Sbjct: 1500 RKNVPQYLIVMTDGMSNDSVNEDAAAL------RSSGVKIFSIGIGLRNSFELVMIAGSP 1553

Query: 343  NSFYLVENPHSMYDAFSHIGKDIVTKRI 370
             + Y VE     + A   I + IV +  
Sbjct: 1554 KNVYEVET----FQALDSIKRQIVAQVC 1577



 Score = 92.9 bits (229), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 47/275 (17%), Positives = 92/275 (33%), Gaps = 31/275 (11%)

Query: 103  FVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKI---PLKFCTFIPWYTNSRHIVMPIT 159
            F     +I   T LDI+       +  +  S  ++     +    +      +   +P  
Sbjct: 766  FAVGFQNI-NDTELDIIASHPPRKHVTNVESFLQLSNLEFRIQKRLCNEIVVKSFAVPAI 824

Query: 160  SSVKVNSQ-TDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNV 218
            +             D+  ++D S S+       + K          M+E + +     N 
Sbjct: 825  ARAVKEGCVDTEEADIYFLIDGSGSIYPEDFEDMKKF---------MIELISMFQVGANR 875

Query: 219  VQSGLVTFSN-KIEEFFLLEWGVSHL-QRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGM 276
            V+ G+V +S+ +  EFF+ E     + +  I  + + G  T +   L        +    
Sbjct: 876  VRFGVVQYSDVRRTEFFISEHNTQKMLKDAISQIEQLGGGTLTGEALTSMKQLFVNAAKD 935

Query: 277  RQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFL 336
            R H         + +V +TDGE        +      E +  G  ++AIG++     E  
Sbjct: 936  RPHK------VPQSLVVITDGE-----SQDRVTEAAAEIRNDGITIFAIGVKNAVEEEIR 984

Query: 337  RACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIW 371
                S    + V N    +D+   I  D+  +   
Sbjct: 985  DIAGSNEKMFFVNN----FDSLKVIKNDLARELCT 1015



 Score = 84.8 bits (208), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 41/205 (20%), Positives = 82/205 (40%), Gaps = 23/205 (11%)

Query: 163  KVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSG 222
               +  + + D++ ++D S S+ S         +   + + +M+++ ++ PD    VQ G
Sbjct: 1015 TPEACKNMKADIVFLVDSSASINS------DDYETMKEFMESMVKQAEIGPD---RVQIG 1065

Query: 223  LVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHC 280
            L+ FS++ +E F L        +Q  I+ + +    T     LKY        +G     
Sbjct: 1066 LIQFSSETKEEFPLNRYKRKDEIQSAIRGIQQLSQGTLMGEALKYTLPYFSASKG----- 1120

Query: 281  NTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA 340
                 N K+ ++ +TDGE                 +  G I+YAIG++   + + L    
Sbjct: 1121 --GRVNTKQYLIVITDGE-----AQDAVGNPAKAIRDHGVIIYAIGVQQANNTQLLEIAG 1173

Query: 341  SPNSFYLVENPHSMYDAFSHIGKDI 365
                 Y  ++  S+     +I  +I
Sbjct: 1174 KQEQVYYEDSFDSLAFLNKNIMFEI 1198



 Score = 66.3 bits (160), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 44/216 (20%), Positives = 97/216 (44%), Gaps = 22/216 (10%)

Query: 151  SRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVK 210
            +++I+  I +  +   +T+   D++ +LD S S+         +  +  + + A++ +  
Sbjct: 1191 NKNIMFEICNPQESCKKTEVA-DIIFLLDASASIT------RGEFRLMQRFVEAVVNDSL 1243

Query: 211  LIPDVNNVVQSGLVTF-SNKIEEFFLLEWGVS-HLQRKIKYLSKFGVSTNSTPGLKYAYN 268
            +  D    VQ G V + +N  E+F L  +     + + +  L +    T +   L+Y   
Sbjct: 1244 VGKDN---VQFGAVVYGTNPAEQFSLNTYSTKLDILKAVFSLPQVSGYTYTAKALEYTRI 1300

Query: 269  QIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEA-KKRGAIVYAIGI 327
            +     G R   +        I++ +TDG   +T+ D+ +L   ++A K  G IV+A+G+
Sbjct: 1301 RFGTSYGGRPGISH-------ILILVTDG--ATTEADRPNLPIVSKALKDDGIIVFAVGV 1351

Query: 328  RVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGK 363
                  E  +    P+ ++LV+N   + +   +I +
Sbjct: 1352 GKAVPQELQQIAGYPDRWFLVQNYKGLDNIHDNITQ 1387



 Score = 65.2 bits (157), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 37/203 (18%), Positives = 73/203 (35%), Gaps = 26/203 (12%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI-E 231
           D++ ++D S S+                 +  ++    +  D    +Q GL+ +S+    
Sbjct: 33  DIVFLMDGSWSIG------TENFITMKNFLYTLVNGFDVGLDK---IQIGLIQYSDNART 83

Query: 232 EFFLLEW-GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKI 290
           EFFL  +     + + I+ L   G  T +   L++    +          +       +I
Sbjct: 84  EFFLNSYSNKEDVLKYIQNLKYKGGGTKTGLSLEF----MLTQHFSEAAGSRAAEGVPQI 139

Query: 291 IVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPN--SFYLV 348
            V +TDG+                 K  G I+YAIGI+     E     + P+    Y V
Sbjct: 140 AVVITDGQ-----AQDSIREPAIAVKNAGIILYAIGIKDAVLSELNEIASDPDDKHVYSV 194

Query: 349 ENPHSMYDAFSHIGKDIVTKRIW 371
            +    ++A   I ++++     
Sbjct: 195 AD----FNALQSISQNMIQVLCT 213



 Score = 62.5 bits (150), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 37/231 (16%), Positives = 90/231 (38%), Gaps = 30/231 (12%)

Query: 129 ISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARL----------DMMIVL 178
           I++    K       F    + S++++  + ++V+  ++   ++          D+++++
Sbjct: 182 IASDPDDKHVYSVADFNALQSISQNMIQVLCTTVEEAARQTGQIAQVCRTANQADIVLLV 241

Query: 179 DVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEW 238
           + +  M               K+ N + + V  +    N ++ GLVT++++    FLL  
Sbjct: 242 ESTTRMGD---------ATFEKAKNFLYDLVSNLDVGINKIRIGLVTYNDETNPEFLLNS 292

Query: 239 GVSHLQ--RKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTD 296
             S  +    I+ +      T +   L+Y     F      +     + +  +I++ +T+
Sbjct: 293 YSSKTEILESIQNMKYVEGYTYTGRALEYVNTTYFTQAAGSRF----EESVAQILIIVTE 348

Query: 297 GENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYL 347
           G++  T           E K RG  VY +G  +    +   A + P+  + 
Sbjct: 349 GDSSDT-----LTEPAKELKSRGISVYVVGTNIKYDRQLQEASSKPDEKFF 394



 Score = 57.5 bits (137), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 38/203 (18%), Positives = 77/203 (37%), Gaps = 22/203 (10%)

Query: 157 PITSSVKVNSQTDARL-DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDV 215
               SV     + A + D++ ++D S S+    +  +T++         + + V  +   
Sbjct: 615 FSPVSVVPAVCSSASVADIVFLIDESSSIGP-INFQLTRV--------FLHKVVSALDIS 665

Query: 216 NNVVQSGLVTFSNKIEEFFLLEWGVSHLQ--RKIKYLSKFGVSTNSTPGLKYAYNQIFDM 273
            + V+ GLV +S++      L       +    I  L   G   ++   L +   ++F  
Sbjct: 666 LSNVRVGLVLYSDEPRLELKLNTFNEKYEILDFITKLPYRGGKAHTGAALDFLRKKMFT- 724

Query: 274 QGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSH 333
              +Q+        ++I V MT+G+++             + ++ G  V+A+G + I   
Sbjct: 725 ---KQNGGRPHQGVQQIAVVMTNGQSMDNFT-----KPAAKLRRSGVEVFAVGFQNINDT 776

Query: 334 EFLRACASPNSFYLVENPHSMYD 356
           E L   AS      V N  S   
Sbjct: 777 E-LDIIASHPPRKHVTNVESFLQ 798



 Score = 52.8 bits (125), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 40/237 (16%), Positives = 83/237 (35%), Gaps = 28/237 (11%)

Query: 116 LDIVVVPQNEGY-----SISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQ--T 168
           + + VV  N  Y       S+    K   +   F      +  ++  +  S+ +N Q  +
Sbjct: 367 ISVYVVGTNIKYDRQLQEASSKPDEKFFYQLDDFDDSENVTEQLLKNLCFSIDLNIQVYS 426

Query: 169 DARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
               D++ ++D S SM + F             I  ++ ++ +  +     + GL  +S 
Sbjct: 427 KRYADVVFLVDSSTSMGTIF------FQKMKDFIIHIINQLNVGINK---HRIGLAQYSG 477

Query: 229 KIEEFFLLEW--GVSHLQRKIKY-LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDA 285
             +  FLL        + + IK   +  G    +   L++     F ++      N  + 
Sbjct: 478 LPQTEFLLNHYETKEEILKHIKETFTYRGGPLKTGHALEF-VRSTFFIEEAGSRINYGN- 535

Query: 286 NYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
              + +V +T     S+K +     +  E K  G    ++GI      E  +    P
Sbjct: 536 --PQFLVVIT-----SSKSEDAVRRHAEELKSVGVTTISVGIGNSDRKELEKIATDP 585


>gi|149410544|ref|XP_001506183.1| PREDICTED: similar to protocadherin 9, partial [Ornithorhynchus
           anatinus]
          Length = 588

 Score =  116 bits (290), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 45/203 (22%), Positives = 87/203 (42%), Gaps = 24/203 (11%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           +S    RLD++ V+D SRS+           +   + I  +L+ + + PD   V + GL+
Sbjct: 3   SSCDSKRLDLIFVIDSSRSVRPH------DFEKVKEFIVTILQFLDVAPD---VTRVGLI 53

Query: 225 TFSNKIEEFFLL-EWG-VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            + + ++  F L  +G  S ++R +K + + G  T +   ++YA N  F           
Sbjct: 54  QYGSTVKNEFSLKTYGRKSEVERAVKVMKRLGTGTMTGLAIQYAVNIAFSESE---GARP 110

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
              N  +II+ +TDG                +A+  G +++AIG+  +  +      + P
Sbjct: 111 LRENVPRIIMIVTDGRPQDP-----VAEVAAKARNSGILIFAIGVGQVDYNTLKSIGSKP 165

Query: 343 --NSFYLVEN---PHSMYDAFSH 360
             +  +LV N     S+   F +
Sbjct: 166 HQDHVFLVANFSQIESLTSVFQN 188


>gi|147906540|ref|NP_001087052.1| von Willebrand factor A domain-containing protein 2 precursor
           [Xenopus laevis]
 gi|82235697|sp|Q6DCQ6|VWA2_XENLA RecName: Full=von Willebrand factor A domain-containing protein 2;
           AltName: Full=A domain-containing protein similar to
           matrilin and collagen; Short=AMACO; Flags: Precursor
 gi|50415038|gb|AAH77945.1| MGC80919 protein [Xenopus laevis]
          Length = 790

 Score =  115 bits (287), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 62/245 (25%), Positives = 98/245 (40%), Gaps = 38/245 (15%)

Query: 133 SRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSI 192
             Y  P +    +P       +   I S + V       LD+  VLD S ++        
Sbjct: 499 VTYSNPQQLFNQLP------QLQKRICS-IDVQGCQAQPLDLAFVLDASTAVG------- 544

Query: 193 TKIDMAIKSINAMLEEVKLIPDVN-NVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKY 249
                    +   +  V L  D+N +V Q GLVT+S++ E  F L+     S L + I  
Sbjct: 545 ---QEKFNRLKNFVTMVSLQFDINRDVTQIGLVTYSSRPETVFGLDTHDSGSSLLQGIGR 601

Query: 250 LSKFGVSTNSTPGLKYAYNQIFDMQ-GMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQS 308
            S  G S ++   L   YN +  +Q G R   N       K +V +TDG        + +
Sbjct: 602 ASYMGGSASTGSALLRVYNDVMTVQKGARPGVN-------KAVVVITDGRGA-----EDA 649

Query: 309 LYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                + +  G +VY IGI  I+ +  LR   S    +L+  P   Y++  H  +D V +
Sbjct: 650 AVPAQKLRDNGIMVYVIGIGNIQRNSLLRLAGSEK--FLISVPS--YESLGHY-EDSVVQ 704

Query: 369 RIWYD 373
           R+  D
Sbjct: 705 RVCED 709



 Score = 66.3 bits (160), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 39/214 (18%), Positives = 79/214 (36%), Gaps = 25/214 (11%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           S+     +  + LD++I+LD S S+      S  +       +         +   ++++
Sbjct: 37  SAAGRRMRCSSPLDILILLDGSNSIG---RGSFERSKHFASKL------CDALDIGSDLI 87

Query: 220 QSGLVTFSNKIEEFFLLEWGVSH--LQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + G + +S   +  F L+   S   ++ KIK +   G  T +   LKY           +
Sbjct: 88  RVGAMQYSGAPQVEFRLDSSFSKAAIKEKIKSIVFKGGPTETGLALKYIV--------WK 139

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                  A+  KI++ ++DG     K          + K     V+ +G++  R  E L 
Sbjct: 140 GFPGGRPASVPKILIIVSDG-----KSQGNIKLPAAQIKGEDIEVFTVGVKFPRWEE-LH 193

Query: 338 ACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIW 371
           A +S      V     + DA + +   +    + 
Sbjct: 194 ALSSEPQEAHVLFAEHVDDAVNGLATSLTNSSLC 227



 Score = 47.5 bits (111), Expect = 0.004,   Method: Composition-based stats.
 Identities = 26/197 (13%), Positives = 71/197 (36%), Gaps = 22/197 (11%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           +D++ ++D S           T ++  ++  + +   ++      + +  G+  +SN+++
Sbjct: 341 IDLLFLVDSS---------DTTSLEAFMQHKSFLKRFIQASLSDESPLNVGVAQYSNEVQ 391

Query: 232 EFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
               +     ++ L + I  +   G    +   L+Y     F    +         +  +
Sbjct: 392 MVVKIGEYQSMAELLKHIDNMRFMGGGLFTGKALRYVTQYGFKSTPVFSDV---RDDLPR 448

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSH-EFLRACASPNSFYLV 348
           ++V +T      +K           A+ +   V+ IG+    +  E      +P +    
Sbjct: 449 LVVLLT-----GSKSQDSVTGPATYARDQ--EVFLIGVTSDSNKGEMAEIVGNPLNLVTY 501

Query: 349 ENPHSMYDAFSHIGKDI 365
            NP  +++    + K I
Sbjct: 502 SNPQQLFNQLPQLQKRI 518


>gi|327269537|ref|XP_003219550.1| PREDICTED: matrilin-2-like [Anolis carolinensis]
          Length = 809

 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 38/212 (17%), Positives = 88/212 (41%), Gaps = 24/212 (11%)

Query: 156 MPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDV 215
           +  +S +     +D RLD++ ++D SRS+  +        +   + I  +L+ + + PD 
Sbjct: 2   LFYSSFLPEEFCSDKRLDLVFIIDSSRSVRPY------DFEKVKEFILNILQFLDIRPD- 54

Query: 216 NNVVQSGLVTFSNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM 273
             V + GL+ + + ++  F L+       ++R ++ +      T +   +++A N  F  
Sbjct: 55  --VTRVGLIQYGSTVKNEFSLKTFARKQDMERAVRRMMYLSTGTMTGLAIQFAVNIAFSE 112

Query: 274 QGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSH 333
                       N  ++I+ +TDG                +A+  G +++AIG+  +  +
Sbjct: 113 TE---GARPLSQNVPRVIMIVTDGRPQDP-----VAEIAAKARNSGILIFAIGVGRVDMN 164

Query: 334 EFLRACASP--NSFYLVEN---PHSMYDAFSH 360
                 + P  +  +LV N     ++   F +
Sbjct: 165 TLKSIGSEPYEDHVFLVANFSQIETLTSVFQN 196



 Score = 97.1 bits (240), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 37/210 (17%), Positives = 83/210 (39%), Gaps = 25/210 (11%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              T+  +D++ V+D S+S+       +   ++  + +  +L+ + + P      + GL+
Sbjct: 569 KGCTEGPVDLVFVIDGSKSLG------VNNFEIVKEFVLGILDSLTISPKAA---RIGLL 619

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S ++   F L+   +   +++ +  +   G  + +   LK    + F      +H   
Sbjct: 620 QYSTQVRTEFTLKQFSTATDMKKAVSQMKYMGKGSMTGLALKQMTERSFTEAEGARHL-- 677

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
             A   ++ V  TDG         +   +  +AK+RG  +YAIGI      E     + P
Sbjct: 678 -SAKVPRVCVVFTDGR-----AQDEVSEWAAKAKQRGITMYAIGIGKAIEEELREIASDP 731

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVTKRI 370
                +  E+    + A   I + +  +  
Sbjct: 732 PEKHLFYAED----FSAMGEITEKLQKRMC 757


>gi|224046544|ref|XP_002198814.1| PREDICTED: matrilin 2 [Taeniopygia guttata]
          Length = 902

 Score =  107 bits (267), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 43/202 (21%), Positives = 85/202 (42%), Gaps = 24/202 (11%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           NS  +  LD++ ++D SRS+  +        +   + I  +L+ + + PD  +V   GL+
Sbjct: 7   NSCNNKHLDLVFIIDSSRSVSHY------DFEKVKEFILTILQFLDISPDATHV---GLI 57

Query: 225 TFSNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            + + +++ F L+       ++R +K +   G  T +   L+YA N  F           
Sbjct: 58  QYGSTVKQEFSLKTFRRKQDIERAVKRMMHLGTGTMTGLALQYAVNIAFSETE---GARP 114

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
              N  +II+ +TDG                +A+  G +++AIG+  +  +      + P
Sbjct: 115 LRQNVPRIIMIVTDGRPQDP-----VAEIAAKARNSGILIFAIGVGRVDMNTLKSIGSEP 169

Query: 343 --NSFYLVEN---PHSMYDAFS 359
                +LV N     ++  AF 
Sbjct: 170 HEEHVFLVANFSQIETLTSAFQ 191



 Score = 77.5 bits (189), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 39/209 (18%), Positives = 84/209 (40%), Gaps = 25/209 (11%)

Query: 166 SQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVT 225
             T+  +D++ V+D S+S+           ++  + ++ +L+ +++ P      + GL+ 
Sbjct: 606 RCTEGPIDLVFVIDGSKSLGE------DNFEIVKQFVSGILDTLEISPKAA---RVGLLQ 656

Query: 226 FSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           +S ++   F L    S   +++ +  +   G  + +   L+    + F            
Sbjct: 657 YSTEVRTEFTLRQFSSAKDMKKAVSQMKYMGRGSMTGLALRQMSERSFTETE---GARPF 713

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP- 342
            AN  +I +  TDG         +   +   AK+RG I+YAIGI      E L   + P 
Sbjct: 714 SANVPRISIVFTDGR-----AQDEVSEWATRAKQRGIIIYAIGIGKAIEEELLEIASEPS 768

Query: 343 -NSFYLVENPHSMYDAFSHIGKDIVTKRI 370
               +  E+    + A   I +++  +  
Sbjct: 769 YKHLFYAED----FTALEDISEELRAQIC 793


>gi|118087212|ref|XP_424219.2| PREDICTED: similar to matrilin 2 [Gallus gallus]
          Length = 1799

 Score =  107 bits (267), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 39/206 (18%), Positives = 85/206 (41%), Gaps = 24/206 (11%)

Query: 161 SVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQ 220
           S+  N+  + RLD++ ++D SRS+  +        +   + I  +L+ + + PD     +
Sbjct: 20  SLLENTCNNKRLDLVFIIDSSRSVRPY------DFEKVKEFILTILQFLDVSPDA---TR 70

Query: 221 SGLVTFSNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQ 278
            GL+ + + ++  F L+       ++R ++ +      T +   ++YA N  F       
Sbjct: 71  VGLIQYGSTVKHEFSLKTFRRKQEIERAVRRMMHLATGTMTGLAIQYAVNIAFSESE--- 127

Query: 279 HCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRA 338
                + N  +II+ +TDG                +A+  G +++AIG+  +  +     
Sbjct: 128 GARPLNQNVPRIIMIVTDGRPQDPVG-----EIAAKARNSGILIFAIGVGRVDMNTLKSI 182

Query: 339 CASP--NSFYLVEN---PHSMYDAFS 359
            + P     +LV N     ++   F 
Sbjct: 183 GSEPHEEHIFLVANFSQIETLTSVFQ 208



 Score = 79.4 bits (194), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 38/209 (18%), Positives = 86/209 (41%), Gaps = 25/209 (11%)

Query: 166  SQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVT 225
              T+  +D++ V+D S+S+           ++  + ++ +L+ +++ P      + GL+ 
Sbjct: 1482 RCTEGPVDLVFVIDGSKSLGE------DNFEIVKQFVSGILDTLEISPKAA---RVGLLQ 1532

Query: 226  FSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
            +S+++   F L    +   +++ +  +   G  + +   LK  + + F            
Sbjct: 1533 YSSEVRTEFTLRRFSTAKDMKKAVSQMKYMGRGSMTGLALKQMFERSFTETE---GARPL 1589

Query: 284  DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP- 342
             AN  +I +  TDG     +   +   +   AK+ G I+YAIGI      E L   + P 
Sbjct: 1590 SANIPRISIVFTDG-----RAQDEVSEWAARAKRSGIIIYAIGIGKAIEEELLEIASEPS 1644

Query: 343  -NSFYLVENPHSMYDAFSHIGKDIVTKRI 370
                +  E+    + A   I +++  +  
Sbjct: 1645 YKHLFYAED----FTAMEDISEELKVQIC 1669


>gi|22760136|dbj|BAC11081.1| unnamed protein product [Homo sapiens]
          Length = 488

 Score =  107 bits (266), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 35/181 (19%), Positives = 72/181 (39%), Gaps = 21/181 (11%)

Query: 198 AIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGV 255
             + +  +L  + + P+     + G++ +S++++  F L        ++R I+ L     
Sbjct: 1   MRQFLMGLLRGLNVGPNA---TRVGVIQYSSQVQSVFPLRAFSRREDMERAIRDLVPLAQ 57

Query: 256 STNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEA 315
            T +   ++YA N  F +          +    ++ V +TDG         +      +A
Sbjct: 58  GTMTGLAIQYAMNVAFSVAE---GARPPEERVPRVAVIVTDGRPQD-----RVAEVAAQA 109

Query: 316 KKRGAIVYAIGIRVIRSHEFLRACASP---NSFYLVENPHSMYDAFSHIGKDIVTKRIWY 372
           +  G  +YA+G++       LRA ASP      +LVE+    +D     G    ++    
Sbjct: 110 RASGIEIYAVGVQRADVGS-LRAMASPPLDEHVFLVES----FDLIQEFGLQFQSRLCAI 164

Query: 373 D 373
           D
Sbjct: 165 D 165



 Score = 81.4 bits (199), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 31/180 (17%), Positives = 75/180 (41%), Gaps = 19/180 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           N   +  +D+++++D S+S+           ++  + +N +++ + + P+     + GLV
Sbjct: 244 NRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQIVDFLDVSPEG---TRVGLV 294

Query: 225 TFSNKIEEFFLL-EWGVS-HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS+++   F L  +G +  +++ +  +      T +   L++     F      Q    
Sbjct: 295 QFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMERGTMTGLALRHMVEHSFSEA---QGARP 351

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
              N  ++ +  TDG +           +   AK+ G ++YA+G+      E     + P
Sbjct: 352 RALNVPRVGLVFTDGRSQDDIS-----VWAARAKEEGIVMYAVGVGKAVEAELREIASEP 406


>gi|47208832|emb|CAF90336.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 443

 Score =  106 bits (265), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 45/297 (15%), Positives = 105/297 (35%), Gaps = 35/297 (11%)

Query: 82  ILCRIKNTWNMSFRNELRDNGFVNDIDDIVRS--TSLDIVVVPQNEGYSISA-------I 132
              +   ++   F  + + +   N +     +    L  +  P N    ++        I
Sbjct: 122 DFYQPHQSFKSHFSYKPKASCPKNLVPTFSSAPVAPLPTIPSPPNPTVQLTTPPAPLATI 181

Query: 133 SRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSI 192
           +   +P++         ++    +    +   +S     LD++ ++D SRS+     S  
Sbjct: 182 TPEVLPVETSAPATLSVSTFTTTVSAVETETDSSCLSRPLDLVFIIDSSRSVR---PSEF 238

Query: 193 TKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYL 250
            K+ +       + + V  +    +  +  +V +++ ++  FLL+      +L++ I  +
Sbjct: 239 EKVKIF------LADMVDTLDVGADATRVAVVNYASTVKTEFLLKDHFNKPNLKKAISRI 292

Query: 251 SKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLY 310
                 T +   +K A ++ F  Q           N  K+ + +TDG      E+  +  
Sbjct: 293 EPLATGTMTGLAIKTAVSEAFTEQ---SGARPRPRNIAKVAIIVTDGRPQDQVEEVSAA- 348

Query: 311 YCNEAKKRGAIVYAIGIRVIRSHEFLRACAS---PNSFYLVEN---PHSMYDAFSHI 361
               A+  G  +YA+G+        L+  AS    +  + VE       +   F   
Sbjct: 349 ----ARASGVEIYAVGVDRADMRS-LQLMASVPLEDHVFYVETYGVIEKLTSKFRET 400


>gi|114682173|ref|XP_001153832.1| PREDICTED: matrilin 4 isoform 1 [Pan troglodytes]
          Length = 488

 Score =  106 bits (264), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 36/181 (19%), Positives = 73/181 (40%), Gaps = 21/181 (11%)

Query: 198 AIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGV 255
             + +  +L  + + P+     + G++ +S++++  F L        ++R I+ L     
Sbjct: 1   MRQFLMGLLPGLNVGPNA---TRVGVIQYSSQVQSVFPLRAFSRREDMERAIRDLVPLAQ 57

Query: 256 STNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEA 315
            T +   ++YA N  F +          +    ++ V +TDG         +      +A
Sbjct: 58  GTMTGLAIQYAMNVAFSVAE---GARPPEERVPRVAVIVTDGRPQD-----RVAEVAAQA 109

Query: 316 KKRGAIVYAIGIRVIRSHEFLRACASP---NSFYLVENPHSMYDAFSHIGKDIVTKRIWY 372
           + RG  +YA+G++       LRA ASP      +LVE+    +D     G    ++    
Sbjct: 110 RARGIEIYAVGVQRADVGS-LRAMASPPLDEHVFLVES----FDLIQEFGLQFQSRLCAI 164

Query: 373 D 373
           D
Sbjct: 165 D 165



 Score = 82.9 bits (203), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 32/180 (17%), Positives = 75/180 (41%), Gaps = 19/180 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           N   +  +D+++++D S+S+           ++  + +N +++ + + P+     + GLV
Sbjct: 244 NRCREGHVDLVLLVDGSKSVRP------QNFELVKRFVNQIVDFLDVSPEG---TRVGLV 294

Query: 225 TFSNKIEEFFLL-EWGVS-HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS+++   F L  +G +  +++ +  +      T +   L++     F      Q    
Sbjct: 295 QFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMERGTMTGLALRHMVEHSFSEA---QGARP 351

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
              N  ++ +  TDG +           +   AK+ G +VYA+G+      E     + P
Sbjct: 352 RALNVPRVGLVFTDGRSQDDIS-----VWAARAKEEGIVVYAVGVGKAVEAELREIASEP 406


>gi|218678237|ref|ZP_03526134.1| hypothetical protein RetlC8_04927 [Rhizobium etli CIAT 894]
          Length = 120

 Score =  106 bits (263), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 31/111 (27%), Positives = 42/111 (37%), Gaps = 7/111 (6%)

Query: 265 YAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKE-----DQQSLYYCNEAKKRG 319
            A N   +      H        KK IVFMTDG+N +        D  +   C++AK +G
Sbjct: 4   TAKNAAGNDAEDAAHKLKTGQIPKKYIVFMTDGDNNNDSSGGRSYDTATKKTCDDAKSKG 63

Query: 320 AIVYAIGIRVIR-SHEFLRACASPNSFYL-VENPHSMYDAFSHIGKDIVTK 368
             +Y I           L  CAS +S Y   E    +  AF  IG     +
Sbjct: 64  IEIYTIAFMAPAGGQALLHYCASDDSHYFQAEKMEDLLAAFEAIGAKSAAQ 114


>gi|47212423|emb|CAF93579.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 688

 Score =  104 bits (260), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 41/212 (19%), Positives = 82/212 (38%), Gaps = 30/212 (14%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
                +D++ ++D SRS+         + +   +    M++ +  +    N  + G+V +
Sbjct: 1   CRSGPVDLLFLIDSSRSVRPH------EFETMRRF---MIDILNTLDIGLNSTRVGVVQY 51

Query: 227 SNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
           S+++   F L     +  + + I+ +      T +   ++Y  N  F           + 
Sbjct: 52  SSQVRSEFSLRSHASLDSMVKAIQEMVPLAQGTMTGLAIRYTMNVAFTAAE------GDR 105

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP-- 342
                ++V +TDG         +      EA++RG  +YA+G+        LRA ASP  
Sbjct: 106 PKVPNVVVIVTDGRPQD-----RVAEVAAEARERGMEIYAVGVARADMTS-LRAMASPPF 159

Query: 343 -NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
            +  +LVE+    +D     G     K    D
Sbjct: 160 EDHVFLVES----FDLIHQFGLQFQDKLCGAD 187



 Score = 57.1 bits (136), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 27/185 (14%), Positives = 60/185 (32%), Gaps = 44/185 (23%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINA---------MLEE------- 208
            +   A +D+++++D S+S+           ++  K +N          +LE+       
Sbjct: 436 GTCKSANIDLVLLIDGSKSVRP------QNFELVKKFVNQGPEPDEGSWLLEDMEKRPER 489

Query: 209 ------------VKLIPDVNNVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFG 254
                       V  +       + GLV +S+++   F L        ++  +  +    
Sbjct: 490 KTWRHLRFSCWVVDSLDVSPQGTRVGLVQYSSRVRTEFPLSMYHSAQEIKAAVMKVEYME 549

Query: 255 VSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNE 314
             T +   LK+     F              +  +I +  TDG +           +  +
Sbjct: 550 KGTMTGLALKHMLENSFSEAE---GARPARRHVPRIGLVFTDGRSQDDIS-----EHARK 601

Query: 315 AKKRG 319
           AK+ G
Sbjct: 602 AKEAG 606


>gi|26349121|dbj|BAC38200.1| unnamed protein product [Mus musculus]
          Length = 280

 Score =  103 bits (257), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 46/218 (21%), Positives = 95/218 (43%), Gaps = 26/218 (11%)

Query: 151 SRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVK 210
            RH+ M   +++  +S  + R D+  ++D SRS+ ++  + +       + I  +L+ + 
Sbjct: 35  GRHVRMYPQTALLESSCENKRADLAFIIDSSRSVNTYHYAKV------KEFILDILQFLD 88

Query: 211 LIPDVNNVVQSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYN 268
           + PD   V + GL+ + + ++  F L+     S ++R +K +      T +   ++YA N
Sbjct: 89  IGPD---VTRVGLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYALN 145

Query: 269 QIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR 328
             F              N  +II+ +TDG                +A+  G +++AIG+ 
Sbjct: 146 IAFSEAE---GARPLRENVPRIIMIVTDGRPQD-----SVAEVAAKARNTGILIFAIGVG 197

Query: 329 VIRSHEFLRACASP---NSFYLVEN---PHSMYDAFSH 360
            +  +  L+A  S    +  +LV N     S+   F +
Sbjct: 198 QVDLNT-LKAIGSEPHKDHVFLVANFSQIESLTSVFQN 234


>gi|47205231|emb|CAG06181.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 427

 Score =  103 bits (257), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 37/215 (17%), Positives = 81/215 (37%), Gaps = 26/215 (12%)

Query: 155 VMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPD 214
                S    +S  +  +D++ ++D SRS+        T+ + A + +  +++ +++  D
Sbjct: 36  PSSTVSPASGSSCRNGPIDLVFIVDSSRSVRP------TEFEKAKEFLQDLVDSLEVGLD 89

Query: 215 VNNVVQSGLVTFSNKIEEFFLLEWGVSH--LQRKIKYLSKFGVSTNSTPGLKYAYNQIFD 272
                + GLV +++ +   F L+   S   L+  +  +      T +   ++ A  + F 
Sbjct: 90  S---TRVGLVNYASTVRMEFPLKAHFSKPALKGALARVEPLASGTMTGLAIRTAVEKAFA 146

Query: 273 MQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRS 332
            +              ++ V +TDG      E   +      A++ G  +YA+G+     
Sbjct: 147 AE---AGARLNSTKVARVAVVVTDGRPQDEVERVSAA-----ARESGIEIYAVGVDRADR 198

Query: 333 HEFLRACAS---PNSFYLVEN---PHSMYDAFSHI 361
              LR  AS    +  + VE       +   F   
Sbjct: 199 TS-LRLMASQPHEDHVFYVETYGVIEKLTSRFRET 232


>gi|149721558|ref|XP_001490961.1| PREDICTED: matrilin 2 isoform 1 [Equus caballus]
          Length = 956

 Score =  103 bits (257), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 42/209 (20%), Positives = 90/209 (43%), Gaps = 26/209 (12%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           +++  +S  + R D++ ++D SRS+ +   + +       + I  +L+ + + PD   V 
Sbjct: 44  TALLESSCENKRADVVFIIDSSRSVNTHDYAKV------KEFIVDILQFLDIGPD---VT 94

Query: 220 QSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + GL+ + + ++  F L+     S ++R +K +      T +   ++YA N  F      
Sbjct: 95  RVGLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYALNIAFSEAE-- 152

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                   N  ++I+ +TDG                +A+  G +++AIG+  +     L+
Sbjct: 153 -GARPLRENVPRVIMIVTDGRPQD-----SVAEVAAKARDTGILIFAIGVGQVD-FNTLK 205

Query: 338 ACAS---PNSFYLVEN---PHSMYDAFSH 360
           A  S    +  +LV N     S+   F +
Sbjct: 206 AIGSEPHEDHVFLVANFSQMESLTSVFQN 234



 Score = 94.5 bits (233), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 33/207 (15%), Positives = 80/207 (38%), Gaps = 21/207 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              T+  +D++ V+D S+S+           ++  + +  +++ + + P      + GL+
Sbjct: 647 KRCTEGPIDLVFVIDGSKSLGE------ENFEIVKQFVTGIIDSLAISPKAA---RVGLL 697

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S ++   F L    S   +++ + ++   G  + +   LK+ + + F           
Sbjct: 698 QYSTQVRTEFTLRNFGSAKDMKKAVAHMKYMGKGSMTGLALKHMFERSFTQVE---GARP 754

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
             A   ++ +  TDG             + ++AK  G  +YA+G+      E     + P
Sbjct: 755 LSARVPRVAIVFTDGR-----AQDDVSEWASKAKANGITMYAVGVGKAIEEELQEIASEP 809

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVT 367
                +  E+  +M +    + K I  
Sbjct: 810 IDKHLFYAEDFSTMGEINEKLKKGICE 836


>gi|149721562|ref|XP_001490991.1| PREDICTED: matrilin 2 isoform 2 [Equus caballus]
          Length = 915

 Score =  103 bits (257), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 42/209 (20%), Positives = 90/209 (43%), Gaps = 26/209 (12%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           +++  +S  + R D++ ++D SRS+ +   + +       + I  +L+ + + PD   V 
Sbjct: 44  TALLESSCENKRADVVFIIDSSRSVNTHDYAKV------KEFIVDILQFLDIGPD---VT 94

Query: 220 QSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + GL+ + + ++  F L+     S ++R +K +      T +   ++YA N  F      
Sbjct: 95  RVGLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYALNIAFSEAE-- 152

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                   N  ++I+ +TDG                +A+  G +++AIG+  +     L+
Sbjct: 153 -GARPLRENVPRVIMIVTDGRPQD-----SVAEVAAKARDTGILIFAIGVGQVD-FNTLK 205

Query: 338 ACAS---PNSFYLVEN---PHSMYDAFSH 360
           A  S    +  +LV N     S+   F +
Sbjct: 206 AIGSEPHEDHVFLVANFSQMESLTSVFQN 234



 Score = 94.5 bits (233), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 33/207 (15%), Positives = 80/207 (38%), Gaps = 21/207 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              T+  +D++ V+D S+S+           ++  + +  +++ + + P      + GL+
Sbjct: 606 KRCTEGPIDLVFVIDGSKSLGE------ENFEIVKQFVTGIIDSLAISPKAA---RVGLL 656

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S ++   F L    S   +++ + ++   G  + +   LK+ + + F           
Sbjct: 657 QYSTQVRTEFTLRNFGSAKDMKKAVAHMKYMGKGSMTGLALKHMFERSFTQVE---GARP 713

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
             A   ++ +  TDG             + ++AK  G  +YA+G+      E     + P
Sbjct: 714 LSARVPRVAIVFTDGR-----AQDDVSEWASKAKANGITMYAVGVGKAIEEELQEIASEP 768

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVT 367
                +  E+  +M +    + K I  
Sbjct: 769 IDKHLFYAEDFSTMGEINEKLKKGICE 795


>gi|13529371|gb|AAH05429.1| Matn2 protein [Mus musculus]
          Length = 956

 Score =  103 bits (257), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 46/218 (21%), Positives = 95/218 (43%), Gaps = 26/218 (11%)

Query: 151 SRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVK 210
            RH+ M   +++  +S  + R D++ ++D SRS+ +   + +       + I  +L+ + 
Sbjct: 35  GRHVRMYPQTALLESSCENKRADLVFIIDSSRSVNTHDYAKV------KEFILDILQFLD 88

Query: 211 LIPDVNNVVQSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYN 268
           + PD   V + GL+ + + ++  F L+     S ++R +K +      T +   ++YA N
Sbjct: 89  IGPD---VTRVGLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYALN 145

Query: 269 QIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR 328
             F              N  +II+ +TDG                +A+  G +++AIG+ 
Sbjct: 146 IAFSEAE---GARPLRENVPRIIMIVTDGRPQD-----SVAEVAAKARNTGILIFAIGVG 197

Query: 329 VIRSHEFLRACASP---NSFYLVEN---PHSMYDAFSH 360
            +  +  L+A  S    +  +LV N     S+   F +
Sbjct: 198 QVDLNT-LKAIGSEPHKDHVFLVANFSQIESLTSVFQN 234



 Score = 96.8 bits (239), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 31/207 (14%), Positives = 77/207 (37%), Gaps = 21/207 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              T+  +D++ V+D S+S+           +     +  +++ + + P      + GL+
Sbjct: 647 KRCTEGPIDLVFVIDGSKSLGE------ENFETVKHFVTGIIDSLAVSPKAA---RVGLL 697

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S ++   F L    S   +++ + ++   G  + +   LK+ + + F           
Sbjct: 698 QYSTQVRTEFTLRGFSSAKEMKKAVAHMKYMGKGSMTGLALKHMFERSFTQVE---GARP 754

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                 ++ +  TDG             + ++AK  G  +YA+G+      E     + P
Sbjct: 755 PSTQVPRVAIVFTDGR-----AQDDVSEWASKAKANGITMYAVGVGKAIEEELQEIASEP 809

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVT 367
                +  E+  +M +    + + I  
Sbjct: 810 IDKHLFYAEDFSTMGEISEKLKEGICE 836


>gi|148676905|gb|EDL08852.1| matrilin 2, isoform CRA_a [Mus musculus]
          Length = 836

 Score =  103 bits (257), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 46/218 (21%), Positives = 96/218 (44%), Gaps = 26/218 (11%)

Query: 151 SRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVK 210
            RH+ M   +++  +S  + R D++ ++D SRS+ ++  + +       + I  +L+ + 
Sbjct: 61  GRHVRMYPQTALLESSCENKRADLVFIIDSSRSVNTYDYAKV------KEFILDILQFLD 114

Query: 211 LIPDVNNVVQSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYN 268
           + PD   V + GL+ + + ++  F L+     S ++R +K +      T +   ++YA N
Sbjct: 115 IGPD---VTRVGLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYALN 171

Query: 269 QIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR 328
             F              N  +II+ +TDG                +A+  G +++AIG+ 
Sbjct: 172 IAFSEAE---GARPLRENVPRIIMIVTDGRPQD-----SVAEVAAKARNTGILIFAIGVG 223

Query: 329 VIRSHEFLRACASP---NSFYLVEN---PHSMYDAFSH 360
            +  +  L+A  S    +  +LV N     S+   F +
Sbjct: 224 QVDLNT-LKAIGSEPHKDHVFLVANFSQIESLTSVFQN 260



 Score = 78.7 bits (192), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 23/157 (14%), Positives = 60/157 (38%), Gaps = 19/157 (12%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              T+  +D++ V+D S+S+           +     +  +++ + + P      + GL+
Sbjct: 673 KRCTEGPIDLVFVIDGSKSLGE------ENFETVKHFVTGIIDSLAVSPKAA---RVGLL 723

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S ++   F L    S   +++ + ++   G  + +   LK+ + + F           
Sbjct: 724 QYSTQVRTEFTLRGFSSAKEMKKAVTHMKYMGKGSMTGLALKHMFERSFTQVE---GARP 780

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRG 319
                 ++ +  TDG     +       + ++AK  G
Sbjct: 781 PSTQVPRVAIVFTDG-----RAQDDVSEWASKAKANG 812


>gi|148676906|gb|EDL08853.1| matrilin 2, isoform CRA_b [Mus musculus]
          Length = 941

 Score =  103 bits (257), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 46/218 (21%), Positives = 96/218 (44%), Gaps = 26/218 (11%)

Query: 151 SRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVK 210
            RH+ M   +++  +S  + R D++ ++D SRS+ ++  + +       + I  +L+ + 
Sbjct: 35  GRHVRMYPQTALLESSCENKRADLVFIIDSSRSVNTYDYAKV------KEFILDILQFLD 88

Query: 211 LIPDVNNVVQSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYN 268
           + PD   V + GL+ + + ++  F L+     S ++R +K +      T +   ++YA N
Sbjct: 89  IGPD---VTRVGLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYALN 145

Query: 269 QIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR 328
             F              N  +II+ +TDG                +A+  G +++AIG+ 
Sbjct: 146 IAFSEAE---GARPLRENVPRIIMIVTDGRPQD-----SVAEVAAKARNTGILIFAIGVG 197

Query: 329 VIRSHEFLRACASP---NSFYLVEN---PHSMYDAFSH 360
            +  +  L+A  S    +  +LV N     S+   F +
Sbjct: 198 QVDLNT-LKAIGSEPHKDHVFLVANFSQIESLTSVFQN 234



 Score = 96.8 bits (239), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 31/207 (14%), Positives = 77/207 (37%), Gaps = 21/207 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              T+  +D++ V+D S+S+           +     +  +++ + + P      + GL+
Sbjct: 647 KRCTEGPIDLVFVIDGSKSLGE------ENFETVKHFVTGIIDSLAVSPKAA---RVGLL 697

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S ++   F L    S   +++ + ++   G  + +   LK+ + + F           
Sbjct: 698 QYSTQVRTEFTLRGFSSAKEMKKAVTHMKYMGKGSMTGLALKHMFERSFTQVE---GARP 754

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                 ++ +  TDG             + ++AK  G  +YA+G+      E     + P
Sbjct: 755 PSTQVPRVAIVFTDGR-----AQDDVSEWASKAKANGITMYAVGVGKAIEEELQEIASEP 809

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVT 367
                +  E+  +M +    + + I  
Sbjct: 810 IDKHLFYAEDFSTMGEISEKLKEGICE 836


>gi|120407045|ref|NP_058042.2| matrilin-2 [Mus musculus]
          Length = 937

 Score =  103 bits (257), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 46/218 (21%), Positives = 96/218 (44%), Gaps = 26/218 (11%)

Query: 151 SRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVK 210
            RH+ M   +++  +S  + R D++ ++D SRS+ ++  + +       + I  +L+ + 
Sbjct: 35  GRHVRMYPQTALLESSCENKRADLVFIIDSSRSVNTYDYAKV------KEFILDILQFLD 88

Query: 211 LIPDVNNVVQSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYN 268
           + PD   V + GL+ + + ++  F L+     S ++R +K +      T +   ++YA N
Sbjct: 89  IGPD---VTRVGLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYALN 145

Query: 269 QIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR 328
             F              N  +II+ +TDG                +A+  G +++AIG+ 
Sbjct: 146 IAFSEAE---GARPLRENVPRIIMIVTDGRPQD-----SVAEVAAKARNTGILIFAIGVG 197

Query: 329 VIRSHEFLRACASP---NSFYLVEN---PHSMYDAFSH 360
            +  +  L+A  S    +  +LV N     S+   F +
Sbjct: 198 QVDLNT-LKAIGSEPHKDHVFLVANFSQIESLTSVFQN 234



 Score = 96.8 bits (239), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 31/207 (14%), Positives = 77/207 (37%), Gaps = 21/207 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              T+  +D++ V+D S+S+           +     +  +++ + + P      + GL+
Sbjct: 647 KRCTEGPIDLVFVIDGSKSLGE------ENFETVKHFVTGIIDSLAVSPKAA---RVGLL 697

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S ++   F L    S   +++ + ++   G  + +   LK+ + + F           
Sbjct: 698 QYSTQVRTEFTLRGFSSAKEMKKAVTHMKYMGKGSMTGLALKHMFERSFTQVE---GARP 754

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                 ++ +  TDG             + ++AK  G  +YA+G+      E     + P
Sbjct: 755 PSTQVPRVAIVFTDGR-----AQDDVSEWASKAKANGITMYAVGVGKAIEEELQEIASEP 809

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVT 367
                +  E+  +M +    + + I  
Sbjct: 810 IDKHLFYAEDFSTMGEISEKLKEGICE 836


>gi|20136122|gb|AAM11539.1| matrilin-2 [Mus musculus]
          Length = 956

 Score =  103 bits (257), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 46/218 (21%), Positives = 96/218 (44%), Gaps = 26/218 (11%)

Query: 151 SRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVK 210
            RH+ M   +++  +S  + R D++ ++D SRS+ ++  + +       + I  +L+ + 
Sbjct: 35  GRHVRMYPQTALLESSCENKRADLVFIIDSSRSVNTYDYAKV------KEFILDILQFLD 88

Query: 211 LIPDVNNVVQSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYN 268
           + PD   V + GL+ + + ++  F L+     S ++R +K +      T +   ++YA N
Sbjct: 89  IGPD---VTRVGLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYALN 145

Query: 269 QIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR 328
             F              N  +II+ +TDG                +A+  G +++AIG+ 
Sbjct: 146 IAFSEAE---GARPLRENVPRIIMIVTDGRPQD-----SVAEVAAKARNTGILIFAIGVG 197

Query: 329 VIRSHEFLRACASP---NSFYLVEN---PHSMYDAFSH 360
            +  +  L+A  S    +  +LV N     S+   F +
Sbjct: 198 QVDLNT-LKAIGSEPHKDHVFLVANFSQIESLTSVFQN 234



 Score = 96.8 bits (239), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 31/207 (14%), Positives = 77/207 (37%), Gaps = 21/207 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              T+  +D++ V+D S+S+           +     +  +++ + + P      + GL+
Sbjct: 647 KRCTEGPIDLVFVIDGSKSLGE------ENFETVKHFVTGIIDSLAVSPKAA---RVGLL 697

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S ++   F L    S   +++ + ++   G  + +   LK+ + + F           
Sbjct: 698 QYSTQVRTEFTLRGFSSAKEMKKAVTHMKYMGKGSMTGLALKHMFERSFTQVE---GARP 754

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                 ++ +  TDG             + ++AK  G  +YA+G+      E     + P
Sbjct: 755 PSTQVPRVAIVFTDGR-----AQDDVSEWASKAKANGITMYAVGVGKAIEEELQEIASEP 809

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVT 367
                +  E+  +M +    + + I  
Sbjct: 810 IDKHLFYAEDFSTMGEISEKLKEGICE 836


>gi|62185620|gb|AAH92298.1| Matrilin 2 [Mus musculus]
          Length = 937

 Score =  103 bits (257), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 46/218 (21%), Positives = 96/218 (44%), Gaps = 26/218 (11%)

Query: 151 SRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVK 210
            RH+ M   +++  +S  + R D++ ++D SRS+ ++  + +       + I  +L+ + 
Sbjct: 35  GRHVRMYPQTALLESSCENKRADLVFIIDSSRSVNTYDYAKV------KEFILDILQFLD 88

Query: 211 LIPDVNNVVQSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYN 268
           + PD   V + GL+ + + ++  F L+     S ++R +K +      T +   ++YA N
Sbjct: 89  IGPD---VTRVGLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYALN 145

Query: 269 QIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR 328
             F              N  +II+ +TDG                +A+  G +++AIG+ 
Sbjct: 146 IAFSEAE---GARPLRENVPRIIMIVTDGRPQD-----SVAEVAAKARNTGILIFAIGVG 197

Query: 329 VIRSHEFLRACASP---NSFYLVEN---PHSMYDAFSH 360
            +  +  L+A  S    +  +LV N     S+   F +
Sbjct: 198 QVDLNT-LKAIGSEPHKDHVFLVANFSQIESLTSVFQN 234



 Score = 96.8 bits (239), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 31/207 (14%), Positives = 77/207 (37%), Gaps = 21/207 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              T+  +D++ V+D S+S+           +     +  +++ + + P      + GL+
Sbjct: 647 KRCTEGPIDLVFVIDGSKSLGE------ENFETVKHFVTGIIDSLAVSPKAA---RVGLL 697

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S ++   F L    S   +++ + ++   G  + +   LK+ + + F           
Sbjct: 698 QYSTQVRTEFTLRGFSSAKEMKKAVTHMKYMGKGSMTGLALKHMFERSFTQVE---GARP 754

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                 ++ +  TDG             + ++AK  G  +YA+G+      E     + P
Sbjct: 755 PSTQVPRVAIVFTDGR-----AQDDVSEWASKAKANGITMYAVGVGKAIEEELQEIASEP 809

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVT 367
                +  E+  +M +    + + I  
Sbjct: 810 IDKHLFYAEDFSTMGEISEKLKEGICE 836


>gi|74202868|dbj|BAE37504.1| unnamed protein product [Mus musculus]
          Length = 928

 Score =  103 bits (257), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 46/218 (21%), Positives = 96/218 (44%), Gaps = 26/218 (11%)

Query: 151 SRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVK 210
            RH+ M   +++  +S  + R D++ ++D SRS+ ++  + +       + I  +L+ + 
Sbjct: 35  GRHVRMYPQTALLESSCENKRADLVFIIDSSRSVNTYDYAKV------KEFILDILQFLD 88

Query: 211 LIPDVNNVVQSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYN 268
           + PD   V + GL+ + + ++  F L+     S ++R +K +      T +   ++YA N
Sbjct: 89  IGPD---VTRVGLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYALN 145

Query: 269 QIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR 328
             F              N  +II+ +TDG                +A+  G +++AIG+ 
Sbjct: 146 IAFSEAE---GARPLRENVPRIIMIVTDGRPQD-----SVAEVAAKARNTGILIFAIGVG 197

Query: 329 VIRSHEFLRACASP---NSFYLVEN---PHSMYDAFSH 360
            +  +  L+A  S    +  +LV N     S+   F +
Sbjct: 198 QVDLNT-LKAIGSEPHKDHVFLVANFSQIESLTSVFQN 234



 Score = 96.8 bits (239), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 31/207 (14%), Positives = 77/207 (37%), Gaps = 21/207 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              T+  +D++ V+D S+S+           +     +  +++ + + P      + GL+
Sbjct: 647 KRCTEGPIDLVFVIDGSKSLGE------ENFETVKHFVTGIIDSLAVSPKAA---RVGLL 697

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S ++   F L    S   +++ + ++   G  + +   LK+ + + F           
Sbjct: 698 QYSTQVRTEFTLRGFSSAKEMKKAVTHMKYMGKGSMTGLALKHMFERSFTQVE---GARP 754

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                 ++ +  TDG             + ++AK  G  +YA+G+      E     + P
Sbjct: 755 PSTQVPRVAIVFTDGR-----AQDDVSEWASKAKANGITMYAVGVGKAIEEELQEIASEP 809

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVT 367
                +  E+  +M +    + + I  
Sbjct: 810 IDKHLFYAEDFSTMGEISEKLKEGICE 836


>gi|7387906|sp|O08746|MATN2_MOUSE RecName: Full=Matrilin-2; Flags: Precursor
 gi|2072792|gb|AAC53163.1| matrilin-2 precursor [Mus musculus]
          Length = 956

 Score =  103 bits (257), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 46/218 (21%), Positives = 96/218 (44%), Gaps = 26/218 (11%)

Query: 151 SRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVK 210
            RH+ M   +++  +S  + R D++ ++D SRS+ ++  + +       + I  +L+ + 
Sbjct: 35  GRHVRMYPQTALLESSCENKRADLVFIIDSSRSVNTYDYAKV------KEFILDILQFLD 88

Query: 211 LIPDVNNVVQSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYN 268
           + PD   V + GL+ + + ++  F L+     S ++R +K +      T +   ++YA N
Sbjct: 89  IGPD---VTRVGLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYALN 145

Query: 269 QIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR 328
             F              N  +II+ +TDG                +A+  G +++AIG+ 
Sbjct: 146 IAFSEAE---GARPLRENVPRIIMIVTDGRPQD-----SVAEVAAKARNTGILIFAIGVG 197

Query: 329 VIRSHEFLRACASP---NSFYLVEN---PHSMYDAFSH 360
            +  +  L+A  S    +  +LV N     S+   F +
Sbjct: 198 QVDLNT-LKAIGSEPHKDHVFLVANFSQIESLTSVFQN 234



 Score = 96.8 bits (239), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 31/207 (14%), Positives = 77/207 (37%), Gaps = 21/207 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              T+  +D++ V+D S+S+           +     +  +++ + + P      + GL+
Sbjct: 647 KRCTEGPIDLVFVIDGSKSLGE------ENFETVKHFVTGIIDSLAVSPKAA---RVGLL 697

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S ++   F L    S   +++ + ++   G  + +   LK+ + + F           
Sbjct: 698 QYSTQVRTEFTLRGFSSAKEMKKAVTHMKYMGKGSMTGLALKHMFERSFTQVE---GARP 754

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                 ++ +  TDG             + ++AK  G  +YA+G+      E     + P
Sbjct: 755 PSTQVPRVAIVFTDGR-----AQDDVSEWASKAKANGITMYAVGVGKAIEEELQEIASEP 809

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVT 367
                +  E+  +M +    + + I  
Sbjct: 810 IDKHLFYAEDFSTMGEISEKLKEGICE 836


>gi|218458490|ref|ZP_03498581.1| von Willebrand factor type A [Rhizobium etli Kim 5]
          Length = 220

 Score =  102 bits (255), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 35/235 (14%), Positives = 71/235 (30%), Gaps = 53/235 (22%)

Query: 26  FLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCR 85
             P++    GM + V  +   K  L                +         L  G I   
Sbjct: 1   MAPVLLGAAGMAVHVGDMLLSKQQLQEAA------------DSAALATATALANGKIQTS 48

Query: 86  IKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDI--VVVPQNEGYSISAISRYKIPLKFCT 143
               +  +F      N ++    DI   TS+++      ++  Y ++    Y + +    
Sbjct: 49  EAEAYARNFVAGQMAN-YLQSGVDIKGGTSVNVQTSTSGKSTSYQVTVSPSYDLSVNPLM 107

Query: 144 FIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMES--------------FFD 189
               +  ++H+    T+ V  +SQT   + M + LD S SM                 +D
Sbjct: 108 QAVGF-KTQHLSTSGTT-VGGHSQTQGSISMFLALDKSGSMGESTATVNEDDPTETFTYD 165

Query: 190 SSI----------------------TKIDMAIKSINAMLEEVKLIPDVNNVVQSG 222
            ++                      TKI+    +   +  ++         V++G
Sbjct: 166 CNLHYNSKNNKWVYDKCTGSRTNYYTKIEALKIAAGNLFSQLNSADPNAQYVRTG 220


>gi|45384196|ref|NP_990403.1| matrilin-3 precursor [Gallus gallus]
 gi|14548115|sp|O42401|MATN3_CHICK RecName: Full=Matrilin-3; Flags: Precursor
 gi|2326444|emb|CAA03885.1| matrilin-3 [Gallus gallus]
          Length = 452

 Score =  102 bits (253), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 30/205 (14%), Positives = 78/205 (38%), Gaps = 26/205 (12%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
            +  +  LD++ ++D SRS+         + +     ++ M++ + +        +  ++
Sbjct: 46  TACKNRPLDLVFIIDSSRSVRP------EEFEKVKIFLSKMIDTLDVGE---RTTRVAVM 96

Query: 225 TFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +++ ++  F L      + ++  +  +      T +   ++ A +++F  +        
Sbjct: 97  NYASTVKVEFPLRTYFDKASMKEAVSRIQPLSAGTMTGLAIQAAMDEVFTEE---MGTRP 153

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACAS- 341
            + N  K+++ +TDG      E+  +      A+  G  +YA+G+        LR  AS 
Sbjct: 154 ANFNIPKVVIIVTDGRPQDQVENVAA-----NARTAGIEIYAVGVGRADMQS-LRIMASE 207

Query: 342 --PNSFYLVEN---PHSMYDAFSHI 361
                 + VE       +   F   
Sbjct: 208 PLDEHVFYVETYGVIEKLTSKFRET 232


>gi|26350291|dbj|BAC38785.1| unnamed protein product [Mus musculus]
          Length = 810

 Score =  101 bits (252), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 45/218 (20%), Positives = 95/218 (43%), Gaps = 26/218 (11%)

Query: 151 SRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVK 210
            RH+ M   +++  +S  + R D++ ++D SRS+ ++  + +       + I  +L+ + 
Sbjct: 35  GRHVRMYPQTALLESSCENKRADLVFIIDSSRSVNTYDYAKV------KEFILDILQFLD 88

Query: 211 LIPDVNNVVQSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYN 268
           + PD   V + GL+ + + ++  F L+     S ++R +K +      T +   ++YA N
Sbjct: 89  IGPD---VTRVGLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYALN 145

Query: 269 QIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR 328
             F              N  +II+ +TDG                +A+  G +++AIG+ 
Sbjct: 146 IAFSEAE---GARPLRENVPRIIMIVTDGRPQD-----SVAEVAAKARNTGILIFAIGVG 197

Query: 329 VIRSHEFLRACASP---NSFYLVEN---PHSMYDAFSH 360
            +  +   +A  S    +  +LV N     S+   F +
Sbjct: 198 QVDLNTV-KAIGSEPHKDHVFLVANFSQIESLTSVFQN 234



 Score = 78.7 bits (192), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 23/157 (14%), Positives = 60/157 (38%), Gaps = 19/157 (12%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              T+  +D++ V+D S+S+           +     +  +++ + + P      + GL+
Sbjct: 647 KRCTEGPIDLVFVIDGSKSLGE------ENFETVKHFVTGIIDSLAVSPKAA---RVGLL 697

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S ++   F L    S   +++ + ++   G  + +   LK+ + + F           
Sbjct: 698 QYSTQVRTEFTLRGFSSAKEMKKAVTHMKYMGKGSMTGLALKHMFERSFTQVE---GARP 754

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRG 319
                 ++ +  TDG     +       + ++AK  G
Sbjct: 755 PSTQVPRVAIVFTDG-----RAQDDVSEWASKAKANG 786


>gi|329850249|ref|ZP_08265094.1| von Willebrand factor type A domain protein [Asticcacaulis
           biprosthecum C19]
 gi|328840564|gb|EGF90135.1| von Willebrand factor type A domain protein [Asticcacaulis
           biprosthecum C19]
          Length = 412

 Score =  101 bits (252), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 68/419 (16%), Positives = 141/419 (33%), Gaps = 92/419 (21%)

Query: 13  YNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGN 72
            +  G + ++ A+ + +IF  +G  I+ S + + +  L    D +++    + M   +  
Sbjct: 23  RDQSGNVIMIFALSVFVIFGFVGAAIDFSRVDYARRRLQDAADSAVL----RAMALKSAT 78

Query: 73  NRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSISAI 132
           +  +    D           +F       G  +    + R  + +I+    ++ Y++ A 
Sbjct: 79  DESRGVAAD----------KAFAENFGHPGVYDLNGALKREVNENII----SQTYTVHAT 124

Query: 133 SRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMES--FFDS 190
                     ++   +       + + S  K +       ++  VLD + SM       +
Sbjct: 125 VS--------SYFGAFFGKDSYPVTVVSQAKTSLD---VFEIAFVLDTTGSMAEANKMPN 173

Query: 191 SITKIDMAIKSI----NAMLEEVKLIPDVNNVVQSGLVTFSNK----------------- 229
             + +D A+  +      +      +   N  V+    T +                   
Sbjct: 174 LKSSVDSAMAGLLQNGKNLSGSKIAVVPFNTQVRLSDATVTTMSSQGLSSGWGNCVHDRD 233

Query: 230 ------------------------------IEEFFLLEWGVSHLQRKIKYLSKFGVSTNS 259
                                         ++    L   +S  +  IK L   G  TN 
Sbjct: 234 LATSHDVSASAAQKGKAQTLYPLETCDEASLKPVQGLSDNISSARNFIKTLQP-GGYTNV 292

Query: 260 TPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENL-------STKEDQQSLYYC 312
           T G+++    +   Q             +K ++ +TDG+N        ++  D+++   C
Sbjct: 293 TMGVQWGMEVLSPNQPFSDATEFGSTKARKFMIVVTDGDNTKSFTSWSASVIDKRTALAC 352

Query: 313 NEAKKRGAIVYAIGIRVIRSHEFLRACAS-PNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
             AK +G  VY + I    S+  LR CAS P  FY + + + +  A S I K I   R+
Sbjct: 353 ENAKAKGITVYTVKIIQGNSN-MLRKCASAPEYFYDLTSANQLNAAMSGIFKSINKTRL 410


>gi|332238409|ref|XP_003268390.1| PREDICTED: matrilin-2 isoform 3 [Nomascus leucogenys]
          Length = 915

 Score =  101 bits (252), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 41/209 (19%), Positives = 89/209 (42%), Gaps = 26/209 (12%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           +++  +S  + R D++ ++D SRS+ +   + +       + I  +L+ + + PD   V 
Sbjct: 44  TALLESSCENKRADLVFIIDSSRSVNTHDYAKV------KEFIVDILQFLDIGPD---VT 94

Query: 220 QSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + GL+ + + ++  F L+     S ++R +K +      T +   ++YA N  F      
Sbjct: 95  RVGLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYALNIAFSEAE-- 152

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                   N  ++I+ +TDG                +A+  G +++AIG+  +     L+
Sbjct: 153 -GARPLRENVPRVIMIVTDGRPQD-----SVAEVAAKARDTGILIFAIGVGQVD-FNTLK 205

Query: 338 ACAS---PNSFYLVEN---PHSMYDAFSH 360
           A  S    +  +LV N     ++   F  
Sbjct: 206 AIGSEPHEDHVFLVANFSQIETLTSVFQK 234



 Score = 96.0 bits (237), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 32/207 (15%), Positives = 78/207 (37%), Gaps = 21/207 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              T+  +D++ V+D S+S+           ++  + +  +++ + + P      + GL+
Sbjct: 606 KKCTEGPIDLVFVIDGSKSLGE------ENFEVVKQFVTGIIDSLTISPKAA---RVGLL 656

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S ++   F L    S   +++ + ++   G  + +   LK+ + + F           
Sbjct: 657 QYSTQVRTEFTLRNFNSAKDMKKAVAHMKYMGKGSMTGLALKHMFERSFTQGE---GARP 713

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                 +  +  TDG             + ++AK  G  +YA+G+      E     + P
Sbjct: 714 LSTRVPRAAIVFTDGR-----AQDDVSEWASKAKANGITMYAVGVGKAIEEELQEIASEP 768

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVT 367
                +  E+  +M +    + K I  
Sbjct: 769 TNKHLFYAEDFSTMDEISEKLKKGICE 795


>gi|332238407|ref|XP_003268389.1| PREDICTED: matrilin-2 isoform 2 [Nomascus leucogenys]
          Length = 937

 Score =  101 bits (252), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 41/209 (19%), Positives = 89/209 (42%), Gaps = 26/209 (12%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           +++  +S  + R D++ ++D SRS+ +   + +       + I  +L+ + + PD   V 
Sbjct: 44  TALLESSCENKRADLVFIIDSSRSVNTHDYAKV------KEFIVDILQFLDIGPD---VT 94

Query: 220 QSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + GL+ + + ++  F L+     S ++R +K +      T +   ++YA N  F      
Sbjct: 95  RVGLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYALNIAFSEAE-- 152

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                   N  ++I+ +TDG                +A+  G +++AIG+  +     L+
Sbjct: 153 -GARPLRENVPRVIMIVTDGRPQD-----SVAEVAAKARDTGILIFAIGVGQVD-FNTLK 205

Query: 338 ACAS---PNSFYLVEN---PHSMYDAFSH 360
           A  S    +  +LV N     ++   F  
Sbjct: 206 AIGSEPHEDHVFLVANFSQIETLTSVFQK 234



 Score = 96.0 bits (237), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 32/207 (15%), Positives = 78/207 (37%), Gaps = 21/207 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              T+  +D++ V+D S+S+           ++  + +  +++ + + P      + GL+
Sbjct: 647 KKCTEGPIDLVFVIDGSKSLGE------ENFEVVKQFVTGIIDSLTISPKAA---RVGLL 697

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S ++   F L    S   +++ + ++   G  + +   LK+ + + F           
Sbjct: 698 QYSTQVRTEFTLRNFNSAKDMKKAVAHMKYMGKGSMTGLALKHMFERSFTQGE---GARP 754

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                 +  +  TDG             + ++AK  G  +YA+G+      E     + P
Sbjct: 755 LSTRVPRAAIVFTDGR-----AQDDVSEWASKAKANGITMYAVGVGKAIEEELQEIASEP 809

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVT 367
                +  E+  +M +    + K I  
Sbjct: 810 TNKHLFYAEDFSTMDEISEKLKKGICE 836


>gi|332238405|ref|XP_003268388.1| PREDICTED: matrilin-2 isoform 1 [Nomascus leucogenys]
          Length = 956

 Score =  101 bits (252), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 41/209 (19%), Positives = 89/209 (42%), Gaps = 26/209 (12%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           +++  +S  + R D++ ++D SRS+ +   + +       + I  +L+ + + PD   V 
Sbjct: 44  TALLESSCENKRADLVFIIDSSRSVNTHDYAKV------KEFIVDILQFLDIGPD---VT 94

Query: 220 QSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + GL+ + + ++  F L+     S ++R +K +      T +   ++YA N  F      
Sbjct: 95  RVGLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYALNIAFSEAE-- 152

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                   N  ++I+ +TDG                +A+  G +++AIG+  +     L+
Sbjct: 153 -GARPLRENVPRVIMIVTDGRPQD-----SVAEVAAKARDTGILIFAIGVGQVD-FNTLK 205

Query: 338 ACAS---PNSFYLVEN---PHSMYDAFSH 360
           A  S    +  +LV N     ++   F  
Sbjct: 206 AIGSEPHEDHVFLVANFSQIETLTSVFQK 234



 Score = 96.0 bits (237), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 32/207 (15%), Positives = 78/207 (37%), Gaps = 21/207 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              T+  +D++ V+D S+S+           ++  + +  +++ + + P      + GL+
Sbjct: 647 KKCTEGPIDLVFVIDGSKSLGE------ENFEVVKQFVTGIIDSLTISPKAA---RVGLL 697

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S ++   F L    S   +++ + ++   G  + +   LK+ + + F           
Sbjct: 698 QYSTQVRTEFTLRNFNSAKDMKKAVAHMKYMGKGSMTGLALKHMFERSFTQGE---GARP 754

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                 +  +  TDG             + ++AK  G  +YA+G+      E     + P
Sbjct: 755 LSTRVPRAAIVFTDGR-----AQDDVSEWASKAKANGITMYAVGVGKAIEEELQEIASEP 809

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVT 367
                +  E+  +M +    + K I  
Sbjct: 810 TNKHLFYAEDFSTMDEISEKLKKGICE 836


>gi|297683362|ref|XP_002819353.1| PREDICTED: LOW QUALITY PROTEIN: matrilin-2-like [Pongo abelii]
          Length = 935

 Score =  101 bits (252), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 41/209 (19%), Positives = 89/209 (42%), Gaps = 26/209 (12%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           +++  +S  + R D++ ++D SRS+ +   + +       + I  +L+ + + PD   V 
Sbjct: 44  TALLESSCENKRADLVFIIDSSRSVNTHDYAKV------KEFIVDILQFLDIGPD---VT 94

Query: 220 QSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + GL+ + + ++  F L+     S ++R +K +      T +   ++YA N  F      
Sbjct: 95  RVGLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYALNIAFSEAE-- 152

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                   N  ++I+ +TDG                +A+  G +++AIG+  +     L+
Sbjct: 153 -GARPLRENVPRVIMIVTDGRPQD-----SVAEVAAKARDTGILIFAIGVGQVD-FNTLK 205

Query: 338 ACAS---PNSFYLVEN---PHSMYDAFSH 360
           A  S    +  +LV N     ++   F  
Sbjct: 206 AIGSEPHEDHVFLVANFSQIETLTSVFQK 234



 Score = 96.0 bits (237), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 32/207 (15%), Positives = 78/207 (37%), Gaps = 21/207 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              T+  +D++ V+D S+S+           ++  + +  +++ + + P      + GL+
Sbjct: 645 KKCTEGPIDLVFVIDGSKSLGE------ENFEVVKQFVTGIIDSLTISPKAA---RVGLL 695

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S ++   F L    S   +++ + ++   G  + +   LK+ + + F           
Sbjct: 696 QYSTQVRTEFTLRNFNSAKDMKKAVAHMKYMGKGSMTGLALKHMFERSFTQGE---GARP 752

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                 +  +  TDG             + ++AK  G  +YA+G+      E     + P
Sbjct: 753 LSTRVPRAAIVFTDGR-----AQDDVSEWASKAKANGITMYAVGVGKAIEEELQEIASEP 807

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVT 367
                +  E+  +M +    + K I  
Sbjct: 808 TTKHLFYAEDFSTMDEISEKLKKGICE 834


>gi|301756400|ref|XP_002914037.1| PREDICTED: matrilin-2-like isoform 3 [Ailuropoda melanoleuca]
          Length = 957

 Score =  101 bits (252), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 42/209 (20%), Positives = 91/209 (43%), Gaps = 26/209 (12%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           +++  +S  + R D++ ++D SRS+ +   + +       + I  +L+ + + PD   V 
Sbjct: 45  TALLGDSCENKRADLVFIIDSSRSVNTHDYAKV------KEFIVDILQFLDIGPD---VT 95

Query: 220 QSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + GL+ + + ++  F L+     S ++R +K +      T +   ++YA N  F      
Sbjct: 96  RVGLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYALNIAFSEAE-- 153

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                   N  ++I+ +TDG                +A+  G +++AIG+  +  +  L+
Sbjct: 154 -GARPLRENVLRVIMIVTDGRPQD-----SVAEVAAKARDTGILIFAIGVGQVDLNT-LK 206

Query: 338 ACAS---PNSFYLVEN---PHSMYDAFSH 360
           A  S    +  +LV N     S+   F +
Sbjct: 207 AIGSEPHEDHVFLVANFSQMESLTSVFQN 235



 Score = 92.5 bits (228), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 31/207 (14%), Positives = 79/207 (38%), Gaps = 21/207 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              T+  +D++ V+D S+S+           ++  + +  +++ + + P      + GL+
Sbjct: 648 KRCTEGPVDLVFVIDGSKSLGE------ENFEIVKQFVTGIIDSLAVSPKAA---RVGLL 698

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S ++   F L    S   +++ + ++   G  + +   LK+ + + F           
Sbjct: 699 QYSTQVRTEFTLRNFNSAKDMKKAVAHMKYMGKGSMTGLALKHMFERSFTQVE---GARP 755

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                 ++ +  TDG             + ++A+  G  +YA+G+      E     + P
Sbjct: 756 LSTRVPRVAIVFTDGR-----AQDDVSEWASKAQANGITMYAVGVGKAIEEELQEIASEP 810

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVT 367
                +  E+  +M +    + K I  
Sbjct: 811 TDKHLFYAEDFSTMGEISEKLKKGICE 837


>gi|56797865|emb|CAG27566.1| matrilin-4 [Danio rerio]
          Length = 726

 Score =  101 bits (252), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/212 (18%), Positives = 79/212 (37%), Gaps = 30/212 (14%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
                +D++ ++D SRS+         + +   K +  ++ E+ +        + G V +
Sbjct: 16  CKSGPVDLVFIIDGSRSVRPH------EFETMRKFMIDIIHELDIGLAA---TRIGAVQY 66

Query: 227 SNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
           S++++  F L+       + + I  +      T +   ++YA N  F  +          
Sbjct: 67  SSQVQNVFSLKAFSKTEQMVKAINEIIPLAQGTMTGLAIRYAMNVAFSAEE------GAR 120

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP-- 342
            N   + V +TDG       +  +        + G  +YA+G+        LRA ASP  
Sbjct: 121 PNVPHVAVIVTDGRPQDRVAEVAAAAR-----ESGIEIYAVGVARADMTS-LRAMASPPF 174

Query: 343 -NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
            +  +LVE+    +D     G     K    D
Sbjct: 175 EDHVFLVES----FDLIHQFGLQFQDKLCGMD 202



 Score = 86.0 bits (211), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 30/205 (14%), Positives = 77/205 (37%), Gaps = 25/205 (12%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
            +   + +D+  ++D S+S+           ++  + +N +++++ +        + GLV
Sbjct: 486 GTCRTSNIDLAPLIDGSKSVRP------QNFELVKQFVNQVVDQLDV---SAKGTRVGLV 536

Query: 225 TFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S+++   F L        +++ +  +      T +   LK+     F      +    
Sbjct: 537 QYSSRVRTEFPLSMYHSKDEIKKAVMNVEYMEKGTMTGLALKHMVENSFSEAEGARPAEK 596

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                 ++ +  TDG             +  +AK+ G  +YA+G+      E     + P
Sbjct: 597 N---IPRVGLVFTDGR-----SQDDIQEWAKKAKEAGITMYAVGVGKAVEDELREIASDP 648

Query: 343 --NSFYLVENPHSMYDAFSHIGKDI 365
               F+   +    + A S I +++
Sbjct: 649 VEKHFFYSAD----FTAISQIAENL 669


>gi|156523168|ref|NP_001095998.1| matrilin-2 [Bos taurus]
 gi|146186873|gb|AAI40517.1| MATN2 protein [Bos taurus]
 gi|296480475|gb|DAA22590.1| matrilin 2 [Bos taurus]
          Length = 958

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/209 (19%), Positives = 89/209 (42%), Gaps = 26/209 (12%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           +++  ++  + R D++ ++D SRS+ +   + +       + I  +L+ + + PD   V 
Sbjct: 46  TALLGSACENKRADVVFIIDSSRSVNTHDYAKV------KEFIVDILQFLDIGPD---VT 96

Query: 220 QSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + GL+ + + ++  F L+     S ++R +K +      T +   ++YA N  F      
Sbjct: 97  RVGLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYALNIAFSEAE-- 154

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                   N  ++I+ +TDG                +A+  G +++AIG+  +     L+
Sbjct: 155 -GARPLRENVPRVIMIVTDGRPQD-----SVAEVAAKARDTGILIFAIGVGQVD-FNTLK 207

Query: 338 ACAS---PNSFYLVEN---PHSMYDAFSH 360
           A  S    +  +LV N     ++   F  
Sbjct: 208 AIGSEPHEDHVFLVANFSQIETLTSVFQK 236



 Score = 90.2 bits (222), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 32/212 (15%), Positives = 78/212 (36%), Gaps = 26/212 (12%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              T+  +D++ V+D S+S+           ++  + +  +++ + + P      + GL+
Sbjct: 649 KRCTEGPVDLVFVIDGSKSLGE------DNFEIVKQFVTGIIDSLAISPKAA---RVGLL 699

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S  +   F L    S   +++ + ++   G  + +   LK+ + + F           
Sbjct: 700 QYSTLVRTEFTLRNFSSAKDMKKAVAHMKYMGKGSMTGLALKHMFERSFTQVE---GARP 756

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
             A   ++ +  TDG             + ++A+  G  +YA+G+      E     + P
Sbjct: 757 LSARVPRVAIVFTDGR-----AQDDVSEWASKAQASGITMYAVGVGKAIEEELQEIASEP 811

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVTKRIWY 372
                +  E+    +     I   +  K I  
Sbjct: 812 TEKHLFYAED----FSTMGEISDKLQ-KGICE 838


>gi|73974062|ref|XP_548552.2| PREDICTED: similar to matrilin 2 isoform a precursor [Canis
           familiaris]
          Length = 978

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 44/234 (18%), Positives = 98/234 (41%), Gaps = 28/234 (11%)

Query: 137 IPLKFCTFIPWYTNSR--HIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITK 194
           +P +     PW + SR  H      +++  +S  + + D++ ++D SRS+ +   + + +
Sbjct: 55  LPAEAKERTPWRSISRGRHAWTHPQTALLESSCENKQADLVFIIDSSRSVNTHDYAKVKE 114

Query: 195 IDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSK 252
                     +L+ ++ +    ++ + GL+ + + I+  F L+     S ++R +K +  
Sbjct: 115 F---------ILDILQFLDISPDLTRVGLLQYGSTIKNEFSLKTFKKKSEVERAVKRMRH 165

Query: 253 FGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYC 312
               T +   ++YA N  F              N  ++I+ +TDG               
Sbjct: 166 LSTGTMTGLAIQYALNIAFSEAE---GARPLRENVLRVIMIVTDGRPQD-----SVAEVA 217

Query: 313 NEAKKRGAIVYAIGIRVIRSHEFLRACAS---PNSFYLVEN---PHSMYDAFSH 360
            +A+  G +++AIG+  +  +  L+A  S    +  +LV N     S+   F  
Sbjct: 218 AKARDTGILIFAIGVGQVDLNT-LKAIGSEPHEDHVFLVANFSQMESLTSVFQK 270



 Score = 90.2 bits (222), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 32/207 (15%), Positives = 80/207 (38%), Gaps = 21/207 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              T+  LD++ V+D S+S+           ++  + +  +++ + + P      + GL+
Sbjct: 683 KRCTEGPLDLVFVIDGSKSLGE------ENFEIVKQFVAGIIDSLAVSPKAA---RVGLL 733

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S ++   F L    S   +++ + ++   G  + +   LK+ + + F+     +  + 
Sbjct: 734 QYSTQVRTEFTLGDFSSARDMKKAVAHMKYMGKGSMTGLALKHMFERSFNPVEGARPVSP 793

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                 ++ +  TDG             +   A+  G  +YA+G+      E     + P
Sbjct: 794 G---VSRVAIVFTDGR-----AQDDVSAWARRARAGGITMYAVGVGKAIEEELQEIASEP 845

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVT 367
                +  E+  +M +    + K I  
Sbjct: 846 TDKHLFYAEDFSTMGEISEKLKKGICE 872


>gi|45361321|ref|NP_989238.1| matrilin 2 [Xenopus (Silurana) tropicalis]
 gi|39645939|gb|AAH63920.1| matrilin 2 [Xenopus (Silurana) tropicalis]
          Length = 839

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 36/204 (17%), Positives = 82/204 (40%), Gaps = 26/204 (12%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           ++  +  LD++ ++D SRS+         K+    + +  ML+ + + PD     + GL+
Sbjct: 44  SACHNKPLDLVFIIDSSRSVR---PPDFEKV---KEFLITMLKFLDIGPD---TTRVGLL 94

Query: 225 TFSNKIEEFFLLEWGVSHL--QRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            + + ++  F L+     +  +R +K +      T +   ++YA N  F           
Sbjct: 95  QYGSTVKNEFSLKTYKKKMDIERAVKRMMHLATGTMTGLAIQYAMNIAFSESE---GARP 151

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
            + +  +I + +TDG                +A+  G +++A+G+  +     L+   S 
Sbjct: 152 LNQHVPRIAMIVTDGRPQDP-----VAEIAAKARNSGILIFAVGVGRVD-MSTLKTIGSE 205

Query: 343 ---NSFYLVEN---PHSMYDAFSH 360
                 +LV N     ++   F +
Sbjct: 206 PHTEHVFLVANFSQIETLTTVFQN 229



 Score = 85.6 bits (210), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 37/212 (17%), Positives = 80/212 (37%), Gaps = 23/212 (10%)

Query: 148 YTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLE 207
                 +     S        +  +D++ V+D S+S+           ++  + +N +L+
Sbjct: 546 CFEGYTLGEDGKSCKSERKCGEGPVDLVFVIDGSKSLGEN------NFEIVKQFVNGILD 599

Query: 208 EVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKY 265
            +++     +V   GL+ +S  I   F +    S   +++ +  +   G  + +   LK 
Sbjct: 600 SLEISQKAAHV---GLIQYSTHIRTEFTMAQYSSAKDVKKAVSQIKYMGRGSMTGLALKL 656

Query: 266 AYNQIFD-MQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYA 324
            + + F  +QG R           ++ +  TDG         +   Y  +AK+ G  +YA
Sbjct: 657 MHEKSFSEVQGARPRAMG----VPRVAIVFTDGR-----AQDEVSEYAKKAKQSGITIYA 707

Query: 325 IGIRVIRSHEFLRACASP--NSFYLVENPHSM 354
           IG+      E     ++P        E+  +M
Sbjct: 708 IGVGKAIDEELQEIASAPQEKHVIYAEDFSAM 739


>gi|157819693|ref|NP_001101483.1| matrilin-3 [Rattus norvegicus]
 gi|149050910|gb|EDM03083.1| matrilin 3 (predicted) [Rattus norvegicus]
          Length = 463

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 35/213 (16%), Positives = 74/213 (34%), Gaps = 26/213 (12%)

Query: 157 PITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVN 216
           P +            LD++ ++D SRS+        TK+   +  I      +  +    
Sbjct: 62  PYSGVRGSGVCKSRPLDLVFIIDSSRSVRPL---EFTKVKTFVSRI------IDTLDIGA 112

Query: 217 NVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQ 274
              +  +V +++ ++  F L        L++ +  ++     T S   ++ A  + F ++
Sbjct: 113 TDTRVAVVNYASTVKIEFQLNTYSNKQALKQAVARITPLSTGTMSGLAIQTAMEEAFTVE 172

Query: 275 GMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHE 334
                     +N  K+ + +TDG         Q       A+  G  +YA+G+       
Sbjct: 173 ---AGARGPTSNIPKVAIIVTDGRPQD-----QVNEVAARARASGIELYAVGVDRADMES 224

Query: 335 FLRACAS---PNSFYLVEN---PHSMYDAFSHI 361
            L+  AS    +  + VE       +   F   
Sbjct: 225 -LKMMASKPLEDHVFYVETYGVIEKLSARFQET 256


>gi|297299828|ref|XP_002805471.1| PREDICTED: matrilin-2-like [Macaca mulatta]
          Length = 897

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/209 (19%), Positives = 84/209 (40%), Gaps = 26/209 (12%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           +++  +S  + R D++ ++D SRS+ +       K+   +  I   L          +V 
Sbjct: 44  TALLESSCENKRADLVFIIDSSRSVNTH---DYAKVKEFLMDILQFL------DIGPDVT 94

Query: 220 QSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + GL+ + + ++  F L+     S ++R +K +      T +   ++YA N  F      
Sbjct: 95  RVGLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYALNIAFSEAE-- 152

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                   N  ++I+ +TDG                +A+  G +++AIG+  +     L+
Sbjct: 153 -GARPLRENVPRVIMIVTDGRPQD-----SVAEVAAKARDTGILIFAIGVGQVD-FNTLK 205

Query: 338 ACAS---PNSFYLVEN---PHSMYDAFSH 360
           A  S    +  +LV N     ++   F  
Sbjct: 206 AIGSEPHEDHVFLVANFSQIETLTSVFQR 234



 Score = 77.5 bits (189), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 23/157 (14%), Positives = 61/157 (38%), Gaps = 19/157 (12%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              T+  +D++ V+D S+S+           ++  + +  +++ + + P      + GL+
Sbjct: 647 KKCTEGPIDLVFVIDGSKSLGE------ENFEVVKQFVTGIIDSLTISPKAA---RVGLL 697

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S ++   F L    S   +++ + ++   G  + +   LK+ + + F           
Sbjct: 698 QYSTQVRTEFTLRNFNSAKDMKKAVAHMKYMGKGSMTGLALKHMFERSFTQGE---GARP 754

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRG 319
                 +  +  TDG     +       + ++AK  G
Sbjct: 755 LSTRVPRAAIVFTDG-----RAQDDVSEWASKAKANG 786


>gi|293360567|ref|XP_216941.5| PREDICTED: matrilin 2 [Rattus norvegicus]
          Length = 900

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 41/209 (19%), Positives = 92/209 (44%), Gaps = 26/209 (12%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           +++  +S  + R D++ ++D SRS+ +   + +       + I  +L+ + + PD+    
Sbjct: 43  TALLESSCENKRADLVFIIDSSRSVNTHDYAKV------KEFILDILQFLDIGPDI---T 93

Query: 220 QSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + GL+ + + ++  F L+     S ++R +K +      T +   ++YA N  F      
Sbjct: 94  RVGLLQYGSTVKNEFSLKTFKRKSDVERAVKRMRHLSTGTMTGLAIQYALNIAFSEAE-- 151

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                   N  ++I+ +TDG               ++A+  G +++AIG+  +  +  L+
Sbjct: 152 -GARPLRENVPRVIMIVTDGRPQD-----SVAEVASKARNTGILIFAIGVGQVDLNT-LK 204

Query: 338 ACASP---NSFYLVEN---PHSMYDAFSH 360
           A  S    +  +LV N     S+   F +
Sbjct: 205 AIGSEPHKDHVFLVANFSQIESLTSVFQN 233



 Score = 93.7 bits (231), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 32/197 (16%), Positives = 74/197 (37%), Gaps = 21/197 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              T+  +D++ V+D S+S+           ++    +  +++ + + P      + GL+
Sbjct: 605 KRCTEGPIDLVFVIDGSKSLGE------ENFEIVKHFVTGIIDSLAVSPKAA---RVGLL 655

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S ++   F L+   S   +++ + ++   G  + +   LK+ Y + F           
Sbjct: 656 QYSTQVRTEFTLKGFSSAKDMKKAVAHMKYMGKGSMTGLALKHMYERSFTQVE---GARP 712

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                 +  +  TDG             +  +AK  G  +YA+GI      E     + P
Sbjct: 713 LSTRVPRAAIVFTDGR-----AQDDVSEWARKAKANGITMYAVGIGKAIEEELQEIASEP 767

Query: 343 --NSFYLVENPHSMYDA 357
                +  E+  +M + 
Sbjct: 768 IDKHLFYAEDFSTMGEI 784


>gi|293348660|ref|XP_001058523.2| PREDICTED: matrilin 2 [Rattus norvegicus]
          Length = 922

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 41/209 (19%), Positives = 92/209 (44%), Gaps = 26/209 (12%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           +++  +S  + R D++ ++D SRS+ +   + +       + I  +L+ + + PD+    
Sbjct: 43  TALLESSCENKRADLVFIIDSSRSVNTHDYAKV------KEFILDILQFLDIGPDI---T 93

Query: 220 QSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + GL+ + + ++  F L+     S ++R +K +      T +   ++YA N  F      
Sbjct: 94  RVGLLQYGSTVKNEFSLKTFKRKSDVERAVKRMRHLSTGTMTGLAIQYALNIAFSEAE-- 151

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                   N  ++I+ +TDG               ++A+  G +++AIG+  +  +  L+
Sbjct: 152 -GARPLRENVPRVIMIVTDGRPQD-----SVAEVASKARNTGILIFAIGVGQVDLNT-LK 204

Query: 338 ACASP---NSFYLVEN---PHSMYDAFSH 360
           A  S    +  +LV N     S+   F +
Sbjct: 205 AIGSEPHKDHVFLVANFSQIESLTSVFQN 233



 Score = 93.7 bits (231), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 32/197 (16%), Positives = 74/197 (37%), Gaps = 21/197 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              T+  +D++ V+D S+S+           ++    +  +++ + + P      + GL+
Sbjct: 633 KRCTEGPIDLVFVIDGSKSLGE------ENFEIVKHFVTGIIDSLAVSPKAA---RVGLL 683

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S ++   F L+   S   +++ + ++   G  + +   LK+ Y + F           
Sbjct: 684 QYSTQVRTEFTLKGFSSAKDMKKAVAHMKYMGKGSMTGLALKHMYERSFTQVE---GARP 740

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                 +  +  TDG             +  +AK  G  +YA+GI      E     + P
Sbjct: 741 LSTRVPRAAIVFTDGR-----AQDDVSEWARKAKANGITMYAVGIGKAIEEELQEIASEP 795

Query: 343 --NSFYLVENPHSMYDA 357
                +  E+  +M + 
Sbjct: 796 IDKHLFYAEDFSTMGEI 812


>gi|149066552|gb|EDM16425.1| matrilin 2 (predicted) [Rattus norvegicus]
          Length = 898

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 41/209 (19%), Positives = 92/209 (44%), Gaps = 26/209 (12%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           +++  +S  + R D++ ++D SRS+ +   + +       + I  +L+ + + PD+    
Sbjct: 43  TALLESSCENKRADLVFIIDSSRSVNTHDYAKV------KEFILDILQFLDIGPDI---T 93

Query: 220 QSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + GL+ + + ++  F L+     S ++R +K +      T +   ++YA N  F      
Sbjct: 94  RVGLLQYGSTVKNEFSLKTFKRKSDVERAVKRMRHLSTGTMTGLAIQYALNIAFSEAE-- 151

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                   N  ++I+ +TDG               ++A+  G +++AIG+  +  +  L+
Sbjct: 152 -GARPLRENVPRVIMIVTDGRPQD-----SVAEVASKARNTGILIFAIGVGQVDLNT-LK 204

Query: 338 ACASP---NSFYLVEN---PHSMYDAFSH 360
           A  S    +  +LV N     S+   F +
Sbjct: 205 AIGSEPHKDHVFLVANFSQIESLTSVFQN 233



 Score = 93.7 bits (231), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 32/197 (16%), Positives = 74/197 (37%), Gaps = 21/197 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              T+  +D++ V+D S+S+           ++    +  +++ + + P      + GL+
Sbjct: 605 KRCTEGPIDLVFVIDGSKSLGE------ENFEIVKHFVTGIIDSLAVSPKAA---RVGLL 655

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S ++   F L+   S   +++ + ++   G  + +   LK+ Y + F           
Sbjct: 656 QYSTQVRTEFTLKGFSSAKDMKKAVAHMKYMGKGSMTGLALKHMYERSFTQVE---GARP 712

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                 +  +  TDG             +  +AK  G  +YA+GI      E     + P
Sbjct: 713 LSTRVPRAAIVFTDGR-----AQDDVSEWARKAKANGITMYAVGIGKAIEEELQEIASEP 767

Query: 343 --NSFYLVENPHSMYDA 357
                +  E+  +M + 
Sbjct: 768 IDKHLFYAEDFSTMGEI 784


>gi|301756398|ref|XP_002914036.1| PREDICTED: matrilin-2-like isoform 2 [Ailuropoda melanoleuca]
          Length = 938

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 42/209 (20%), Positives = 91/209 (43%), Gaps = 26/209 (12%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           +++  +S  + R D++ ++D SRS+ +   + +       + I  +L+ + + PD   V 
Sbjct: 45  TALLESSCENKRADLVFIIDSSRSVNTHDYAKV------KEFIVDILQFLDIGPD---VT 95

Query: 220 QSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + GL+ + + ++  F L+     S ++R +K +      T +   ++YA N  F      
Sbjct: 96  RVGLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYALNIAFSEAE-- 153

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                   N  ++I+ +TDG                +A+  G +++AIG+  +  +  L+
Sbjct: 154 -GARPLRENVLRVIMIVTDGRPQD-----SVAEVAAKARDTGILIFAIGVGQVDLNT-LK 206

Query: 338 ACAS---PNSFYLVEN---PHSMYDAFSH 360
           A  S    +  +LV N     S+   F +
Sbjct: 207 AIGSEPHEDHVFLVANFSQMESLTSVFQN 235



 Score = 92.5 bits (228), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 31/207 (14%), Positives = 79/207 (38%), Gaps = 21/207 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              T+  +D++ V+D S+S+           ++  + +  +++ + + P      + GL+
Sbjct: 648 KRCTEGPVDLVFVIDGSKSLGE------ENFEIVKQFVTGIIDSLAVSPKAA---RVGLL 698

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S ++   F L    S   +++ + ++   G  + +   LK+ + + F           
Sbjct: 699 QYSTQVRTEFTLRNFNSAKDMKKAVAHMKYMGKGSMTGLALKHMFERSFTQVE---GARP 755

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                 ++ +  TDG             + ++A+  G  +YA+G+      E     + P
Sbjct: 756 LSTRVPRVAIVFTDGR-----AQDDVSEWASKAQANGITMYAVGVGKAIEEELQEIASEP 810

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVT 367
                +  E+  +M +    + K I  
Sbjct: 811 TDKHLFYAEDFSTMGEISEKLKKGICE 837


>gi|301756396|ref|XP_002914035.1| PREDICTED: matrilin-2-like isoform 1 [Ailuropoda melanoleuca]
          Length = 957

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 42/209 (20%), Positives = 91/209 (43%), Gaps = 26/209 (12%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           +++  +S  + R D++ ++D SRS+ +   + +       + I  +L+ + + PD   V 
Sbjct: 45  TALLESSCENKRADLVFIIDSSRSVNTHDYAKV------KEFIVDILQFLDIGPD---VT 95

Query: 220 QSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + GL+ + + ++  F L+     S ++R +K +      T +   ++YA N  F      
Sbjct: 96  RVGLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYALNIAFSEAE-- 153

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                   N  ++I+ +TDG                +A+  G +++AIG+  +  +  L+
Sbjct: 154 -GARPLRENVLRVIMIVTDGRPQD-----SVAEVAAKARDTGILIFAIGVGQVDLNT-LK 206

Query: 338 ACAS---PNSFYLVEN---PHSMYDAFSH 360
           A  S    +  +LV N     S+   F +
Sbjct: 207 AIGSEPHEDHVFLVANFSQMESLTSVFQN 235



 Score = 92.5 bits (228), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 31/207 (14%), Positives = 79/207 (38%), Gaps = 21/207 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              T+  +D++ V+D S+S+           ++  + +  +++ + + P      + GL+
Sbjct: 648 KRCTEGPVDLVFVIDGSKSLGE------ENFEIVKQFVTGIIDSLAVSPKAA---RVGLL 698

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S ++   F L    S   +++ + ++   G  + +   LK+ + + F           
Sbjct: 699 QYSTQVRTEFTLRNFNSAKDMKKAVAHMKYMGKGSMTGLALKHMFERSFTQVE---GARP 755

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                 ++ +  TDG             + ++A+  G  +YA+G+      E     + P
Sbjct: 756 LSTRVPRVAIVFTDGR-----AQDDVSEWASKAQANGITMYAVGVGKAIEEELQEIASEP 810

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVT 367
                +  E+  +M +    + K I  
Sbjct: 811 TDKHLFYAEDFSTMGEISEKLKKGICE 837


>gi|281350435|gb|EFB26019.1| hypothetical protein PANDA_001886 [Ailuropoda melanoleuca]
          Length = 942

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 42/209 (20%), Positives = 91/209 (43%), Gaps = 26/209 (12%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           +++  +S  + R D++ ++D SRS+ +   + +       + I  +L+ + + PD   V 
Sbjct: 45  TALLESSCENKRADLVFIIDSSRSVNTHDYAKV------KEFIVDILQFLDIGPD---VT 95

Query: 220 QSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + GL+ + + ++  F L+     S ++R +K +      T +   ++YA N  F      
Sbjct: 96  RVGLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYALNIAFSEAE-- 153

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                   N  ++I+ +TDG                +A+  G +++AIG+  +  +  L+
Sbjct: 154 -GARPLRENVLRVIMIVTDGRPQD-----SVAEVAAKARDTGILIFAIGVGQVDLNT-LK 206

Query: 338 ACAS---PNSFYLVEN---PHSMYDAFSH 360
           A  S    +  +LV N     S+   F +
Sbjct: 207 AIGSEPHEDHVFLVANFSQMESLTSVFQN 235



 Score = 92.5 bits (228), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 31/207 (14%), Positives = 79/207 (38%), Gaps = 21/207 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              T+  +D++ V+D S+S+           ++  + +  +++ + + P      + GL+
Sbjct: 648 KRCTEGPVDLVFVIDGSKSLGE------ENFEIVKQFVTGIIDSLAVSPKAA---RVGLL 698

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S ++   F L    S   +++ + ++   G  + +   LK+ + + F           
Sbjct: 699 QYSTQVRTEFTLRNFNSAKDMKKAVAHMKYMGKGSMTGLALKHMFERSFTQVE---GARP 755

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                 ++ +  TDG             + ++A+  G  +YA+G+      E     + P
Sbjct: 756 LSTRVPRVAIVFTDGR-----AQDDVSEWASKAQANGITMYAVGVGKAIEEELQEIASEP 810

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVT 367
                +  E+  +M +    + K I  
Sbjct: 811 TDKHLFYAEDFSTMGEISEKLKKGICE 837


>gi|56797871|emb|CAG27569.1| matrilin-4 [Danio rerio]
          Length = 644

 Score =  100 bits (250), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/212 (18%), Positives = 80/212 (37%), Gaps = 30/212 (14%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
                +D++ ++D SRS+         + +   K +  ++ E+ +        + G+V +
Sbjct: 16  CKSGPVDLVFIIDGSRSVRPH------EFETMRKFMIDIIHELDIGLAA---TRIGVVQY 66

Query: 227 SNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
           S++++  F L+       + + I  +      T +   ++YA N  F  +          
Sbjct: 67  SSQVQNVFSLKAFSKTEQMVKAINEIIPLAQGTMTGLAIRYAMNVAFSAEE------GAR 120

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP-- 342
            N   + V +TDG       +  +        + G  +YA+G+        LRA ASP  
Sbjct: 121 PNVPHVAVIVTDGRPQDRVAEVAAAAR-----ESGIEIYAVGVARADMTS-LRAMASPPF 174

Query: 343 -NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
            +  +LVE+    +D     G     K    D
Sbjct: 175 EDHVFLVES----FDLIHQFGLQFQDKLCGMD 202



 Score = 89.1 bits (219), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 30/205 (14%), Positives = 79/205 (38%), Gaps = 25/205 (12%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
            +   + +D+++++D S+S+           ++  + +N +++++ +        + GLV
Sbjct: 404 GTCRTSNIDLVLLIDGSKSVRP------QNFELVKQFVNQVVDQLDV---SAKGTRVGLV 454

Query: 225 TFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S+++   F L        +++ +  +      T +   LK+     F      +    
Sbjct: 455 QYSSRVRTEFPLSMYHSKDEIKKAVMNVEYMEKGTMTGLALKHMVENSFSEAEGARPAEK 514

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                 ++ +  TDG             +  +AK+ G  +YA+G+      E     + P
Sbjct: 515 N---IPRVGLVFTDGR-----SQDDIQEWAKKAKEAGITMYAVGVGKAVEDELREIASDP 566

Query: 343 --NSFYLVENPHSMYDAFSHIGKDI 365
               F+   +    + A S I +++
Sbjct: 567 VEKHFFYSAD----FTAISQIAENL 587


>gi|56797869|emb|CAG27568.1| matrilin-4 [Danio rerio]
          Length = 685

 Score =  100 bits (250), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 40/212 (18%), Positives = 80/212 (37%), Gaps = 30/212 (14%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
                +D++ ++D SRS+         + +   K +  ++ E+ +        + G+V +
Sbjct: 16  CKSGPVDLVFIIDGSRSVRPH------EFETMRKFMIDIIHELDIGLAA---TRIGVVQY 66

Query: 227 SNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
           S++++  F L+       + + I  +      T +   ++YA N  F  +          
Sbjct: 67  SSQVQNVFSLKAFSKTEQMVKAINEIIPLAQGTMTGLAIRYAMNVAFSAEE------GAR 120

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP-- 342
            N   + V +TDG       +  +        + G  +YA+G+        LRA ASP  
Sbjct: 121 PNVPHVAVIVTDGRPQDRVAEVAAAAR-----ESGIEIYAVGVARADMTS-LRAMASPPF 174

Query: 343 -NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
            +  +LVE+    +D     G     K    D
Sbjct: 175 EDHVFLVES----FDLIHQFGLQFQDKLCGMD 202



 Score = 85.6 bits (210), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 30/205 (14%), Positives = 78/205 (38%), Gaps = 25/205 (12%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
            +   + +D+++++D S+S+           ++  + +N +++++ +        + GLV
Sbjct: 445 GTCRTSNIDLVLLIDGSKSVRP------QNFELVKQFVNQVVDQLDV---SAKGTRVGLV 495

Query: 225 TFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S+++   F L        +++    +      T +   LK+     F      +    
Sbjct: 496 QYSSRVRTEFPLSMYHSKDEIKKAEMNVEYMEKGTMTGLALKHMVENSFSEAEGARPAEK 555

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                 ++ +  TDG             +  +AK+ G  +YA+G+      E     + P
Sbjct: 556 N---IPRVGLVFTDGR-----SQDDIQEWAKKAKEAGITMYAVGVGKAVEDELREIASDP 607

Query: 343 --NSFYLVENPHSMYDAFSHIGKDI 365
               F+   +    + A S I +++
Sbjct: 608 VEKHFFYSAD----FTAISQIAENL 628


>gi|332830871|ref|XP_003311907.1| PREDICTED: matrilin-2 isoform 2 [Pan troglodytes]
          Length = 915

 Score =  100 bits (250), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 40/209 (19%), Positives = 89/209 (42%), Gaps = 26/209 (12%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           +++  +S  + R D++ ++D SRS+ +   + +       + I  +L+ + + PD   V 
Sbjct: 44  TALLESSCENKRADLVFIIDSSRSVNTHDYAKV------KEFIVDILQFLDIGPD---VT 94

Query: 220 QSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + GL+ + + ++  F L+     S ++R +K +      T +   ++YA N  F      
Sbjct: 95  RVGLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYALNIAFSEAE-- 152

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                   N  ++I+ +TDG                +A+  G +++AIG+  +     L+
Sbjct: 153 -GARPLRENVPRVIMIVTDGRPQD-----SVAEVAAKARDTGILIFAIGVGQVD-FNTLK 205

Query: 338 ACAS---PNSFYLVEN---PHSMYDAFSH 360
           +  S    +  +LV N     ++   F  
Sbjct: 206 SIGSEPHEDHVFLVANFSQIETLTSVFQK 234



 Score = 96.0 bits (237), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 32/207 (15%), Positives = 78/207 (37%), Gaps = 21/207 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              T+  +D++ V+D S+S+           ++  + +  +++ + + P      + GL+
Sbjct: 606 KKCTEGPIDLVFVIDGSKSLGE------ENFEVVKQFVTGIIDSLTISPKAA---RVGLL 656

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S ++   F L    S   +++ + ++   G  + +   LK+ + + F           
Sbjct: 657 QYSTQVRTEFTLRNFNSAKDMKKAVAHMKYMGKGSMTGLALKHMFERSFTQGE---GARP 713

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                 +  +  TDG             + ++AK  G  +YA+G+      E     + P
Sbjct: 714 LSTRVPRAAIVFTDGR-----AQDDVSEWASKAKANGITMYAVGVGKAIEEELQEIASEP 768

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVT 367
                +  E+  +M +    + K I  
Sbjct: 769 TNKHLFYAEDFSTMDEISEKLKKGICE 795


>gi|332830869|ref|XP_528309.3| PREDICTED: matrilin-2 isoform 3 [Pan troglodytes]
          Length = 937

 Score =  100 bits (250), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 40/209 (19%), Positives = 89/209 (42%), Gaps = 26/209 (12%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           +++  +S  + R D++ ++D SRS+ +   + +       + I  +L+ + + PD   V 
Sbjct: 44  TALLESSCENKRADLVFIIDSSRSVNTHDYAKV------KEFIVDILQFLDIGPD---VT 94

Query: 220 QSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + GL+ + + ++  F L+     S ++R +K +      T +   ++YA N  F      
Sbjct: 95  RVGLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYALNIAFSEAE-- 152

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                   N  ++I+ +TDG                +A+  G +++AIG+  +     L+
Sbjct: 153 -GARPLRENVPRVIMIVTDGRPQD-----SVAEVAAKARDTGILIFAIGVGQVD-FNTLK 205

Query: 338 ACAS---PNSFYLVEN---PHSMYDAFSH 360
           +  S    +  +LV N     ++   F  
Sbjct: 206 SIGSEPHEDHVFLVANFSQIETLTSVFQK 234



 Score = 96.0 bits (237), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 32/207 (15%), Positives = 78/207 (37%), Gaps = 21/207 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              T+  +D++ V+D S+S+           ++  + +  +++ + + P      + GL+
Sbjct: 647 KKCTEGPIDLVFVIDGSKSLGE------ENFEVVKQFVTGIIDSLTISPKAA---RVGLL 697

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S ++   F L    S   +++ + ++   G  + +   LK+ + + F           
Sbjct: 698 QYSTQVRTEFTLRNFNSAKDMKKAVAHMKYMGKGSMTGLALKHMFERSFTQGE---GARP 754

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                 +  +  TDG             + ++AK  G  +YA+G+      E     + P
Sbjct: 755 LSTRVPRAAIVFTDGR-----AQDDVSEWASKAKANGITMYAVGVGKAIEEELQEIASEP 809

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVT 367
                +  E+  +M +    + K I  
Sbjct: 810 TNKHLFYAEDFSTMDEISEKLKKGICE 836


>gi|332830867|ref|XP_003311906.1| PREDICTED: matrilin-2 isoform 1 [Pan troglodytes]
          Length = 956

 Score =  100 bits (250), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 40/209 (19%), Positives = 89/209 (42%), Gaps = 26/209 (12%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           +++  +S  + R D++ ++D SRS+ +   + +       + I  +L+ + + PD   V 
Sbjct: 44  TALLESSCENKRADLVFIIDSSRSVNTHDYAKV------KEFIVDILQFLDIGPD---VT 94

Query: 220 QSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + GL+ + + ++  F L+     S ++R +K +      T +   ++YA N  F      
Sbjct: 95  RVGLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYALNIAFSEAE-- 152

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                   N  ++I+ +TDG                +A+  G +++AIG+  +     L+
Sbjct: 153 -GARPLRENVPRVIMIVTDGRPQD-----SVAEVAAKARDTGILIFAIGVGQVD-FNTLK 205

Query: 338 ACAS---PNSFYLVEN---PHSMYDAFSH 360
           +  S    +  +LV N     ++   F  
Sbjct: 206 SIGSEPHEDHVFLVANFSQIETLTSVFQK 234



 Score = 96.0 bits (237), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 32/207 (15%), Positives = 78/207 (37%), Gaps = 21/207 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              T+  +D++ V+D S+S+           ++  + +  +++ + + P      + GL+
Sbjct: 647 KKCTEGPIDLVFVIDGSKSLGE------ENFEVVKQFVTGIIDSLTISPKAA---RVGLL 697

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S ++   F L    S   +++ + ++   G  + +   LK+ + + F           
Sbjct: 698 QYSTQVRTEFTLRNFNSAKDMKKAVAHMKYMGKGSMTGLALKHMFERSFTQGE---GARP 754

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                 +  +  TDG             + ++AK  G  +YA+G+      E     + P
Sbjct: 755 LSTRVPRAAIVFTDGR-----AQDDVSEWASKAKANGITMYAVGVGKAIEEELQEIASEP 809

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVT 367
                +  E+  +M +    + K I  
Sbjct: 810 TNKHLFYAEDFSTMDEISEKLKKGICE 836


>gi|119612173|gb|EAW91767.1| matrilin 2, isoform CRA_c [Homo sapiens]
          Length = 451

 Score =  100 bits (250), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 40/209 (19%), Positives = 89/209 (42%), Gaps = 26/209 (12%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           +++  +S  + R D++ ++D SRS+ +   + +       + I  +L+ + + PD   V 
Sbjct: 44  TALLESSCENKRADLVFIIDSSRSVNTHDYAKV------KEFIVDILQFLDIGPD---VT 94

Query: 220 QSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + GL+ + + ++  F L+     S ++R +K +      T +   ++YA N  F      
Sbjct: 95  RVGLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYALNIAFSEAE-- 152

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                   N  ++I+ +TDG                +A+  G +++AIG+  +     L+
Sbjct: 153 -GARPLRENVPRVIMIVTDGRPQD-----SVAEVAAKARDTGILIFAIGVGQVD-FNTLK 205

Query: 338 ACAS---PNSFYLVEN---PHSMYDAFSH 360
           +  S    +  +LV N     ++   F  
Sbjct: 206 SIGSEPHEDHVFLVANFSQIETLTSVFQK 234


>gi|119612172|gb|EAW91766.1| matrilin 2, isoform CRA_b [Homo sapiens]
 gi|119612174|gb|EAW91768.1| matrilin 2, isoform CRA_b [Homo sapiens]
          Length = 922

 Score =  100 bits (250), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 40/209 (19%), Positives = 89/209 (42%), Gaps = 26/209 (12%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           +++  +S  + R D++ ++D SRS+ +   + +       + I  +L+ + + PD   V 
Sbjct: 44  TALLESSCENKRADLVFIIDSSRSVNTHDYAKV------KEFIVDILQFLDIGPD---VT 94

Query: 220 QSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + GL+ + + ++  F L+     S ++R +K +      T +   ++YA N  F      
Sbjct: 95  RVGLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYALNIAFSEAE-- 152

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                   N  ++I+ +TDG                +A+  G +++AIG+  +     L+
Sbjct: 153 -GARPLRENVPRVIMIVTDGRPQD-----SVAEVAAKARDTGILIFAIGVGQVD-FNTLK 205

Query: 338 ACAS---PNSFYLVEN---PHSMYDAFSH 360
           +  S    +  +LV N     ++   F  
Sbjct: 206 SIGSEPHEDHVFLVANFSQIETLTSVFQK 234



 Score = 96.0 bits (237), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 32/207 (15%), Positives = 78/207 (37%), Gaps = 21/207 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              T+  +D++ V+D S+S+           ++  + +  +++ + + P      + GL+
Sbjct: 647 KKCTEGPIDLVFVIDGSKSLGE------ENFEVVKQFVTGIIDSLTISPKAA---RVGLL 697

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S ++   F L    S   +++ + ++   G  + +   LK+ + + F           
Sbjct: 698 QYSTQVHTEFTLRNFNSAKDMKKAVAHMKYMGKGSMTGLALKHMFERSFTQGE---GARP 754

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                 +  +  TDG             + ++AK  G  +YA+G+      E     + P
Sbjct: 755 LSTRVPRAAIVFTDGR-----AQDDVSEWASKAKANGITMYAVGVGKAIEEELQEIASEP 809

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVT 367
                +  E+  +M +    + K I  
Sbjct: 810 TNKHLFYAEDFSTMDEISEKLKKGICE 836


>gi|119612170|gb|EAW91764.1| matrilin 2, isoform CRA_a [Homo sapiens]
 gi|119612171|gb|EAW91765.1| matrilin 2, isoform CRA_a [Homo sapiens]
          Length = 941

 Score =  100 bits (250), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 40/209 (19%), Positives = 89/209 (42%), Gaps = 26/209 (12%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           +++  +S  + R D++ ++D SRS+ +   + +       + I  +L+ + + PD   V 
Sbjct: 44  TALLESSCENKRADLVFIIDSSRSVNTHDYAKV------KEFIVDILQFLDIGPD---VT 94

Query: 220 QSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + GL+ + + ++  F L+     S ++R +K +      T +   ++YA N  F      
Sbjct: 95  RVGLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYALNIAFSEAE-- 152

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                   N  ++I+ +TDG                +A+  G +++AIG+  +     L+
Sbjct: 153 -GARPLRENVPRVIMIVTDGRPQD-----SVAEVAAKARDTGILIFAIGVGQVD-FNTLK 205

Query: 338 ACAS---PNSFYLVEN---PHSMYDAFSH 360
           +  S    +  +LV N     ++   F  
Sbjct: 206 SIGSEPHEDHVFLVANFSQIETLTSVFQK 234



 Score = 96.0 bits (237), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 32/207 (15%), Positives = 78/207 (37%), Gaps = 21/207 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              T+  +D++ V+D S+S+           ++  + +  +++ + + P      + GL+
Sbjct: 647 KKCTEGPIDLVFVIDGSKSLGE------ENFEVVKQFVTGIIDSLTISPKAA---RVGLL 697

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S ++   F L    S   +++ + ++   G  + +   LK+ + + F           
Sbjct: 698 QYSTQVHTEFTLRNFNSAKDMKKAVAHMKYMGKGSMTGLALKHMFERSFTQGE---GARP 754

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                 +  +  TDG             + ++AK  G  +YA+G+      E     + P
Sbjct: 755 LSTRVPRAAIVFTDGR-----AQDDVSEWASKAKANGITMYAVGVGKAIEEELQEIASEP 809

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVT 367
                +  E+  +M +    + K I  
Sbjct: 810 TNKHLFYAEDFSTMDEISEKLKKGICE 836


>gi|62548862|ref|NP_085072.2| matrilin-2 isoform b precursor [Homo sapiens]
          Length = 937

 Score =  100 bits (250), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 40/209 (19%), Positives = 89/209 (42%), Gaps = 26/209 (12%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           +++  +S  + R D++ ++D SRS+ +   + +       + I  +L+ + + PD   V 
Sbjct: 44  TALLESSCENKRADLVFIIDSSRSVNTHDYAKV------KEFIVDILQFLDIGPD---VT 94

Query: 220 QSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + GL+ + + ++  F L+     S ++R +K +      T +   ++YA N  F      
Sbjct: 95  RVGLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYALNIAFSEAE-- 152

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                   N  ++I+ +TDG                +A+  G +++AIG+  +     L+
Sbjct: 153 -GARPLRENVPRVIMIVTDGRPQD-----SVAEVAAKARDTGILIFAIGVGQVD-FNTLK 205

Query: 338 ACAS---PNSFYLVEN---PHSMYDAFSH 360
           +  S    +  +LV N     ++   F  
Sbjct: 206 SIGSEPHEDHVFLVANFSQIETLTSVFQK 234



 Score = 96.0 bits (237), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 32/207 (15%), Positives = 78/207 (37%), Gaps = 21/207 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              T+  +D++ V+D S+S+           ++  + +  +++ + + P      + GL+
Sbjct: 647 KKCTEGPIDLVFVIDGSKSLGE------ENFEVVKQFVTGIIDSLTISPKAA---RVGLL 697

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S ++   F L    S   +++ + ++   G  + +   LK+ + + F           
Sbjct: 698 QYSTQVHTEFTLRNFNSAKDMKKAVAHMKYMGKGSMTGLALKHMFERSFTQGE---GARP 754

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                 +  +  TDG             + ++AK  G  +YA+G+      E     + P
Sbjct: 755 LSTRVPRAAIVFTDGR-----AQDDVSEWASKAKANGITMYAVGVGKAIEEELQEIASEP 809

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVT 367
                +  E+  +M +    + K I  
Sbjct: 810 TNKHLFYAEDFSTMDEISEKLKKGICE 836


>gi|62548860|ref|NP_002371.3| matrilin-2 isoform a precursor [Homo sapiens]
          Length = 956

 Score =  100 bits (250), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 40/209 (19%), Positives = 89/209 (42%), Gaps = 26/209 (12%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           +++  +S  + R D++ ++D SRS+ +   + +       + I  +L+ + + PD   V 
Sbjct: 44  TALLESSCENKRADLVFIIDSSRSVNTHDYAKV------KEFIVDILQFLDIGPD---VT 94

Query: 220 QSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + GL+ + + ++  F L+     S ++R +K +      T +   ++YA N  F      
Sbjct: 95  RVGLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYALNIAFSEAE-- 152

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                   N  ++I+ +TDG                +A+  G +++AIG+  +     L+
Sbjct: 153 -GARPLRENVPRVIMIVTDGRPQD-----SVAEVAAKARDTGILIFAIGVGQVD-FNTLK 205

Query: 338 ACAS---PNSFYLVEN---PHSMYDAFSH 360
           +  S    +  +LV N     ++   F  
Sbjct: 206 SIGSEPHEDHVFLVANFSQIETLTSVFQK 234



 Score = 96.0 bits (237), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 32/207 (15%), Positives = 78/207 (37%), Gaps = 21/207 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              T+  +D++ V+D S+S+           ++  + +  +++ + + P      + GL+
Sbjct: 647 KKCTEGPIDLVFVIDGSKSLGE------ENFEVVKQFVTGIIDSLTISPKAA---RVGLL 697

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S ++   F L    S   +++ + ++   G  + +   LK+ + + F           
Sbjct: 698 QYSTQVHTEFTLRNFNSAKDMKKAVAHMKYMGKGSMTGLALKHMFERSFTQGE---GARP 754

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                 +  +  TDG             + ++AK  G  +YA+G+      E     + P
Sbjct: 755 LSTRVPRAAIVFTDGR-----AQDDVSEWASKAKANGITMYAVGVGKAIEEELQEIASEP 809

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVT 367
                +  E+  +M +    + K I  
Sbjct: 810 TNKHLFYAEDFSTMDEISEKLKKGICE 836


>gi|37182908|gb|AAQ89254.1| MATN2 [Homo sapiens]
          Length = 915

 Score =  100 bits (250), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 40/209 (19%), Positives = 89/209 (42%), Gaps = 26/209 (12%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           +++  +S  + R D++ ++D SRS+ +   + +       + I  +L+ + + PD   V 
Sbjct: 44  TALLESSCENKRADLVFIIDSSRSVNTHDYAKV------KEFIVDILQFLDIGPD---VT 94

Query: 220 QSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + GL+ + + ++  F L+     S ++R +K +      T +   ++YA N  F      
Sbjct: 95  RVGLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYALNIAFSEAE-- 152

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                   N  ++I+ +TDG                +A+  G +++AIG+  +     L+
Sbjct: 153 -GARPLRENVPRVIMIVTDGRPQD-----SVAEVAAKARDTGILIFAIGVGQVD-FNTLK 205

Query: 338 ACAS---PNSFYLVEN---PHSMYDAFSH 360
           +  S    +  +LV N     ++   F  
Sbjct: 206 SIGSEPHEDHVFLVANFSQIETLTSVFQK 234



 Score = 96.0 bits (237), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 32/207 (15%), Positives = 78/207 (37%), Gaps = 21/207 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              T+  +D++ V+D S+S+           ++  + +  +++ + + P      + GL+
Sbjct: 606 KKCTEGPIDLVFVIDGSKSLGE------ENFEVVKQFVTGIIDSLTISPKAA---RVGLL 656

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S ++   F L    S   +++ + ++   G  + +   LK+ + + F           
Sbjct: 657 QYSTQVHTEFTLRNFNSAKDMKKAVAHMKYMGKGSMTGLALKHMFERSFTQGE---GARP 713

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                 +  +  TDG             + ++AK  G  +YA+G+      E     + P
Sbjct: 714 LSTRVPRAAIVFTDGR-----AQDDVSEWASKAKANGITMYAVGVGKAIEEELQEIASEP 768

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVT 367
                +  E+  +M +    + K I  
Sbjct: 769 TNKHLFYAEDFSTMDEISEKLKKGICE 795


>gi|14714613|gb|AAH10444.1| Matrilin 2 [Homo sapiens]
 gi|261858984|dbj|BAI46014.1| matrilin 2 [synthetic construct]
          Length = 937

 Score =  100 bits (250), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 40/209 (19%), Positives = 89/209 (42%), Gaps = 26/209 (12%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           +++  +S  + R D++ ++D SRS+ +   + +       + I  +L+ + + PD   V 
Sbjct: 44  TALLESSCENKRADLVFIIDSSRSVNTHDYAKV------KEFIVDILQFLDIGPD---VT 94

Query: 220 QSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + GL+ + + ++  F L+     S ++R +K +      T +   ++YA N  F      
Sbjct: 95  RVGLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYALNIAFSEAE-- 152

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                   N  ++I+ +TDG                +A+  G +++AIG+  +     L+
Sbjct: 153 -GARPLRENVPRVIMIVTDGRPQD-----SVAEVAAKARDTGILIFAIGVGQVD-FNTLK 205

Query: 338 ACAS---PNSFYLVEN---PHSMYDAFSH 360
           +  S    +  +LV N     ++   F  
Sbjct: 206 SIGSEPHEDHVFLVANFSQIETLTSVFQK 234



 Score = 96.0 bits (237), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 32/207 (15%), Positives = 78/207 (37%), Gaps = 21/207 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              T+  +D++ V+D S+S+           ++  + +  +++ + + P      + GL+
Sbjct: 647 KKCTEGPIDLVFVIDGSKSLGE------ENFEVVKQFVTGIIDSLTISPKAA---RVGLL 697

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S ++   F L    S   +++ + ++   G  + +   LK+ + + F           
Sbjct: 698 QYSTQVHTEFTLRNFNSAKDMKKAVAHMKYMGKGSMTGLALKHMFERSFTQGE---GARP 754

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                 +  +  TDG             + ++AK  G  +YA+G+      E     + P
Sbjct: 755 LSTRVPRAAIVFTDGR-----AQDDVSEWASKAKANGITMYAVGVGKAIEEELQEIASEP 809

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVT 367
                +  E+  +M +    + K I  
Sbjct: 810 TNKHLFYAEDFSTMDEISEKLKKGICE 836


>gi|11125762|gb|AAC51260.2| matrilin-2 precursor [Homo sapiens]
          Length = 956

 Score =  100 bits (250), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 40/209 (19%), Positives = 89/209 (42%), Gaps = 26/209 (12%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           +++  +S  + R D++ ++D SRS+ +   + +       + I  +L+ + + PD   V 
Sbjct: 44  TALLESSCENKRADLVFIIDSSRSVNTHDYAKV------KEFIVDILQFLDIGPD---VT 94

Query: 220 QSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + GL+ + + ++  F L+     S ++R +K +      T +   ++YA N  F      
Sbjct: 95  RVGLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYALNIAFSEAE-- 152

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                   N  ++I+ +TDG                +A+  G +++AIG+  +     L+
Sbjct: 153 -GARPLRENVPRVIMIVTDGRPQD-----SVAEVAAKARDTGILIFAIGVGQVD-FNTLK 205

Query: 338 ACAS---PNSFYLVEN---PHSMYDAFSH 360
           +  S    +  +LV N     ++   F  
Sbjct: 206 SIGSEPHEDHVFLVANFSQIETLTSVFQK 234



 Score = 95.6 bits (236), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 32/207 (15%), Positives = 78/207 (37%), Gaps = 21/207 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              T+  +D++ V+D S+S+           ++  + +  +++ + + P      + GL+
Sbjct: 647 KKCTEGPIDLVFVIDGSKSLGE------ENFEVVKQFVTGIIDSLTISPKAA---RVGLL 697

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S ++   F L    S   +++ + ++   G  + +   LK+ + + F           
Sbjct: 698 QYSTQVHTEFTLRNFNSAKDMKKAVAHMKYMGKGSMTGLALKHMFERSFTQGE---GARP 754

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                 +  +  TDG             + ++AK  G  +YA+G+      E     + P
Sbjct: 755 FSTRVPRAAIVFTDGR-----AQDDVSEWASKAKANGITMYAVGVGKAIEEELQEIASEP 809

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVT 367
                +  E+  +M +    + K I  
Sbjct: 810 TNKHLFYAEDFSTMDEISEKLKKGICE 836


>gi|62298084|sp|O00339|MATN2_HUMAN RecName: Full=Matrilin-2; Flags: Precursor
          Length = 956

 Score =  100 bits (250), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 40/209 (19%), Positives = 89/209 (42%), Gaps = 26/209 (12%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           +++  +S  + R D++ ++D SRS+ +   + +       + I  +L+ + + PD   V 
Sbjct: 44  TALLESSCENKRADLVFIIDSSRSVNTHDYAKV------KEFIVDILQFLDIGPD---VT 94

Query: 220 QSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + GL+ + + ++  F L+     S ++R +K +      T +   ++YA N  F      
Sbjct: 95  RVGLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYALNIAFSEAE-- 152

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                   N  ++I+ +TDG                +A+  G +++AIG+  +     L+
Sbjct: 153 -GARPLRENVPRVIMIVTDGRPQD-----SVAEVAAKARDTGILIFAIGVGQVD-FNTLK 205

Query: 338 ACAS---PNSFYLVEN---PHSMYDAFSH 360
           +  S    +  +LV N     ++   F  
Sbjct: 206 SIGSEPHEDHVFLVANFSQIETLTSVFQK 234



 Score = 96.0 bits (237), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 32/207 (15%), Positives = 78/207 (37%), Gaps = 21/207 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              T+  +D++ V+D S+S+           ++  + +  +++ + + P      + GL+
Sbjct: 647 KKCTEGPIDLVFVIDGSKSLGE------ENFEVVKQFVTGIIDSLTISPKAA---RVGLL 697

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S ++   F L    S   +++ + ++   G  + +   LK+ + + F           
Sbjct: 698 QYSTQVHTEFTLRNFNSAKDMKKAVAHMKYMGKGSMTGLALKHMFERSFTQGE---GARP 754

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                 +  +  TDG             + ++AK  G  +YA+G+      E     + P
Sbjct: 755 LSTRVPRAAIVFTDGR-----AQDDVSEWASKAKANGITMYAVGVGKAIEEELQEIASEP 809

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVT 367
                +  E+  +M +    + K I  
Sbjct: 810 TNKHLFYAEDFSTMDEISEKLKKGICE 836


>gi|21739491|emb|CAD38787.1| hypothetical protein [Homo sapiens]
          Length = 1016

 Score =  100 bits (250), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 40/209 (19%), Positives = 89/209 (42%), Gaps = 26/209 (12%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           +++  +S  + R D++ ++D SRS+ +   + +       + I  +L+ + + PD   V 
Sbjct: 104 TALLESSCENKRADLVFIIDSSRSVNTHDYAKV------KEFIVDILQFLDIGPD---VT 154

Query: 220 QSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + GL+ + + ++  F L+     S ++R +K +      T +   ++YA N  F      
Sbjct: 155 RVGLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYALNIAFSEAE-- 212

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                   N  ++I+ +TDG                +A+  G +++AIG+  +     L+
Sbjct: 213 -GARPLRENVPRVIMIVTDGRPQD-----SVAEVAAKARDTGILIFAIGVGQVD-FNTLK 265

Query: 338 ACAS---PNSFYLVEN---PHSMYDAFSH 360
           +  S    +  +LV N     ++   F  
Sbjct: 266 SIGSEPHEDHVFLVANFSQIETLTSVFQK 294



 Score = 96.0 bits (237), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 32/207 (15%), Positives = 78/207 (37%), Gaps = 21/207 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              T+  +D++ V+D S+S+           ++  + +  +++ + + P      + GL+
Sbjct: 707 KKCTEGPIDLVFVIDGSKSLGE------ENFEVVKQFVTGIIDSLTISPKAA---RVGLL 757

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S ++   F L    S   +++ + ++   G  + +   LK+ + + F           
Sbjct: 758 QYSTQVHTEFTLRNFNSAKDMKKAVAHMKYMGKGSMTGLALKHMFERSFTQGE---GARP 814

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                 +  +  TDG             + ++AK  G  +YA+G+      E     + P
Sbjct: 815 LSTRVPRAAIVFTDGR-----AQDDVSEWASKAKANGITMYAVGVGKAIEEELQEIASEP 869

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVT 367
                +  E+  +M +    + K I  
Sbjct: 870 TNKHLFYAEDFSTMDEISEKLKKGICE 896


>gi|47087209|ref|NP_998714.1| matrilin-2 [Danio rerio]
 gi|45827653|gb|AAS78465.1| matrilin-4-like protein [Danio rerio]
          Length = 821

 Score =  100 bits (250), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 40/212 (18%), Positives = 80/212 (37%), Gaps = 30/212 (14%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
                +D++ ++D SRS+         + +   K +  ++ E+ +        + G+V +
Sbjct: 29  CKSGPVDLVFIIDGSRSVRPH------EFETMRKFMIDIIHELDIGLAA---TRIGVVQY 79

Query: 227 SNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
           S++++  F L+       + + I  +      T +   ++YA N  F  +          
Sbjct: 80  SSQVQNVFSLKAFSKTEQMVKAINEIIPLAQGTMTGLAIRYAMNVAFSAEE------GAR 133

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP-- 342
            N   + V +TDG       +  +        + G  +YA+G+        LRA ASP  
Sbjct: 134 PNVPHVAVIVTDGRPQDRVAEVAAAAR-----ESGIEIYAVGVARADMTS-LRAMASPPF 187

Query: 343 -NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
            +  +LVE+    +D     G     K    D
Sbjct: 188 EDHVFLVES----FDLIHQFGLQFQDKLCGMD 215



 Score = 89.1 bits (219), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 30/205 (14%), Positives = 79/205 (38%), Gaps = 25/205 (12%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
            +   + +D+++++D S+S+           ++  + +N +++++ +        + GLV
Sbjct: 581 GTCRTSNIDLVLLIDGSKSVRP------QNFELVKQFVNQVVDQLDV---SAKGTRVGLV 631

Query: 225 TFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S+++   F L        +++ +  +      T +   LK+     F      +    
Sbjct: 632 QYSSRVRTEFPLSMYHSKDEIKKAVMNVEYMEKGTMTGLALKHMVENSFSEAEGARPAEK 691

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                 ++ +  TDG             +  +AK+ G  +YA+G+      E     + P
Sbjct: 692 N---IPRVGLVFTDGR-----SQDDIQEWAKKAKEAGITMYAVGVGKAVEDELREIASDP 743

Query: 343 --NSFYLVENPHSMYDAFSHIGKDI 365
               F+   +    + A S I +++
Sbjct: 744 VEKHFFYSAD----FTAISQIAENL 764


>gi|190339201|gb|AAI63867.1| Matn4 protein [Danio rerio]
          Length = 944

 Score =  100 bits (250), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 40/212 (18%), Positives = 80/212 (37%), Gaps = 30/212 (14%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
                +D++ ++D SRS+         + +   K +  ++ E+ +        + G+V +
Sbjct: 29  CKSGPVDLVFIIDGSRSVRPH------EFETMRKFMIDIIHELDIGLAA---TRIGVVQY 79

Query: 227 SNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
           S++++  F L+       + + I  +      T +   ++YA N  F  +          
Sbjct: 80  SSQVQNVFSLKAFSKTEQMVKAINEIIPLAQGTMTGLAIRYAMNVAFSAEE------GAR 133

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP-- 342
            N   + V +TDG       +  +        + G  +YA+G+        LRA ASP  
Sbjct: 134 PNVPHVAVIVTDGRPQDRVAEVAAAAR-----ESGIEIYAVGVARADMTS-LRAMASPPF 187

Query: 343 -NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
            +  +LVE+    +D     G     K    D
Sbjct: 188 EDHVFLVES----FDLIHQFGLQFQDKLCGMD 215



 Score = 89.1 bits (219), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 30/205 (14%), Positives = 79/205 (38%), Gaps = 25/205 (12%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
            +   + +D+++++D S+S+           ++  + +N +++++ +        + GLV
Sbjct: 704 GTCRTSNIDLVLLIDGSKSVRP------QNFELVKQFVNQVVDQLDV---SAKGTRVGLV 754

Query: 225 TFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S+++   F L        +++ +  +      T +   LK+     F      +    
Sbjct: 755 QYSSRVRTEFPLSMYHSKDEIKKAVMNVEYMEKGTMTGLALKHMVENSFSEAEGARPAEK 814

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                 ++ +  TDG             +  +AK+ G  +YA+G+      E     + P
Sbjct: 815 N---IPRVGLVFTDGR-----SQDDIQEWAKKAKEAGITMYAVGVGKAVEDELREIASDP 866

Query: 343 --NSFYLVENPHSMYDAFSHIGKDI 365
               F+   +    + A S I +++
Sbjct: 867 VEKHFFYSAD----FTAISQIAENL 887


>gi|56797863|emb|CAG27565.1| matrilin-4 [Danio rerio]
          Length = 944

 Score =  100 bits (250), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 40/212 (18%), Positives = 80/212 (37%), Gaps = 30/212 (14%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
                +D++ ++D SRS+         + +   K +  ++ E+ +        + G+V +
Sbjct: 29  CKSGPVDLVFIIDGSRSVRPH------EFETMRKFMIDIIHELDIGLAA---TRIGVVQY 79

Query: 227 SNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
           S++++  F L+       + + I  +      T +   ++YA N  F  +          
Sbjct: 80  SSQVQNVFSLKAFSKTEQMVKAINEIIPLAQGTMTGLAIRYAMNVAFSAEE------GAR 133

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP-- 342
            N   + V +TDG       +  +        + G  +YA+G+        LRA ASP  
Sbjct: 134 PNVPHVAVIVTDGRPQDRVAEVAAAAR-----ESGIEIYAVGVARADMTS-LRAMASPPF 187

Query: 343 -NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
            +  +LVE+    +D     G     K    D
Sbjct: 188 EDHVFLVES----FDLIHQFGLQFQDKLCGMD 215



 Score = 89.1 bits (219), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 30/205 (14%), Positives = 79/205 (38%), Gaps = 25/205 (12%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
            +   + +D+++++D S+S+           ++  + +N +++++ +        + GLV
Sbjct: 704 GTCRTSNIDLVLLIDGSKSVRP------QNFELVKQFVNQVVDQLDV---SAKGTRVGLV 754

Query: 225 TFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S+++   F L        +++ +  +      T +   LK+     F      +    
Sbjct: 755 QYSSRVRTEFPLSMYHSKDEIKKAVMNVEYMEKGTMTGLALKHMVENSFSEAEGARPAEK 814

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                 ++ +  TDG             +  +AK+ G  +YA+G+      E     + P
Sbjct: 815 N---IPRVGLVFTDGR-----SQDDIQEWAKKAKEAGITMYAVGVGKAVEDELREIASDP 866

Query: 343 --NSFYLVENPHSMYDAFSHIGKDI 365
               F+   +    + A S I +++
Sbjct: 867 VEKHFFYSAD----FTAISQIAENL 887


>gi|296227520|ref|XP_002759384.1| PREDICTED: matrilin-2 [Callithrix jacchus]
          Length = 973

 Score =  100 bits (250), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 41/209 (19%), Positives = 84/209 (40%), Gaps = 26/209 (12%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           +++  +S  + R D++ ++D SRS+ +       K+   I  I   L          +V 
Sbjct: 44  TALLESSCENKRADLVFIIDSSRSVNTH---DYAKVKEFIMDILQFL------DIGPDVT 94

Query: 220 QSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + GL+ + + ++  F L+     S ++R +K +      T +   ++YA N  F      
Sbjct: 95  RVGLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYALNIAFSEAE-- 152

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                   N  ++I+ +TDG                +A+  G +++AIG+  +     L+
Sbjct: 153 -GARPLKENVPRVIMIVTDGRPQD-----SVAEVAAKARNTGILIFAIGVGQVD-FNTLK 205

Query: 338 ACAS---PNSFYLVEN---PHSMYDAFSH 360
           A  S    +  +LV N     ++   F  
Sbjct: 206 AIGSEPHEDHVFLVANFSQIETLTSVFQK 234



 Score = 97.1 bits (240), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 32/207 (15%), Positives = 79/207 (38%), Gaps = 21/207 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              T+  +D++ V+D S+S+           ++  + +  +++ + + P      + GL+
Sbjct: 647 ERCTEGPIDLVFVIDGSKSLGE------ENFEVVKQFVTGIIDSLTISPKAA---RVGLL 697

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S ++   F L    S   +++ + ++   G  + +   LK+ + + F           
Sbjct: 698 QYSTQVRTEFTLRNFNSAKDMKKAVAHMKYMGKGSMTGLALKHMFERSFTQGE---GARP 754

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                 ++ +  TDG             + ++AK  G  +YA+G+      E     + P
Sbjct: 755 LSTRVPRVAIVFTDGR-----AQDDVSEWASKAKANGITMYAVGVGKAIEEELQEIASEP 809

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVT 367
                +  E+  +M +    + K I  
Sbjct: 810 TDKHLFYAEDFSTMDEISEKLKKGICE 836


>gi|56797867|emb|CAG27567.1| matrilin-4 [Danio rerio]
          Length = 548

 Score =  100 bits (249), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 40/212 (18%), Positives = 80/212 (37%), Gaps = 30/212 (14%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
                +D++ ++D SRS+         + +   K +  ++ E+ +        + G+V +
Sbjct: 16  CKSGPVDLVFIIDGSRSVRPH------EFETMRKFMIDIIHELDIGLAA---TRIGVVQY 66

Query: 227 SNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
           S++++  F L+       + + I  +      T +   ++YA N  F  +          
Sbjct: 67  SSQVQNVFSLKAFSKTEQMVKAINEIIPLAQGTMTGLAIRYAMNVAFSAEE------GAR 120

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP-- 342
            N   + V +TDG       +  +        + G  +YA+G+        LRA ASP  
Sbjct: 121 PNVPHVAVIVTDGRPQDRVAEVAAAAR-----ESGIEIYAVGVARADMTS-LRAMASPPF 174

Query: 343 -NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
            +  +LVE+    +D     G     K    D
Sbjct: 175 EDHVFLVES----FDLIHQFGLQFQDKLCGMD 202



 Score = 40.5 bits (93), Expect = 0.41,   Method: Composition-based stats.
 Identities = 10/72 (13%), Positives = 36/72 (50%), Gaps = 9/72 (12%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
            +   + +++++++D S+S+           ++  + +N +++++ +        + GLV
Sbjct: 486 GTCRTSNINLVLLIDGSKSVRP------QNFELVKQFVNQVVDQLDV---SAKGTRVGLV 536

Query: 225 TFSNKIEEFFLL 236
            +S+++   F L
Sbjct: 537 QYSSRVRTEFPL 548


>gi|291388325|ref|XP_002710627.1| PREDICTED: matrilin 3-like [Oryctolagus cuniculus]
          Length = 1109

 Score =  100 bits (249), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 42/209 (20%), Positives = 90/209 (43%), Gaps = 26/209 (12%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           +++   S  + R D++ ++D SRS+ +   + +       + I  +L+ + + PD   V 
Sbjct: 197 TALLEGSCGNKRADLVFIIDSSRSVNTHDYAKV------KEFIVDILQFLDIGPD---VT 247

Query: 220 QSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + GL+ + + ++  F L+     S ++R +K +      T +   ++YA N  F      
Sbjct: 248 RVGLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYALNIAFSEAE-- 305

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                   N  ++I+ +TDG                +A+  G +++AIG+  +  +  L+
Sbjct: 306 -GARPLRENVPRVIMIVTDGRPQD-----SVAEVAAKARDTGILIFAIGVGQVDLNT-LK 358

Query: 338 ACAS---PNSFYLVEN---PHSMYDAFSH 360
           A  S    +  +LV N     S+   F +
Sbjct: 359 AIGSEPHEDHVFLVANFSQIESLTSVFQN 387



 Score = 95.2 bits (235), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 33/197 (16%), Positives = 79/197 (40%), Gaps = 21/197 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              T+  LD++ V+D S+S+           ++  + + A+++ + + P      + GL+
Sbjct: 800 KRCTEGPLDLVFVIDGSKSLGE------DNFEIVKQFLTAIIDSLAVSPKAA---RVGLL 850

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S ++   F L    +   +++ + ++   G  + +   LK+ + + F      +    
Sbjct: 851 QYSTQVRAEFTLRSFSTAKDMKKAVAHMKYMGKGSMTGQALKHMFERSFTQ---LEGARP 907

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
             A   ++ +  TDG             + N+AK  G  +YA+G+      E     + P
Sbjct: 908 LSARVPRVAIVFTDGR-----AQDDVSEWANKAKANGITMYAVGVGKAIEEELQEIASEP 962

Query: 343 --NSFYLVENPHSMYDA 357
                +  E+  +M + 
Sbjct: 963 TDKHLFYAEDFSTMNEI 979


>gi|224048789|ref|XP_002188138.1| PREDICTED: matrilin 3 [Taeniopygia guttata]
          Length = 284

 Score =  100 bits (248), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 28/205 (13%), Positives = 75/205 (36%), Gaps = 26/205 (12%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
            +  +  LD++ ++D SRS+         + +     ++ M++ + +        +  ++
Sbjct: 25  AACKNQPLDLVFIVDSSRSVRP------EEFEKVKIFLSEMIDTLDVGE---RTTRVAVM 75

Query: 225 TFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +++ ++  F L      + ++  +  +      T +   ++ A  ++F  +        
Sbjct: 76  NYASTVKVEFPLRTYFDKASMKEAVSRIEPLSAGTMTGLAIQTAMEEVFTEE---MGTRP 132

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACAS- 341
              N  ++++ +TDG      +D  +      A+  G  +Y +G+        LR  AS 
Sbjct: 133 AAFNIPRVVIVVTDGRPQDQVQDVAA-----SARTAGIEIYTVGVGRADMQA-LRIMASE 186

Query: 342 --PNSFYLVEN---PHSMYDAFSHI 361
                 + VE       +   F   
Sbjct: 187 PLDEHVFYVETYGVIEKLTSRFRET 211


>gi|327274976|ref|XP_003222250.1| PREDICTED: collagen alpha-6(VI) chain-like [Anolis carolinensis]
          Length = 2088

 Score = 99.8 bits (247), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 46/197 (23%), Positives = 86/197 (43%), Gaps = 19/197 (9%)

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
           RLD++ V+D S S++        + D+  +    M+  VK     ++ VQ G V +S + 
Sbjct: 798 RLDIVFVIDGSGSIDP------KEYDIMKEF---MISLVKKSDVSHDRVQFGAVKYSAEP 848

Query: 231 EEFFLLEWGVSH--LQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
           E FF L    +   + R I+     G +T +   L+++     +  G R+H         
Sbjct: 849 ETFFYLNRYTTKSAIIRAIQNDKSIGETTYTAKALRHSEGLFSEEHGSRKHRG-----VP 903

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLV 348
           ++++ +TDG++    E  +      + +  G I+YAIGI   R  E L    S + ++ V
Sbjct: 904 QVLIVITDGDSHDAAELDEVSK---KLRANGIIIYAIGIERARPDELLTMAGSEDKYFYV 960

Query: 349 ENPHSMYDAFSHIGKDI 365
                +   +  I + I
Sbjct: 961 NTFEGLKHLYPRISEKI 977



 Score = 87.5 bits (215), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 42/204 (20%), Positives = 84/204 (41%), Gaps = 27/204 (13%)

Query: 164 VNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGL 223
           V +  + + D++ ++D SRS+      +  K+   +  +      V       + +  G 
Sbjct: 604 VEACKEKKSDILFLVDSSRSIS---PDNFLKMKDFMSEL------VNKSDIGLDRMHVGA 654

Query: 224 VTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCN 281
           + FS++ +E F L      S + R I  +S  G ST +   L++  +    ++G R +  
Sbjct: 655 IQFSSRNKEEFRLSQYATKSDIIRAIGRMSLMGQSTLTGGALQFVLDYFRPIKGSRPY-- 712

Query: 282 TEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACAS 341
                 KKI++ +TDGE                 ++ G IVY++G+      + +     
Sbjct: 713 -----VKKILILITDGE-----AQDDVKTPAEALRQEGIIVYSVGVFNANRTQLVEISGK 762

Query: 342 PNSFYLVENPHSMYDAFSHIGKDI 365
           P   + VE+    +D   H+  +I
Sbjct: 763 PEMVFYVED----FDILKHLENEI 782



 Score = 86.0 bits (211), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 43/208 (20%), Positives = 83/208 (39%), Gaps = 23/208 (11%)

Query: 164  VNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGL 223
               +     D++ ++D S S+    DS  TK+          L++V    D  + VQ G+
Sbjct: 981  SKPECGIPADLVFLIDGSNSIS---DSDFTKMK-------NFLQDVVRPFDTGHNVQVGI 1030

Query: 224  VTFSNKIEEFFLLEWGVSHLQ--RKIKYLSKF-GVSTNSTPGLKYAYNQIFDMQGMRQHC 280
              +S++  + F L      L+   +I  + +  G+ T     L    N      G R   
Sbjct: 1031 AQYSDRYRKEFSLNMFSHKLELETQIGRIRQMEGLQTYIGAALDRVRNFFTPEGGSRV-- 1088

Query: 281  NTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA 340
               + N ++I++ +TDG         + +    + +K+G  +YAIG+  I   +  +   
Sbjct: 1089 ---NENIQQILLVITDGR-----SHDKVVKAAEDLRKKGVDIYAIGVGRIDHLQLSQIAG 1140

Query: 341  SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
            S +  Y V+N   +      +  DI  +
Sbjct: 1141 SSDRKYTVDNFSELKVIKKRLVDDICEE 1168



 Score = 70.6 bits (171), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 54/378 (14%), Positives = 116/378 (30%), Gaps = 36/378 (9%)

Query: 13  YNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGN 72
            +    + ++T    P    +L M  + +H+      +     ++ + +      E   +
Sbjct: 253 KDKCMRIGLVTYSNKPQATSLLRMATDKTHVLQSIQSISPKGGKANLGSVIHFTKEKVFS 312

Query: 73  NRKKLKGGDILCRIKNTWNMSFRNELRDNG-----------FVNDIDDIVRSTSLDIVVV 121
                +    + +I          +                F   ID    +    IV  
Sbjct: 313 KSAGSRKSQGVEQIAIVITHRSSEDDVSGAATALRRAGVTIFAIGIDAANTTQLAQIVAY 372

Query: 122 PQNEGYSISAI---SRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVL 178
           P  +  +          K  +     +       ++       +K         D+  ++
Sbjct: 373 PPEKHLTRLKTFSHLPNKTQIFHKKIMNQIQQKLYLDAKRAELLKRGCVDTEEADIYFLI 432

Query: 179 DVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE-EFFLLE 237
             S SM  F       + + +K +              N V+ G+V ++   E EF   E
Sbjct: 433 GGSSSMNYF---DFADLKLFLKEVVKFFMV------GPNKVRFGVVQYAEINELEFGPEE 483

Query: 238 WG-VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTD 296
           +G  S + + I+ + +   + ++   LK+ +  +   QG          N    +V +TD
Sbjct: 484 YGKTSDILKAIENIRQLRGNPHTGKALKFIHPLLRKSQG------QHSRNVPCHLVVLTD 537

Query: 297 GENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYD 356
                   +        + K     +YAIGIR     +      S +  Y V +  S+  
Sbjct: 538 -----QISEDPVKEPAKKLKNEMVSIYAIGIRHANESQIYEIAESKDRAYFVNDFASLKH 592

Query: 357 AFSHIGKDIVTKRIWYDK 374
             + + +DI       +K
Sbjct: 593 IRNEVVRDICAVEACKEK 610



 Score = 64.8 bits (156), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 41/215 (19%), Positives = 83/215 (38%), Gaps = 29/215 (13%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
            +       DA  D+  ++DV  S      ++I KI + ++ +      V  +   +  +
Sbjct: 209 GTALEACDADAVADVAFIVDVGSS-----QTNIEKIQIFLEKL------VSSLDVKDKCM 257

Query: 220 QSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + GLVT+SNK +   LL      +H+ + I+ +S  G   N    + +   ++F      
Sbjct: 258 RIGLVTYSNKPQATSLLRMATDKTHVLQSIQSISPKGGKANLGSVIHFTKEKVFSKSAGS 317

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
           +    +    ++I + +T         +          ++ G  ++AIGI    + +  +
Sbjct: 318 R----KSQGVEQIAIVIT-----HRSSEDDVSGAATALRRAGVTIFAIGIDAANTTQLAQ 368

Query: 338 ACASPNSFYLVENPHSMYDAFSHIGK--DIVTKRI 370
             A     Y  E   +    FSH+     I  K+I
Sbjct: 369 IVA-----YPPEKHLTRLKTFSHLPNKTQIFHKKI 398



 Score = 44.0 bits (102), Expect = 0.044,   Method: Composition-based stats.
 Identities = 31/172 (18%), Positives = 55/172 (31%), Gaps = 17/172 (9%)

Query: 198 AIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGV 255
               I+  +  + L P+     ++ L  FS+++   F L+   G + +   IK    F  
Sbjct: 43  VKTFISKTINSLPLGPNE---YRAALAQFSDQVYNEFHLDTYKGKNQMLNHIKSKLVFKG 99

Query: 256 STNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEA 315
               T       N +  +Q      +    N  KI++ MT         +          
Sbjct: 100 GPLKTG------NALRKIQESVYWKSITGQNRSKILIVMT-----PQPSEDDVKEAAQML 148

Query: 316 KKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVT 367
           +K G    A+G+      E       P SF+       +     +I   IV 
Sbjct: 149 QKSGVKTVALGMENASHDELFLIATKPYSFFFPI-MEELSLFSQNISGIIVD 199


>gi|22761666|dbj|BAC11648.1| unnamed protein product [Homo sapiens]
          Length = 451

 Score = 99.5 bits (246), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 40/209 (19%), Positives = 89/209 (42%), Gaps = 26/209 (12%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           +++  +S  + R D++ ++D SRS+ +   + +       + I  +L+ + + PD   V 
Sbjct: 44  TALLESSCENKRADLVFIIDSSRSVNTHDYAKV------KEFIVDILQFLDIGPD---VT 94

Query: 220 QSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + GL+ + + ++  F L+     S ++R +K +      T +   ++YA N  F      
Sbjct: 95  RVGLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHPSTGTMTGLAIQYALNIAFSEAE-- 152

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                   N  ++I+ +TDG                +A+  G +++AIG+  +     L+
Sbjct: 153 -GARPLRENVPRVIMIVTDGRPQD-----SVAEVAAKARDTGILIFAIGVGQVD-FNTLK 205

Query: 338 ACAS---PNSFYLVEN---PHSMYDAFSH 360
           +  S    +  +LV N     ++   F  
Sbjct: 206 SIGSEPHEDHVFLVANFSQIETLTSVFQK 234


>gi|301758388|ref|XP_002915048.1| PREDICTED: matrilin-3-like [Ailuropoda melanoleuca]
          Length = 466

 Score = 99.5 bits (246), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 37/234 (15%), Positives = 83/234 (35%), Gaps = 28/234 (11%)

Query: 139 LKFCTFIPWYTNSRHIVMPITS----SVKVNSQTDARLDMMIVLDVSRSMESFFDSSITK 194
            +       +T S+H  M  ++    S++        LD++ ++D SRS+        TK
Sbjct: 25  FEPACSKVEFTGSQHGTMQASALPFWSLQAGVCKSRPLDLVFIIDSSRSVRPL---EFTK 81

Query: 195 IDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSK 252
           +   +  I      +  +       +  +V +++ ++  F L+       L++ +  ++ 
Sbjct: 82  VKTFVSQI------IDTLDIGAADTRVAVVNYASTVKTEFHLQTYSDKQSLKQAVARITP 135

Query: 253 FGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYC 312
               T S   ++ A ++ F ++          +N  K+ + +TDG         Q     
Sbjct: 136 LSTGTMSGLAIQTAMDEAFTVE---AGARGPTSNIPKVAIIVTDGRPQD-----QVNEVA 187

Query: 313 NEAKKRGAIVYAIGIRVIRSHEFLRACASP--NSFYLVEN---PHSMYDAFSHI 361
             A+  G  +YA+G+            + P     + VE       +   F   
Sbjct: 188 ARARASGIELYAVGVDRADMESLKMIASEPLDEHVFYVETYGVIEKLSSRFQET 241


>gi|148226222|ref|NP_001089834.1| hypothetical protein LOC734900 [Xenopus laevis]
 gi|80477144|gb|AAI08519.1| MGC130922 protein [Xenopus laevis]
          Length = 840

 Score = 99.5 bits (246), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 35/204 (17%), Positives = 80/204 (39%), Gaps = 26/204 (12%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           ++  +  +D++ ++D SRS+           +   + +  ML+ + + PD     + GL+
Sbjct: 44  SACYNKPMDLVFIIDSSRSVRP------ADFEKVKEFLITMLKFLDIGPDN---TRVGLL 94

Query: 225 TFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            + + ++  F L+       ++R +K +      T +   ++YA N  F           
Sbjct: 95  QYGSTVKNEFSLKTYKRKPDIERAVKRMMHLATGTMTGLAIQYAMNIAFSEAE---GARP 151

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACAS- 341
            +    +I + +TDG                +A+  G +++AIG+  +     L+   S 
Sbjct: 152 LNQYVPRIAMIVTDGRPQDP-----VAEIAAKARNSGILIFAIGVGRVD-MSTLKTIGSQ 205

Query: 342 --PNSFYLVEN---PHSMYDAFSH 360
                 +LV N     ++   F +
Sbjct: 206 PHSEHVFLVANFSQIETLTSVFQN 229



 Score = 87.9 bits (216), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 35/212 (16%), Positives = 77/212 (36%), Gaps = 23/212 (10%)

Query: 148 YTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLE 207
                 +     S        +  +D++ V+D S+S+           ++  + +  +L+
Sbjct: 546 CLEGYSLGEDGKSCKGEKKCGEGPVDLVFVIDGSKSLGE------DNFEIVKQFVKGILD 599

Query: 208 EVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKY 265
            +++        + GL+ +S  +   F +    S   +++ +  +   G  + +   LK 
Sbjct: 600 SLEISQKAA---RVGLIQYSTHVRTEFTMAQYSSAKDVKKAVSQIKYMGRGSMTGLALKL 656

Query: 266 AYNQIFD-MQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYA 324
            + + F   QG R           ++ +  TDG         +   Y  +AK+ G  +YA
Sbjct: 657 MHEKSFSEAQGARARPM----RVPRVAIVFTDGR-----AQDEVSEYAEKAKQSGITIYA 707

Query: 325 IGIRVIRSHEFLRACASP--NSFYLVENPHSM 354
           IGI      E     ++P        E+  +M
Sbjct: 708 IGIGKAIDEELQEIASAPQEKHVIYAEDFSAM 739


>gi|154250683|ref|YP_001411507.1| von Willebrand factor type A [Parvibaculum lavamentivorans DS-1]
 gi|154154633|gb|ABS61850.1| von Willebrand factor type A [Parvibaculum lavamentivorans DS-1]
          Length = 436

 Score = 99.5 bits (246), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 43/153 (28%), Positives = 68/153 (44%), Gaps = 13/153 (8%)

Query: 227 SNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
           +  ++    L    S L   I  ++  G +TN+T GL + +N +    G         AN
Sbjct: 286 NCNLQTIMPLSTNWSALNSHIDAMASAG-NTNTTIGLAWGWN-MLTQGGPLSSAAAPAAN 343

Query: 287 YKKIIVFMTDGEN-------LSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFL-RA 338
             K+IVF+TDG+N        S   + ++   CN  K  G  VY++  RVI  +  L R 
Sbjct: 344 LDKVIVFLTDGDNTRNRWSNNSNTINARTTLICNNIKAAGIKVYSV--RVIEGNATLIRN 401

Query: 339 CAS-PNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           CA+ P  +Y V     +   F+ I + +   RI
Sbjct: 402 CATEPGMYYSVTTASELTSVFASIAQSLSNLRI 434



 Score = 46.7 bits (109), Expect = 0.005,   Method: Composition-based stats.
 Identities = 29/221 (13%), Positives = 70/221 (31%), Gaps = 37/221 (16%)

Query: 11  FFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGN 70
            + + +G    + AI +  +    G  +++S  + +++ L + +D S +           
Sbjct: 11  LWQDRRGNFAAIFAIAIIPVVAAAGATVDISRAYIVESRLKAALDASALAVGGA------ 64

Query: 71  GNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSIS 130
                      +          SF N       +     +  S S ++V           
Sbjct: 65  ---------TGMTTSQMQAMAQSFFNANYPASKLGVPGTLSVSQSGNVV----------- 104

Query: 131 AISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDS 190
                 +  +  T +        + +  TS V    +    L++ +VLD + SM S    
Sbjct: 105 ---SLSVHAQLPTTLMGVVGINTLNVSATSQVTRMGKK---LEVALVLDNTGSMASGG-- 156

Query: 191 SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
              ++ +   +   ++  V         V+  +V F+  + 
Sbjct: 157 ---RMTVLKTAAKNLITTVSAAATNPGDVKVAIVPFNVDVN 194


>gi|297265499|ref|XP_002799207.1| PREDICTED: matrilin-3-like [Macaca mulatta]
          Length = 445

 Score = 99.1 bits (245), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 34/209 (16%), Positives = 74/209 (35%), Gaps = 26/209 (12%)

Query: 161 SVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQ 220
           +          LD++ ++D SRS+        TK+   +  I      +  +       +
Sbjct: 72  ASGAGVCKSRPLDLVFLIDSSRSVRPL---EFTKVKTFVSRI------IDTLDIGPADTR 122

Query: 221 SGLVTFSNKIEEFFLLEWGVSH--LQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQ 278
             +V +++ ++  F L+       L++ +  ++     T S   ++ A +++F  +    
Sbjct: 123 VAVVNYASTVKIEFQLQAYTDKQSLKQAVGQITPLSTGTMSGLAIQTAMDEVFTAE---A 179

Query: 279 HCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRA 338
                 +N  K+ + +TDG         Q       A+  G  +YA+G+        L+ 
Sbjct: 180 GARGPSSNIPKVAIIVTDGRPQD-----QVNEVAARARASGIELYAVGVDRADMQS-LKM 233

Query: 339 CAS---PNSFYLVEN---PHSMYDAFSHI 361
            AS       + VE       +   F   
Sbjct: 234 MASEPLEEHVFYVETYGVIEKLSSRFQET 262


>gi|56797873|emb|CAG27570.1| matrilin-4 [Danio rerio]
          Length = 428

 Score = 99.1 bits (245), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 40/212 (18%), Positives = 80/212 (37%), Gaps = 30/212 (14%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
                +D++ ++D SRS+         + +   K +  ++ E+ +        + G+V +
Sbjct: 16  CKSGPVDLVFIIDGSRSVRPH------EFETMRKFMIDIIHELNIGLAA---TRIGVVQY 66

Query: 227 SNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
           S++++  F L+       + + I  +      T +   ++YA N  F  +          
Sbjct: 67  SSQVQNVFSLKAFSKTEQMVKAINEIIPLAQGTMTGLAIRYAMNVAFSAEE------GAR 120

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP-- 342
            N   + V +TDG       +  +        + G  +YA+G+        LRA ASP  
Sbjct: 121 PNVPHVAVIVTDGRPQDRVAEVAAAAR-----ESGIEIYAVGVARADMTS-LRAMASPPF 174

Query: 343 -NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
            +  +LVE+    +D     G     K    D
Sbjct: 175 EDHVFLVES----FDLIHQFGLQSQDKLCGMD 202



 Score = 43.6 bits (101), Expect = 0.054,   Method: Composition-based stats.
 Identities = 11/73 (15%), Positives = 36/73 (49%), Gaps = 9/73 (12%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
            +   + +D+++++D S+S+           ++  + +N +++++ +        + GLV
Sbjct: 363 GTCRTSNIDLVLLIDGSKSVRP------QNFELVKQFVNQVVDQLDV---SAKGTRVGLV 413

Query: 225 TFSNKIEEFFLLE 237
            +S+++   F L 
Sbjct: 414 QYSSRVRTEFPLS 426


>gi|55729600|emb|CAH91529.1| hypothetical protein [Pongo abelii]
          Length = 955

 Score = 99.1 bits (245), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 40/209 (19%), Positives = 88/209 (42%), Gaps = 26/209 (12%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           +++  +S  + R D++ ++D SRS+ +   + +       + I  +L+ + + PD   V 
Sbjct: 44  TALLESSCENKRADLVFIIDSSRSVNTHDYAKV------KEFIVDILQFLDIGPD---VT 94

Query: 220 QSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + GL+ + + ++  F L+     S ++R +K +      T +   ++YA N  F      
Sbjct: 95  RVGLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYALNIAFSEAE-- 152

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                   N  ++I+ +TDG                +A+  G +++A G+  +     L+
Sbjct: 153 -GARPLRENVPRVIMIVTDGRPQD-----SVAEVAAKARDTGILIFAFGVGQVD-FNTLK 205

Query: 338 ACAS---PNSFYLVEN---PHSMYDAFSH 360
           A  S    +  +LV N     ++   F  
Sbjct: 206 AIGSEPHEDHVFLVANFSQIETLTSVFQK 234



 Score = 92.1 bits (227), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 30/207 (14%), Positives = 76/207 (36%), Gaps = 21/207 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              T+  +D+  V+D S+ +           ++  + +  +++ + + P      + GL+
Sbjct: 647 KKCTEGPIDLAFVIDGSKGLGE------ENFEVVKQFVTGIIDSLTISPKAA---RVGLL 697

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S ++   F L    S   +++ + ++   G  + +   L++ + + F           
Sbjct: 698 QYSTQVRTEFTLRNFNSAKDMKKAVAHMKYMGKGSMTGLALRHMFERSFTQGE---GARP 754

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                 +  +  TDG             + ++AK  G  +YA+G+      E     + P
Sbjct: 755 LSTRVPRAAIVFTDGR-----AQDDVSEWASKAKANGITMYAVGVGKAIEEELQEIASEP 809

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVT 367
                +  E+  +M +    + K I  
Sbjct: 810 TTKHLFYAEDFSTMDEISEKLKKGICE 836


>gi|87311197|ref|ZP_01093320.1| hypothetical protein DSM3645_16250 [Blastopirellula marina DSM
           3645]
 gi|87286105|gb|EAQ78016.1| hypothetical protein DSM3645_16250 [Blastopirellula marina DSM
           3645]
          Length = 373

 Score = 98.7 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 60/378 (15%), Positives = 125/378 (33%), Gaps = 38/378 (10%)

Query: 4   LNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAAT 63
           LN  +       +G + IL A+ LP+I  +    ++V+++   +T L    D +    A 
Sbjct: 8   LNRKLGRISR-RRGAVLILIAVLLPVILWMAAFCVDVAYMQLTRTELRIATDSAARAGAR 66

Query: 64  QIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQ 123
            +  E + +   K               ++  +     G     DD+ R T      +  
Sbjct: 67  TLSLEQDASLAHKSAIEYAAKNNVAGNTLTLADSDVQIGLSVRTDDVGRFTFSSGGKLLN 126

Query: 124 NEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRS 183
               +++     + P                  P+  +           D+ +V+D S S
Sbjct: 127 --SVNVTGRRTQQAPDGAVRLYLTPIFGHEFFQPVADATASQIDR----DIALVVDRSGS 180

Query: 184 MESFFD--------------SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229
           M    +               S  +    + S++  L E+   P +  V    L T+++ 
Sbjct: 181 MTFRINRNSYESGWRNNDPVPSRARWWALVDSVDGFLTELGSTPQLELV---SLSTYNSS 237

Query: 230 IEEFFLLEWGVSHLQRKIKYLSKF--GVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287
            +    L    S ++  +   S+     STN T G+    + + + +  R + +      
Sbjct: 238 AKIDEQLTDKYSRIEDALDDYSRRYPDGSTNITAGMDRGISTLQNKKYARPYAS------ 291

Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA--SPNSF 345
            K +V MTDG +        + Y   +A     +V+ I      +   +R  A       
Sbjct: 292 -KTMVVMTDGNHNYGSSPTNAAY---DAASDDIVVHTITYSDGANQSLMREVARIGGGQH 347

Query: 346 YLVENPHSMYDAFSHIGK 363
           +   +   + + F  I +
Sbjct: 348 WHAPDGDELEEIFREIAR 365


>gi|85859126|ref|YP_461328.1| von Willebrand factor type A domain-containing protein [Syntrophus
           aciditrophicus SB]
 gi|85722217|gb|ABC77160.1| von Willebrand factor type A domain protein [Syntrophus
           aciditrophicus SB]
          Length = 447

 Score = 98.3 bits (243), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 56/334 (16%), Positives = 106/334 (31%), Gaps = 45/334 (13%)

Query: 13  YNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGN 72
            N KG + I+ A+ L ++     + ++V   +  ++ L   +D   +  A  I N   G 
Sbjct: 6   KNQKGAVLIIFALLLIVLLGFTALAVDVGRWYTTRSELSKSVDAGAIAGAKNISNPYLGE 65

Query: 73  NRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSISAI 132
           +                       E    G++   D   RS +        +    I   
Sbjct: 66  DGHLR------------LAEEVARENFSAGYLMTPDSGERSATFTAYADEDHR---IRVE 110

Query: 133 SRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSI 192
                P      +        +        K        +++M+VLD S SM        
Sbjct: 111 GTVSSP----GNLAGLFGVDWVATSAMGVAK-----KNEVEIMLVLDRSGSM------DG 155

Query: 193 TKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWG-VSHLQRKIKYLS 251
           T ++   K+  + +   +   D +   + GLV+F+  ++    L    VS +  KI  + 
Sbjct: 156 TPMNDLKKAARSFVSFFEETQDQD---KMGLVSFATSVKVDVPLGNNYVSSMTSKINAMD 212

Query: 252 KFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTK-------E 304
             G  TN+   L  A N        +      +   ++ ++F +DG   + +        
Sbjct: 213 AVGA-TNAEDSLSQAGNPAKGGLTDQSGV-PGNKRVQQFVIFFSDGNPTAFRGKFKYNGT 270

Query: 305 DQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRA 338
           D      C      G  VY   +      E+L  
Sbjct: 271 DNIDAVVCGTGNDCG-TVYT-KLGKPEREEWLSY 302



 Score = 45.5 bits (106), Expect = 0.015,   Method: Composition-based stats.
 Identities = 13/69 (18%), Positives = 26/69 (37%)

Query: 302 TKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHI 361
           T     ++ +  E K     +Y IG+  I      +  + P+  +       +   F+ I
Sbjct: 378 TTARGMAVEHAQELKDNNVKIYTIGLGNIDRDFLSQIASGPSFEFYAPTSGELQAIFNKI 437

Query: 362 GKDIVTKRI 370
            KDI  + +
Sbjct: 438 AKDIKLRLV 446


>gi|148234427|ref|NP_001080470.1| matrilin 2 [Xenopus laevis]
 gi|28175657|gb|AAH45220.1| Matn2-prov protein [Xenopus laevis]
          Length = 589

 Score = 98.3 bits (243), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 38/204 (18%), Positives = 84/204 (41%), Gaps = 26/204 (12%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           ++  +  LD++ ++D SRS+           +   + +  ML+ + + PD     + GL+
Sbjct: 44  SACHNKPLDLVFIIDSSRSVRP------ADFEKVKEFLITMLKFLDIGPD---TTRVGLL 94

Query: 225 TFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            + + ++  F L+     S ++R +K +      T +   ++YA N  F           
Sbjct: 95  QYGSTVKNEFSLKMYKRKSDIERAVKRMMHLATGTMTGLAIQYAMNIAFSEAE---GARP 151

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACAS- 341
            +    +I + +TDG      E+  +     +A+  G +++AIG+  +     L+   S 
Sbjct: 152 LNQYVPRIAMIVTDGRPQDPVEEISA-----KARMSGILIFAIGVGRVD-MSTLKTIGSE 205

Query: 342 --PNSFYLVEN---PHSMYDAFSH 360
                 +LV N     ++   F +
Sbjct: 206 PHSEHVFLVANFSQIETLTSVFQN 229


>gi|332253805|ref|XP_003276022.1| PREDICTED: matrilin-3 [Nomascus leucogenys]
          Length = 488

 Score = 98.3 bits (243), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 34/207 (16%), Positives = 73/207 (35%), Gaps = 26/207 (12%)

Query: 163 KVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSG 222
                    LD++ ++D SRS+        TK+   +  I      +  +       +  
Sbjct: 75  GAGVCKSRPLDLVFIIDSSRSVR---PPEFTKVKTFVSRI------IDTLDIGPADTRVA 125

Query: 223 LVTFSNKIEEFFLLEWGVSH--LQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHC 280
           +V +++ ++  F L+       L++ +  ++     T S   ++ A ++ F ++      
Sbjct: 126 VVNYASTVKIEFQLQAYTDKQSLRQAVGRITPLSTGTMSGLAIQTAMDEAFTVE---AGA 182

Query: 281 NTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA 340
               +N  K+ + +TDG         Q       A+  G  +YA+G+        L+  A
Sbjct: 183 RDPSSNIPKVAIIVTDGRPQD-----QVNEVAARARASGIELYAVGVDRADLKS-LKMMA 236

Query: 341 S---PNSFYLVEN---PHSMYDAFSHI 361
           S       + VE       +   F   
Sbjct: 237 SEPLEEHVFYVETYGVIEKLSSRFQET 263


>gi|296224421|ref|XP_002758053.1| PREDICTED: matrilin-3 isoform 2 [Callithrix jacchus]
          Length = 445

 Score = 98.3 bits (243), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 36/217 (16%), Positives = 75/217 (34%), Gaps = 27/217 (12%)

Query: 163 KVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSG 222
                    LD++ ++D SRS+        TK+   +  I      +  +       +  
Sbjct: 74  GAGVCKSRPLDLVFIIDSSRSVRPL---EFTKVKTFVSRI------IDTLDIGPADTRVA 124

Query: 223 LVTFSNKIEEFFLLEWGVSH--LQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHC 280
           +V +++ ++  F L+       L++ +  ++     T S   ++ A ++ F ++      
Sbjct: 125 VVNYASTVKIEFQLQAYTDKQSLKQAVGRITPLSTGTMSGLAIQTAMDEAFTLE---AGA 181

Query: 281 NTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA 340
               +N  K+ + +TDG         Q       A+  G  +YA+G+        L+  A
Sbjct: 182 RGPSSNVPKVAIIVTDGRPQD-----QVNEVAARARASGIELYAVGVDRADMES-LKMMA 235

Query: 341 S---PNSFYLVENPHSMYDAFSHIGKDIVTKRIWYDK 374
           S       + VE     Y     +           DK
Sbjct: 236 SEPLEEHVFYVET----YGVIEKLSSRFQETFCALDK 268


>gi|56797859|emb|CAG27402.1| matrilin-3b [Danio rerio]
          Length = 434

 Score = 98.3 bits (243), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 36/213 (16%), Positives = 78/213 (36%), Gaps = 26/213 (12%)

Query: 157 PITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVN 216
           P T            LD++ ++D SRS+     +   K+ +       + E V  +   +
Sbjct: 188 PPTVPAPAEPCKSRPLDLVFIIDSSRSVR---PAEFEKVKIF------LSEMVDSLDIGS 238

Query: 217 NVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQ 274
           +  +  LV +++ +   F L+  +  + +++    +      T +   +K A +Q+F   
Sbjct: 239 DATRVALVNYASTVNIEFHLKKYFSKAEVKQAFSRIDPLSTGTMTGMAIKTAMDQVFTEN 298

Query: 275 GMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHE 334
              +          K+ + +TDG      E+  +      A+  G  +YA+G+       
Sbjct: 299 AGARPLKKG---IGKVAIIVTDGRPQDKVEEVSAA-----ARASGIEIYAVGVDRAEMRS 350

Query: 335 FLRACAS---PNSFYLVEN---PHSMYDAFSHI 361
            L+  AS    +  + VE       +   F   
Sbjct: 351 -LKQMASQPLDDHVFYVETYGVIEKLTSKFRET 382


>gi|148665999|gb|EDK98415.1| matrilin 3 [Mus musculus]
          Length = 482

 Score = 98.3 bits (243), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 35/213 (16%), Positives = 73/213 (34%), Gaps = 26/213 (12%)

Query: 157 PITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVN 216
           P +            LD++ ++D SRS+        TK+   +  I      +  +    
Sbjct: 62  PYSGGRGAGVCKSRPLDLVFIIDSSRSVRPL---EFTKVKTFVSRI------IDTLDIGA 112

Query: 217 NVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQ 274
              +  +V +++ ++  F L        L++ +  ++     T S   ++ A  + F ++
Sbjct: 113 TDTRVAVVNYASTVKIEFQLNTYSDKQALKQAVARITPLSTGTMSGLAIQTAMEEAFTVE 172

Query: 275 GMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHE 334
                     +N  K+ + +TDG         Q       A+  G  +YA+G+       
Sbjct: 173 ---AGARGPMSNIPKVAIIVTDGRPQD-----QVNEVAARARASGIELYAVGVDRADMES 224

Query: 335 FLRACAS---PNSFYLVEN---PHSMYDAFSHI 361
            L+  AS       + VE       +   F   
Sbjct: 225 -LKMMASKPLEEHVFYVETYGVIEKLSARFQET 256


>gi|306518578|ref|NP_034900.4| matrilin-3 precursor [Mus musculus]
 gi|6918887|emb|CAB72265.1| matrilin-3 [Mus musculus]
 gi|26339344|dbj|BAC33343.1| unnamed protein product [Mus musculus]
          Length = 481

 Score = 98.3 bits (243), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 35/213 (16%), Positives = 73/213 (34%), Gaps = 26/213 (12%)

Query: 157 PITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVN 216
           P +            LD++ ++D SRS+        TK+   +  I      +  +    
Sbjct: 62  PYSGGRGAGVCKSRPLDLVFIIDSSRSVRPL---EFTKVKTFVSRI------IDTLDIGA 112

Query: 217 NVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQ 274
              +  +V +++ ++  F L        L++ +  ++     T S   ++ A  + F ++
Sbjct: 113 TDTRVAVVNYASTVKIEFQLNTYSDKQALKQAVARITPLSTGTMSGLAIQTAMEEAFTVE 172

Query: 275 GMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHE 334
                     +N  K+ + +TDG         Q       A+  G  +YA+G+       
Sbjct: 173 ---AGARGPMSNIPKVAIIVTDGRPQD-----QVNEVAARARASGIELYAVGVDRADMES 224

Query: 335 FLRACAS---PNSFYLVEN---PHSMYDAFSHI 361
            L+  AS       + VE       +   F   
Sbjct: 225 -LKMMASKPLEEHVFYVETYGVIEKLSARFQET 256


>gi|14548114|sp|O35701|MATN3_MOUSE RecName: Full=Matrilin-3; Flags: Precursor
 gi|2342635|emb|CAA71532.1| matrilin-3 [Mus musculus]
          Length = 481

 Score = 98.3 bits (243), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 35/213 (16%), Positives = 73/213 (34%), Gaps = 26/213 (12%)

Query: 157 PITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVN 216
           P +            LD++ ++D SRS+        TK+   +  I      +  +    
Sbjct: 62  PYSGGRGAGVCKSRPLDLVFIIDSSRSVRPL---EFTKVKTFVSRI------IDTLDIGA 112

Query: 217 NVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQ 274
              +  +V +++ ++  F L        L++ +  ++     T S   ++ A  + F ++
Sbjct: 113 TDTRVAVVNYASTVKIEFQLNTYSDKQALKQAVARITPLSTGTMSGLAIQTAMEEAFTVE 172

Query: 275 GMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHE 334
                     +N  K+ + +TDG         Q       A+  G  +YA+G+       
Sbjct: 173 ---AGARGPMSNIPKVAIIVTDGRPQD-----QVNEVAARARASGIELYAVGVDRADMES 224

Query: 335 FLRACAS---PNSFYLVEN---PHSMYDAFSHI 361
            L+  AS       + VE       +   F   
Sbjct: 225 -LKMMASKPLEEHVFYVETYGVIEKLSARFQET 256


>gi|296224419|ref|XP_002758052.1| PREDICTED: matrilin-3 isoform 1 [Callithrix jacchus]
          Length = 487

 Score = 98.3 bits (243), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 34/207 (16%), Positives = 73/207 (35%), Gaps = 26/207 (12%)

Query: 163 KVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSG 222
                    LD++ ++D SRS+        TK+   +  I      +  +       +  
Sbjct: 74  GAGVCKSRPLDLVFIIDSSRSVRPL---EFTKVKTFVSRI------IDTLDIGPADTRVA 124

Query: 223 LVTFSNKIEEFFLLEWGVSH--LQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHC 280
           +V +++ ++  F L+       L++ +  ++     T S   ++ A ++ F ++      
Sbjct: 125 VVNYASTVKIEFQLQAYTDKQSLKQAVGRITPLSTGTMSGLAIQTAMDEAFTLE---AGA 181

Query: 281 NTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA 340
               +N  K+ + +TDG         Q       A+  G  +YA+G+        L+  A
Sbjct: 182 RGPSSNVPKVAIIVTDGRPQD-----QVNEVAARARASGIELYAVGVDRADMES-LKMMA 235

Query: 341 S---PNSFYLVEN---PHSMYDAFSHI 361
           S       + VE       +   F   
Sbjct: 236 SEPLEEHVFYVETYGVIEKLSSRFQET 262


>gi|311253076|ref|XP_003125384.1| PREDICTED: matrilin-3-like [Sus scrofa]
          Length = 488

 Score = 97.9 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 36/207 (17%), Positives = 74/207 (35%), Gaps = 26/207 (12%)

Query: 163 KVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSG 222
                    LD++ ++D SRS+        TK+   +  I      +  +       +  
Sbjct: 75  GAGICKSRPLDLVFIIDSSRSVRPL---EFTKVKTFVSRI------IDNLDIGAEDTRVA 125

Query: 223 LVTFSNKIEEFFLLEWGVSH--LQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHC 280
           +V +++ ++  F L+       L+R +  ++     T S   ++ A ++ F ++      
Sbjct: 126 VVNYASTVKIEFHLQTHSDKQALKRAVARIAPLSTGTMSGLAIQTAMDEAFTVE---AGA 182

Query: 281 NTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA 340
              ++N  K+ + +TDG         Q       A+  G  +YA+G+        LR  A
Sbjct: 183 RGPNSNIPKVAIIVTDGRPQD-----QVNEVAARARASGIELYAVGVDRADMES-LRLMA 236

Query: 341 S---PNSFYLVEN---PHSMYDAFSHI 361
           S       + VE       +   F   
Sbjct: 237 SEPLDEHVFYVETYGVIEKLSSRFQET 263


>gi|158260465|dbj|BAF82410.1| unnamed protein product [Homo sapiens]
          Length = 937

 Score = 97.5 bits (241), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 40/209 (19%), Positives = 88/209 (42%), Gaps = 26/209 (12%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           +++  +S  + R D + ++D SRS+ +   + +       + I  +L+ + + PD   V 
Sbjct: 44  TALLESSCENKRADPVFIIDSSRSVNTHDYAKV------KEFIVDILQFLDIGPD---VT 94

Query: 220 QSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + GL+ + + ++  F L+     S ++R +K +      T +   ++YA N  F      
Sbjct: 95  RVGLLQYGSTVKNEFSLKTFKRKSEVERAVKRMRHLSTGTMTGLAIQYALNIAFSEAE-- 152

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                   N  ++I+ +TDG                +A+  G +++AIG+  +     L+
Sbjct: 153 -GARPLRENVPRVIMIVTDGRPQD-----SVAEVAAKARDMGILIFAIGVGQVD-FNTLK 205

Query: 338 ACAS---PNSFYLVEN---PHSMYDAFSH 360
           +  S    +  +LV N     ++   F  
Sbjct: 206 SIGSEPHEDHVFLVANFSQIETLTSVFQK 234



 Score = 96.0 bits (237), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 32/207 (15%), Positives = 78/207 (37%), Gaps = 21/207 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              T+  +D++ V+D S+S+           ++  + +  +++ + + P      + GL+
Sbjct: 647 KKCTEGPIDLVFVIDGSKSLGE------ENFEVVKQFVTGIIDSLTISPKAA---RVGLL 697

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S ++   F L    S   +++ + ++   G  + +   LK+ + + F           
Sbjct: 698 QYSTQVHTEFTLRNFNSAKDMKKAVAHMKYMGKGSMTGLALKHMFERSFTQGE---GARP 754

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                 +  +  TDG             + ++AK  G  +YA+G+      E     + P
Sbjct: 755 LSTRVPRAAIVFTDGR-----AQDDVSEWASKAKANGITMYAVGVGKAIEEELQEIASEP 809

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVT 367
                +  E+  +M +    + K I  
Sbjct: 810 TNKHLFYAEDFSTMDEISEKLKKGICE 836


>gi|297668115|ref|XP_002812300.1| PREDICTED: LOW QUALITY PROTEIN: matrilin-3-like [Pongo abelii]
          Length = 493

 Score = 97.5 bits (241), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 35/207 (16%), Positives = 74/207 (35%), Gaps = 26/207 (12%)

Query: 163 KVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSG 222
                    LD++ ++D SRS+        TK+   +  I      +  +       +  
Sbjct: 80  GAGVCKSRPLDLVFIIDSSRSVRPL---EFTKVKTFVSRI------IDTLDIGPADTRVA 130

Query: 223 LVTFSNKIEEFFLLEWGVSH--LQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHC 280
           +V +++ ++  F L+       L++ +  ++     T S   ++ A ++IF ++      
Sbjct: 131 VVNYASTVKIEFQLQTYTDKQSLKQAVGRITPLSTGTMSGLAIQTAMDEIFTVE---AGA 187

Query: 281 NTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA 340
               +N  K+ + +TDG         Q       A+  G  +YA+G+        L+  A
Sbjct: 188 RGPSSNIPKVAIIVTDGRPQD-----QVNEVAARAQASGIELYAVGVDRADMES-LKMMA 241

Query: 341 S---PNSFYLVEN---PHSMYDAFSHI 361
           S       + VE       +   F   
Sbjct: 242 SEPLEEHVFYVETYGVIEKLSSRFQET 268


>gi|47217883|emb|CAG05005.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 647

 Score = 97.5 bits (241), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 34/209 (16%), Positives = 75/209 (35%), Gaps = 26/209 (12%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           S    N      LD + V+D SRS+           +     I  +++ +++ P      
Sbjct: 41  SRAVGNPCKAVPLDFVFVIDSSRSIRP------RDYEKVKTFIVNLVQFLEVGP---EAT 91

Query: 220 QSGLVTFSNKIEEFFLLEWGVSH--LQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + GL+ + + ++  F L    +   +++ ++ +      T +   ++YA    F      
Sbjct: 92  RVGLLQYGSVVQPEFSLSTFSTKAEVEQAVRNMKHLATGTMTGLAIQYAAETSFTEAD-- 149

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                   +  +I V +TDG         +      +A++ G  ++AIG+  +     L+
Sbjct: 150 -GARPAHLHIPRIAVVVTDGRPQD-----RVEEVAAQARQAGIQIFAIGVGRVDMKT-LK 202

Query: 338 ACAS---PNSFYLV---ENPHSMYDAFSH 360
              S       +LV       ++   F  
Sbjct: 203 TIGSEPHSEHVHLVASFSQMETLVSVFQS 231



 Score = 85.6 bits (210), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 38/242 (15%), Positives = 84/242 (34%), Gaps = 57/242 (23%)

Query: 163 KVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSG 222
           K ++  D  +D++ ++D S+SM           +   + + +++E + + P   +V   G
Sbjct: 397 KRSACADGAMDLVFMIDGSKSMGP------ANFERVKQFVISIVESLDVSPTGAHV---G 447

Query: 223 LVTFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHC 280
           L+ +S  +   F L    S   +++ +  +   G  + +   L+  +   F  +      
Sbjct: 448 LLQYSTNVRTEFTLSQHTSAQGIRQAVSRMQYMGRGSMTGSALRRMFQSSFSAEE----- 502

Query: 281 NTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGA-------------------- 320
                N  ++ V  TDG     +    +  +  +AK  G                     
Sbjct: 503 -GARPNVPRVSVVFTDG-----RSQDDASEWAKKAKNSGIPGSFSYFGGTGRFLSCSFLL 556

Query: 321 ----IVYAIGIRVIRSHEFLRACASPN--SFYLVENPHSMYDAFSHIGK--DIVTKRIWY 372
                +YA+G+      E     + P     Y  +        F  +G+  + +  R+  
Sbjct: 557 VLGVTIYAVGVGKAIEQELREIASEPEEKHLYYAQE-------FKDVGEITEKLKSRMCT 609

Query: 373 DK 374
           DK
Sbjct: 610 DK 611


>gi|220675931|emb|CAX12090.1| matrilin 3b [Danio rerio]
          Length = 434

 Score = 97.1 bits (240), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 36/213 (16%), Positives = 77/213 (36%), Gaps = 26/213 (12%)

Query: 157 PITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVN 216
           P T            LD++ ++D SRS+     +   K+ +       + E V  +   +
Sbjct: 188 PPTVPAPAEPCKSRPLDLVFIIDSSRSVR---PAEFEKVKIF------LSEMVNSLDIGS 238

Query: 217 NVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQ 274
           +  +  LV +++ +   F L+  +  + +++    +      T +   +K A  Q+F   
Sbjct: 239 DATRVALVNYASTVNIEFHLKKYFSKAEVKQAFSRIDPLSTGTMTGMAIKTAMEQVFTEN 298

Query: 275 GMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHE 334
              +          K+ + +TDG      E+  +      A+  G  +YA+G+       
Sbjct: 299 AGARPLKKG---IGKVAIIVTDGRPQDKVEEVSAA-----ARASGIEIYAVGVDRAEMRS 350

Query: 335 FLRACAS---PNSFYLVEN---PHSMYDAFSHI 361
            L+  AS    +  + VE       +   F   
Sbjct: 351 -LKQMASQPLDDHVFYVETYGVIEKLTSKFRET 382


>gi|59939916|ref|NP_001012385.1| matrilin 3b [Danio rerio]
 gi|56797875|emb|CAG30518.1| matrilin-3b precursor [Danio rerio]
 gi|220675929|emb|CAX12088.1| matrilin 3b [Danio rerio]
          Length = 478

 Score = 97.1 bits (240), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 36/213 (16%), Positives = 77/213 (36%), Gaps = 26/213 (12%)

Query: 157 PITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVN 216
           P T            LD++ ++D SRS+     +   K+ +       + E V  +   +
Sbjct: 188 PPTVPAPAEPCKSRPLDLVFIIDSSRSVR---PAEFEKVKIF------LSEMVNSLDIGS 238

Query: 217 NVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQ 274
           +  +  LV +++ +   F L+  +  + +++    +      T +   +K A  Q+F   
Sbjct: 239 DATRVALVNYASTVNIEFHLKKYFSKAEVKQAFSRIDPLSTGTMTGMAIKTAMEQVFTEN 298

Query: 275 GMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHE 334
              +          K+ + +TDG      E+  +      A+  G  +YA+G+       
Sbjct: 299 AGARPLKKG---IGKVAIIVTDGRPQDKVEEVSAA-----ARASGIEIYAVGVDRAEMRS 350

Query: 335 FLRACAS---PNSFYLVEN---PHSMYDAFSHI 361
            L+  AS    +  + VE       +   F   
Sbjct: 351 -LKQMASQPLDDHVFYVETYGVIEKLTSKFRET 382


>gi|55251329|emb|CAH69127.1| novel protein similar to vertebrate matrilin 3 (MATN3) [Danio
           rerio]
          Length = 454

 Score = 96.8 bits (239), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 35/209 (16%), Positives = 82/209 (39%), Gaps = 26/209 (12%)

Query: 161 SVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQ 220
           +   +      LD++ ++D SRS+         + +     +  M++ + + PD     +
Sbjct: 52  AATDSQCRSRPLDLVFIIDSSRSVRP------GEFEKVKIFLADMVDTLDVGPDA---TR 102

Query: 221 SGLVTFSNKIEEFFLLEWGVSH--LQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQ 278
             +V +++ ++  FLL+  ++   +++ I  +      T +   +K A ++ F     + 
Sbjct: 103 VAVVNYASTVKIEFLLKSHLTKDTIKQAITRIEPLAAGTMTGMAIKKAMDEAFT---EKS 159

Query: 279 HCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRA 338
               +  N  K+ + +TDG      E+  +      A+  G  +YA+G+        L+ 
Sbjct: 160 GARPKSKNISKVAIIVTDGRPQDQVEEVSAA-----ARASGIEIYAVGVDRADMRS-LKL 213

Query: 339 CAS---PNSFYLVEN---PHSMYDAFSHI 361
            AS    +  + VE       +   F   
Sbjct: 214 MASNPLEDHVFYVETYGVIEKLTSKFRET 242


>gi|312878233|ref|ZP_07738157.1| von Willebrand factor type A [Caldicellulosiruptor lactoaceticus
           6A]
 gi|311794982|gb|EFR11387.1| von Willebrand factor type A [Caldicellulosiruptor lactoaceticus
           6A]
          Length = 1221

 Score = 96.8 bits (239), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 41/215 (19%), Positives = 78/215 (36%), Gaps = 29/215 (13%)

Query: 155 VMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPD 214
            +PI    +  +Q    +D++ VLD S SM     +   KI     +  + ++ +     
Sbjct: 515 EVPINKGEREVNQQIKYIDLVFVLDSSGSMSWNDPNGYRKI-----AAKSFVDALIQGD- 568

Query: 215 VNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQ 274
                ++ +V F +       L      ++  I  +  +G  TN   G++ A +Q+    
Sbjct: 569 -----RAAVVDFDDYGYLLQPLTTDFQTVKNAIDRIDSWG-GTNIAEGIRIANHQLISQS 622

Query: 275 GMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHE 334
                      +  K+I+ +TDGE               EAK  G  +Y IG+       
Sbjct: 623 ---------SDDRIKVIILLTDGEGYYDN------NLTTEAKNNGITIYTIGLGTSVDEN 667

Query: 335 FLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVT 367
            LR  A  +   ++ V +   +   F  I + +  
Sbjct: 668 LLRNIATQTGGMYFPVSSASQLPQVFKRITEIVTE 702


>gi|194671641|ref|XP_591137.3| PREDICTED: matrilin 3 [Bos taurus]
 gi|297480578|ref|XP_002691564.1| PREDICTED: matrilin 3 [Bos taurus]
 gi|296482389|gb|DAA24504.1| matrilin 3 [Bos taurus]
          Length = 574

 Score = 96.8 bits (239), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 35/210 (16%), Positives = 74/210 (35%), Gaps = 26/210 (12%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
            +          LD++ ++D SRS+        TK+   +  I      +  +       
Sbjct: 158 GARGAGVCKSRPLDLVFIIDSSRSVRPL---QFTKVKTFVSKI------IDTLDIGPMDT 208

Query: 220 QSGLVTFSNKIEEFFLLEWGVSH--LQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           +  +V +++ ++  F L+       L+R +  ++     T S   ++ A ++ F ++   
Sbjct: 209 RVAVVNYASTVKIEFHLQTHSDKQSLKRAVARITPLSTGTMSGLAIQTAMDEAFTVE--- 265

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                  +N  K+ + +TDG         Q       A+  G  +YA+G+        L+
Sbjct: 266 AGARGPSSNIPKVAIIVTDGRPQD-----QVNEVAARARASGIELYAVGVDRADMES-LK 319

Query: 338 ACAS---PNSFYLVEN---PHSMYDAFSHI 361
             AS       + VE       +   F   
Sbjct: 320 MMASEPLDEHVFYVETYGVIEKLSSRFQET 349


>gi|281344227|gb|EFB19811.1| hypothetical protein PANDA_002988 [Ailuropoda melanoleuca]
          Length = 395

 Score = 96.4 bits (238), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 32/205 (15%), Positives = 71/205 (34%), Gaps = 24/205 (11%)

Query: 164 VNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGL 223
                   LD++ ++D SRS+        TK+   +  I      +  +       +  +
Sbjct: 1   AGVCKSRPLDLVFIIDSSRSVRPL---EFTKVKTFVSQI------IDTLDIGAADTRVAV 51

Query: 224 VTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCN 281
           V +++ ++  F L+       L++ +  ++     T S   ++ A ++ F ++       
Sbjct: 52  VNYASTVKTEFHLQTYSDKQSLKQAVARITPLSTGTMSGLAIQTAMDEAFTVE---AGAR 108

Query: 282 TEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACAS 341
              +N  K+ + +TDG         Q       A+  G  +YA+G+            + 
Sbjct: 109 GPTSNIPKVAIIVTDGRPQD-----QVNEVAARARASGIELYAVGVDRADMESLKMIASE 163

Query: 342 P--NSFYLVEN---PHSMYDAFSHI 361
           P     + VE       +   F   
Sbjct: 164 PLDEHVFYVETYGVIEKLSSRFQET 188


>gi|32425428|gb|AAH16394.1| MATN2 protein [Homo sapiens]
          Length = 715

 Score = 96.0 bits (237), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 32/207 (15%), Positives = 78/207 (37%), Gaps = 21/207 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              T+  +D++ V+D S+S+           ++  + +  +++ + + P      + GL+
Sbjct: 406 KKCTEGPIDLVFVIDGSKSLGE------ENFEVVKQFVTGIIDSLTISPKAA---RVGLL 456

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S ++   F L    S   +++ + ++   G  + +   LK+ + + F           
Sbjct: 457 QYSTQVHTEFTLRNFNSAKDMKKAVAHMKYMGKGSMTGLALKHMFERSFTQGE---GARP 513

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                 +  +  TDG             + ++AK  G  +YA+G+      E     + P
Sbjct: 514 LSTRVPRAAIVFTDGR-----AQDDVSEWASKAKANGITMYAVGVGKAIEEELQEIASEP 568

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVT 367
                +  E+  +M +    + K I  
Sbjct: 569 TNKHLFYAEDFSTMDEISEKLKKGICE 595


>gi|52545626|emb|CAB70853.2| hypothetical protein [Homo sapiens]
          Length = 672

 Score = 96.0 bits (237), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 32/207 (15%), Positives = 78/207 (37%), Gaps = 21/207 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              T+  +D++ V+D S+S+           ++  + +  +++ + + P      + GL+
Sbjct: 363 KKCTEGPIDLVFVIDGSKSLGE------ENFEVVKQFVTGIIDSLTISPKAA---RVGLL 413

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S ++   F L    S   +++ + ++   G  + +   LK+ + + F           
Sbjct: 414 QYSTQVHTEFTLRNFNSAKDMKKAVAHMKYMGKGSMTGLALKHMFERSFTQGE---GARP 470

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                 +  +  TDG             + ++AK  G  +YA+G+      E     + P
Sbjct: 471 LSTRVPRAAIVFTDGR-----AQDDVSEWASKAKANGITMYAVGVGKAIEEELQEIASEP 525

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVT 367
                +  E+  +M +    + K I  
Sbjct: 526 TNKHLFYAEDFSTMDEISEKLKKGICE 552


>gi|14042702|dbj|BAB55358.1| unnamed protein product [Homo sapiens]
          Length = 537

 Score = 96.0 bits (237), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 32/207 (15%), Positives = 78/207 (37%), Gaps = 21/207 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              T+  +D++ V+D S+S+           ++  + +  +++ + + P      + GL+
Sbjct: 228 KKCTEGPIDLVFVIDGSKSLGE------ENFEVVKQFVTGIIDSLTISPKAA---RVGLL 278

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S ++   F L    S   +++ + ++   G  + +   LK+ + + F           
Sbjct: 279 QYSTQVHTEFTLRNFNSAKDMKKAVAHMKYMGKGSMTGLALKHMFERSFTQGE---GARP 335

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                 +  +  TDG             + ++AK  G  +YA+G+      E     + P
Sbjct: 336 LSTRVPRAAIVFTDGR-----AQDDVSEWASKAKANGITMYAVGVGKAIEEELQEIASEP 390

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVT 367
                +  E+  +M +    + K I  
Sbjct: 391 TNKHLFYAEDFSTMDEISEKLKKGICE 417


>gi|11360063|pir||T46488 hypothetical protein DKFZp434J065.1 - human (fragment)
          Length = 741

 Score = 96.0 bits (237), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 32/207 (15%), Positives = 78/207 (37%), Gaps = 21/207 (10%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              T+  +D++ V+D S+S+           ++  + +  +++ + + P      + GL+
Sbjct: 432 KKCTEGPIDLVFVIDGSKSLGE------ENFEVVKQFVTGIIDSLTISPKAA---RVGLL 482

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S ++   F L    S   +++ + ++   G  + +   LK+ + + F           
Sbjct: 483 QYSTQVHTEFTLRNFNSAKDMKKAVAHMKYMGKGSMTGLALKHMFERSFTQGE---GARP 539

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                 +  +  TDG             + ++AK  G  +YA+G+      E     + P
Sbjct: 540 LSTRVPRAAIVFTDGR-----AQDDVSEWASKAKANGITMYAVGVGKAIEEELQEIASEP 594

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVT 367
                +  E+  +M +    + K I  
Sbjct: 595 TNKHLFYAEDFSTMDEISEKLKKGICE 621


>gi|194220937|ref|XP_001501805.2| PREDICTED: matrilin 3 [Equus caballus]
          Length = 450

 Score = 96.0 bits (237), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 38/242 (15%), Positives = 81/242 (33%), Gaps = 27/242 (11%)

Query: 129 ISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNS-QTDARLDMMIVLDVSRSMESF 187
           +     Y       T IP ++ +  +        +         LD++ ++D SRS+   
Sbjct: 2   LRVSPAYWRYPSATTLIPLHSGAPTLGPGQPGVARGAGVCKSRPLDLVFIIDSSRSVRPL 61

Query: 188 FDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSH--LQR 245
                TK+   +  I      +  +       +  +V +++ ++  F L        L++
Sbjct: 62  ---EFTKVKTFVSQI------IDTLDIGPADTRVAVVNYASTVKIEFHLNTHSDKQSLKQ 112

Query: 246 KIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKED 305
            +  ++     T S   ++ A ++ F ++           N  K+ + +TDG        
Sbjct: 113 AVARITPLSTGTMSGLAIQTAMDEAFTVE---AGARVPSYNIPKVAIIVTDGRPQD---- 165

Query: 306 QQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACAS---PNSFYLVEN---PHSMYDAFS 359
            Q       A+  G  +YA+G+        L+  AS       + VE       +   F 
Sbjct: 166 -QVNEVAARARASGIELYAVGVDRADMES-LKVIASEPLDEHVFYVETYGVIEKLSSRFQ 223

Query: 360 HI 361
             
Sbjct: 224 ET 225


>gi|48734898|gb|AAH71224.1| Matrilin 3 [Mus musculus]
          Length = 481

 Score = 95.6 bits (236), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 35/213 (16%), Positives = 73/213 (34%), Gaps = 26/213 (12%)

Query: 157 PITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVN 216
           P +            LD++ ++D SRS+        TK+   +  I      +  +    
Sbjct: 62  PYSGGRGAGVCKSRPLDLVFIIDSSRSVRPL---EFTKVKTFVSRI------IDTLGIGA 112

Query: 217 NVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQ 274
              +  +V +++ ++  F L        L++ +  ++     T S   ++ A  + F ++
Sbjct: 113 TDTRVAVVNYASTVKIEFQLNTYSDKQALKQAVARITPLSTGTMSGLAIQTAMEEAFTVE 172

Query: 275 GMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHE 334
                     +N  K+ + +TDG         Q       A+  G  +YA+G+       
Sbjct: 173 ---AGARGPMSNIPKVAIIVTDGRPQD-----QVNEVAARARASGIELYAVGVDRADMES 224

Query: 335 FLRACAS---PNSFYLVEN---PHSMYDAFSHI 361
            L+  AS       + VE       +   F   
Sbjct: 225 -LKMMASKPLEEHVFYVETYGVIEKLSARFQET 256


>gi|126341666|ref|XP_001379908.1| PREDICTED: hypothetical protein [Monodelphis domestica]
          Length = 2347

 Score = 95.6 bits (236), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 59/349 (16%), Positives = 118/349 (33%), Gaps = 36/349 (10%)

Query: 41  SHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRD 100
           S +      L     R+   AA   + +   + +K  +    + +I          +   
Sbjct: 296 SEVLQEIQKLSPKAGRAYTGAAMTKVRKEVFSVQKGSRRMQGVPQIAILVAHRPSEDNVS 355

Query: 101 NGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTF----IPWYTNSRHIVM 156
              ++   + V   ++ +      +   IS+    K   K  TF        T  + +  
Sbjct: 356 EAALDLRREGVTVFTVGLEGSDDTQLGQISSHPPEKYLSKLKTFSELAAHNQTFQKKLRG 415

Query: 157 PITSSVKVNSQTDARL----------DMMIVLDVSRSMESFFDSSITKIDMAIKSINAML 206
            I   V V S+    L          D+ +++D S S+   + +   ++   +  +  M 
Sbjct: 416 EIQHKVSVLSEQTEHLKAGCVETEEADIYLLIDGSGSI---YPTDFQEMKAFLSEVIEMF 472

Query: 207 EEVKLIPDVNNVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLK 264
                I      V+ G V +S+  E  F +      + L + I  + + G +TN+   L 
Sbjct: 473 ----TIAPYK--VRVGAVQYSHIQELEFEINKYSNKNDLGKAIDNIWQLGGNTNTGAALD 526

Query: 265 YAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYA 324
                 F +  +++            ++ +TDG       D   L    + K     VYA
Sbjct: 527 ------FTLGLLQRAKTQRGNKVPCHLIVLTDG-----MSDDNVLEPAKKLKDENINVYA 575

Query: 325 IGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
           IG++     + L    +    Y V N  S+ D  + + + I +K    D
Sbjct: 576 IGVKEANRTQLLEIAGTEKRVYYVYNFDSLKDIKNQVVQGICSKEACKD 624



 Score = 94.1 bits (232), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 36/196 (18%), Positives = 81/196 (41%), Gaps = 19/196 (9%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ V+D S S++    + + +          M++ VK      + V+ G + +S    
Sbjct: 814 LDIVFVIDSSGSIDYNEYNIMKEF---------MIKLVKKADVAKDRVRFGALKYSYDPT 864

Query: 232 EFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
             F L+     S +   ++  S  G  T +   L ++ +   + +G R      +    +
Sbjct: 865 ILFYLDEFDTRSKVISLLQNDSPKGGDTYTAKALAFSEHMFTEARGSRI-----NQKVPQ 919

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVE 349
           +++ +TDGE+    +   +       + +G ++ A+GI    + E L    S + ++ VE
Sbjct: 920 VLIVITDGESHDANQLNAT---AKALRDKGILILAVGIAGANTEELLAMAGSTDKYFFVE 976

Query: 350 NPHSMYDAFSHIGKDI 365
               +   F ++   I
Sbjct: 977 TFGGLKGIFQNVSDSI 992



 Score = 89.8 bits (221), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 45/211 (21%), Positives = 84/211 (39%), Gaps = 27/211 (12%)

Query: 158 ITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNN 217
           +       +  D + D+M ++D SRS+      +  K+   +K++      V       +
Sbjct: 613 VQGICSKEACKDVKADVMFLVDSSRSIGLE---NFGKMKTFMKNL------VNKSQIGED 663

Query: 218 VVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQG 275
            VQ G+V FS+  +E F L   W    +   I  +S     T +   LK+  +     +G
Sbjct: 664 QVQVGIVQFSDVNKEEFQLNRYWTQHEIFDAIDRMSNIDRETLTGSALKFVSDYFHPSKG 723

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF 335
            R          +K ++ +TDGE+    +D          ++ G I+Y++G+      + 
Sbjct: 724 ARPG-------VRKFLILITDGESQDPVKD-----PAMALRQDGVIIYSVGVYGANETQL 771

Query: 336 LRACASPNSFYLVENPHSMYDAFSHIGKDIV 366
           +     P   + VE     +D   HI  D+V
Sbjct: 772 VEISGKPEMIFYVET----FDILKHIEDDLV 798



 Score = 77.9 bits (190), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 33/216 (15%), Positives = 83/216 (38%), Gaps = 22/216 (10%)

Query: 152  RHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKL 211
            +++   I    KV  + +   D++ +LD S S+                 + +++++  +
Sbjct: 986  QNVSDSICGPSKVECKMEKA-DLVFLLDGSNSIYP------ENFKKMKDFLVSVVDDFDI 1038

Query: 212  IPDVNNVVQSGLVTFSNKIEEFFLLEWGVSH--LQRKIKYLSKFGVSTNSTPGLKYAYNQ 269
             P     V  GL  FS+     F L    S   +  +I+   +   +T+    LK     
Sbjct: 1039 GPS---RVHIGLAQFSHVYRAEFFLGSFTSEGEVSTQIEMTQQVFGNTHIGAALKQVEQY 1095

Query: 270  IFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV 329
                 G R      +   +++++ +TDG+        +      + +++G  +Y++GI  
Sbjct: 1096 FRPEMGSRI-----NVGIQQVLLVLTDGQ-----SQDEVAKAAEDLRRKGIDIYSLGIGD 1145

Query: 330  IRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDI 365
            +   + ++   + +    ++N   +      I ++I
Sbjct: 1146 VDEQQLIQISGTSDKKLTIDNFDELKKIKKRIVRNI 1181



 Score = 57.5 bits (137), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 25/177 (14%), Positives = 64/177 (36%), Gaps = 20/177 (11%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D++ +LD       + + +   ++     +    E V       N ++ GLVT++++ + 
Sbjct: 235 DVVFLLD------EYVNGTQENLEHLKGFLE---ESVSSFDVKENCMRIGLVTYTDETKV 285

Query: 233 FFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKI 290
              L  G   S + ++I+ LS       +   +     ++F +Q   +          +I
Sbjct: 286 IHSLSTGTNKSEVLQEIQKLSPKAGRAYTGAAMTKVRKEVFSVQKGSRRM----QGVPQI 341

Query: 291 IVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYL 347
            + +          +        + ++ G  V+ +G+      +  +  + P   YL
Sbjct: 342 AILV-----AHRPSEDNVSEAALDLRREGVTVFTVGLEGSDDTQLGQISSHPPEKYL 393


>gi|327538644|gb|EGF25299.1| protein containing von Willebrand factor, type A domains
           [Rhodopirellula baltica WH47]
          Length = 388

 Score = 95.2 bits (235), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 57/396 (14%), Positives = 127/396 (32%), Gaps = 64/396 (16%)

Query: 2   FSLNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHA 61
           F+LN+  +    +  G   ++  I LP++  V    I V ++   +T L    D +   A
Sbjct: 19  FTLNVVDKARLRSRSGTTVVMLVILLPVMLAVAAYCINVVYMEMARTELQISTDLATRAA 78

Query: 62  ATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSL--DIV 119
              +   G+     +                     L  N +++    I  +  +     
Sbjct: 79  GRVLAVTGDKAEAIEAAERL----------------LEANPYLDRTLSIGDADIIFGKSN 122

Query: 120 VVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSS--------VKVNSQTDAR 171
              +N  Y  +         K  +       +  + M   +         +K    T   
Sbjct: 123 RTEENRRYEFTPDK------KVNSVGLRAFGADDVPMLFPTMGVPIEFRPIKQAVATQVE 176

Query: 172 LDMMIVLDVSRSM------------------ESFFDSSITKIDMAIKSINAMLEEVKLIP 213
           LD+ IVLD S SM                        ++ K    + ++ A+   + ++ 
Sbjct: 177 LDIAIVLDRSGSMAFSHDEVAKNGSPSSAPPGWKMGHAVPKNARWLDTVAAVNGFLDIME 236

Query: 214 DVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKF--GVSTNSTPGLKYAYNQIF 271
           D ++  +  L T+S+K +    L    + ++  +   S    G +TN   G+      + 
Sbjct: 237 DSSHDERVSLSTYSDKSKADVKLTGDYTEIRAAMNAHSTNFKGGATNIGSGILEGGATLG 296

Query: 272 DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV-I 330
           D    R   +       ++++ M+DG         + +    +      +++ +      
Sbjct: 297 DKNLARSWAS-------RVLIVMSDG---IHNTGIEPIPAAQQVANEKIMIFTVTFSNEA 346

Query: 331 RSHEFLRACAS-PNSFYLVENPHSMYDAFSHIGKDI 365
              E  +   S     +  ++   + +AF  I K +
Sbjct: 347 NVQEMEKVAVSGGGQHFHAKDSQQLAEAFRKIAKSL 382


>gi|114576315|ref|XP_515709.2| PREDICTED: matrilin-3 [Pan troglodytes]
          Length = 486

 Score = 95.2 bits (235), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 33/207 (15%), Positives = 74/207 (35%), Gaps = 26/207 (12%)

Query: 163 KVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSG 222
                    LD++ ++D SRS+        TK+   +  I      +  +       +  
Sbjct: 73  GAGVCKSRPLDLVFIIDSSRSVRPL---EFTKVKTFVSRI------IDTLDIGPADTRVA 123

Query: 223 LVTFSNKIEEFFLLEWGVSH--LQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHC 280
           +V +++ ++  F L+       L++ +  ++     T S   ++ A ++ F ++      
Sbjct: 124 VVNYASTVKIEFQLQAYTDKQSLKQAVGRITPLSTGTMSGLAIQTAMDEAFTVE---AGA 180

Query: 281 NTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA 340
               +N  K+ + +TDG       +  +      A+  G  +YA+G+        L+  A
Sbjct: 181 REPSSNIPKVAIIVTDGRPQDQVNEVVAR-----AQASGIELYAVGVDRADMES-LKMMA 234

Query: 341 S---PNSFYLVEN---PHSMYDAFSHI 361
           S       + VE       +   F   
Sbjct: 235 SEPLEEHVFYVETYGVIEKLSSRFQET 261


>gi|56797855|emb|CAG27023.1| matrilin-3a [Danio rerio]
          Length = 460

 Score = 95.2 bits (235), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 34/209 (16%), Positives = 81/209 (38%), Gaps = 26/209 (12%)

Query: 161 SVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQ 220
           +   +      LD++ ++D SRS+         + +     +  M++ + + PD     +
Sbjct: 52  AATDSQCRSRPLDLVFIIDSSRSVRP------GEFEKVKIFLADMVDTLDVGPDA---TR 102

Query: 221 SGLVTFSNKIEEFFLLEWGVSH--LQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQ 278
             +V +++ ++   LL+  ++   +++ I  +      T +   +K A ++ F     + 
Sbjct: 103 VAVVNYASTVKIESLLKSHLTKDTIKQAITRIEPLAAGTMTGMAIKKAMDEAFT---EKS 159

Query: 279 HCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRA 338
               +  N  K+ + +TDG      E+  +      A+  G  +YA+G+        L+ 
Sbjct: 160 GARPKSKNISKVAIIVTDGRPQDQVEEVSAA-----ARASGIEIYAVGVDRADMRS-LKL 213

Query: 339 CAS---PNSFYLVEN---PHSMYDAFSHI 361
            AS    +  + VE       +   F   
Sbjct: 214 MASNPLEDHVFYVETYGVIEKLTSKFRET 242


>gi|312622403|ref|YP_004024016.1| von willebrand factor type a [Caldicellulosiruptor kronotskyensis
           2002]
 gi|312202870|gb|ADQ46197.1| von Willebrand factor type A [Caldicellulosiruptor kronotskyensis
           2002]
          Length = 1166

 Score = 95.2 bits (235), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 41/215 (19%), Positives = 78/215 (36%), Gaps = 29/215 (13%)

Query: 155 VMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPD 214
            +PI    +  +Q    +D++ VLD S SM     +   KI     +  + ++ +     
Sbjct: 481 EVPINKGEREINQQINYIDLVFVLDSSGSMSWNDPNGYRKI-----AAKSFVDALIQGD- 534

Query: 215 VNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQ 274
                ++ +V F +       L      ++  I  +  +G  TN   G++ A  Q+  + 
Sbjct: 535 -----RAAVVDFDDFGYLLQPLTTDFQAVKNAIDRIDSWG-GTNIAEGIRIANQQLISLS 588

Query: 275 GMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHE 334
                      +  K+I+ +TDGE               EAK  G  +Y IG+       
Sbjct: 589 ---------SEDRIKVIILLTDGEGYYDN------NLTTEAKNNGITIYTIGLGTSVDEN 633

Query: 335 FLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVT 367
            LR  A  +   ++ V +   +   F  I + +  
Sbjct: 634 LLRDIATQTGGMYFPVSSASQLPQVFKRITEIVTE 668


>gi|149641369|ref|XP_001505343.1| PREDICTED: similar to matrilin-3, partial [Ornithorhynchus
           anatinus]
          Length = 354

 Score = 94.8 bits (234), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 30/220 (13%), Positives = 80/220 (36%), Gaps = 24/220 (10%)

Query: 149 TNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEE 208
           T               +      LD++ ++D SRS+         + +     ++ +++ 
Sbjct: 127 TGGSQSPGAGGRGPGADICRSRPLDLVFIVDSSRSVRP------REFEKVKTFLSQVIDT 180

Query: 209 VKLIPDVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYA 266
           + +        +  +V +++ ++  F L+       L++ +  ++     T S   ++ A
Sbjct: 181 LDIGETA---TRVAVVNYASTVKVEFHLQTHSDKESLKQAVSRIAPLATGTMSGLAIRTA 237

Query: 267 YNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIG 326
            +++F ++           N  K++V +TDG      ++  +     +A+  G  +YA+G
Sbjct: 238 MDEVFTVE---AGARAPAFNIPKVVVIVTDGRPQDQVQEAVA-----QAQASGIEIYAVG 289

Query: 327 IRVIRSHEFLRACASP--NSFYLVEN---PHSMYDAFSHI 361
           +         +  + P     + VE       +   F   
Sbjct: 290 VGRADMQSLRQLASEPVETHAFYVETYGVIEKLTSTFRKT 329


>gi|170672288|gb|ACB29772.1| matrilin-3 alternative transcript [Homo sapiens]
          Length = 444

 Score = 94.8 bits (234), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 34/207 (16%), Positives = 73/207 (35%), Gaps = 26/207 (12%)

Query: 163 KVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSG 222
                    LD++ ++D SRS+        TK+   +  I      +  +       +  
Sbjct: 73  GAGVCKSRPLDLVFIIDSSRSVRPL---EFTKVKTFVSRI------IDTLDIGPADTRVA 123

Query: 223 LVTFSNKIEEFFLLEWGVSH--LQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHC 280
           +V +++ ++  F L+       L++ +  ++     T S   ++ A ++ F ++      
Sbjct: 124 VVNYASTVKIEFQLQAYTDKQSLKQAVGRITPLSTGTMSGLAIQTAMDEAFTVE---AGA 180

Query: 281 NTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA 340
               +N  K+ + +TDG         Q       A+  G  +YA+G+        L+  A
Sbjct: 181 REPSSNIPKVAIIVTDGRPQD-----QVNEVAARAQASGIELYAVGVDRADMAS-LKMMA 234

Query: 341 S---PNSFYLVEN---PHSMYDAFSHI 361
           S       + VE       +   F   
Sbjct: 235 SEPLEEHVFYVETYGVIEKLSSRFQET 261


>gi|158255148|dbj|BAF83545.1| unnamed protein product [Homo sapiens]
          Length = 486

 Score = 94.8 bits (234), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 34/207 (16%), Positives = 73/207 (35%), Gaps = 26/207 (12%)

Query: 163 KVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSG 222
                    LD++ ++D SRS+        TK+   +  I      +  +       +  
Sbjct: 73  GAGVCKSRPLDLVFIIDSSRSVRPL---EFTKVKTFVSRI------IDTLDIGPADTRVA 123

Query: 223 LVTFSNKIEEFFLLEWGVSH--LQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHC 280
           +V +++ ++  F L+       L++ +  ++     T S   ++ A ++ F ++      
Sbjct: 124 VVNYASTVKIEFQLQAYTDKQSLKQAVGRITPLSTGTMSGLAIQTAMDEAFTVE---AGA 180

Query: 281 NTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA 340
               +N  K+ + +TDG         Q       A+  G  +YA+G+        L+  A
Sbjct: 181 REPSSNIPKVAIIVTDGRPQD-----QVNEVAARAQASGIELYAVGVDRADMAS-LKMMA 234

Query: 341 S---PNSFYLVEN---PHSMYDAFSHI 361
           S       + VE       +   F   
Sbjct: 235 SEPLEEHVFYVETYGVIEKLSSRFQET 261


>gi|11321565|ref|NP_002372.1| matrilin-3 precursor [Homo sapiens]
 gi|14548113|sp|O15232|MATN3_HUMAN RecName: Full=Matrilin-3; Flags: Precursor
 gi|3647275|emb|CAA12110.1| matrilin-3 [Homo sapiens]
 gi|62630192|gb|AAX88937.1| unknown [Homo sapiens]
 gi|119621242|gb|EAX00837.1| matrilin 3 [Homo sapiens]
 gi|146218451|gb|AAI39908.1| Matrilin 3 [Homo sapiens]
          Length = 486

 Score = 94.8 bits (234), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 34/207 (16%), Positives = 73/207 (35%), Gaps = 26/207 (12%)

Query: 163 KVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSG 222
                    LD++ ++D SRS+        TK+   +  I      +  +       +  
Sbjct: 73  GAGVCKSRPLDLVFIIDSSRSVRPL---EFTKVKTFVSRI------IDTLDIGPADTRVA 123

Query: 223 LVTFSNKIEEFFLLEWGVSH--LQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHC 280
           +V +++ ++  F L+       L++ +  ++     T S   ++ A ++ F ++      
Sbjct: 124 VVNYASTVKIEFQLQAYTDKQSLKQAVGRITPLSTGTMSGLAIQTAMDEAFTVE---AGA 180

Query: 281 NTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA 340
               +N  K+ + +TDG         Q       A+  G  +YA+G+        L+  A
Sbjct: 181 REPSSNIPKVAIIVTDGRPQD-----QVNEVAARAQASGIELYAVGVDRADMAS-LKMMA 234

Query: 341 S---PNSFYLVEN---PHSMYDAFSHI 361
           S       + VE       +   F   
Sbjct: 235 SEPLEEHVFYVETYGVIEKLSSRFQET 261


>gi|222529355|ref|YP_002573237.1| von Willebrand factor type A [Caldicellulosiruptor bescii DSM 6725]
 gi|222456202|gb|ACM60464.1| von Willebrand factor type A [Caldicellulosiruptor bescii DSM 6725]
          Length = 1188

 Score = 94.8 bits (234), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 42/215 (19%), Positives = 77/215 (35%), Gaps = 29/215 (13%)

Query: 155 VMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPD 214
            +PI    +  +Q    +D++ VLD S SM     +   KI     +  + ++ +     
Sbjct: 481 EVPINKGEREINQQVNYIDLVFVLDSSGSMSWNDPNGYRKI-----AAKSFVDALIQGD- 534

Query: 215 VNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQ 274
                ++ +V F N       L      ++  I  +  +G  TN   G++ A  Q+    
Sbjct: 535 -----RAAVVDFDNFGYLLQPLTTDFQAVKNAIDRIDSWG-GTNIAEGIRIANQQLISRS 588

Query: 275 GMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHE 334
                      +  K+I+ +TDGE               EAK  G  +Y IG+       
Sbjct: 589 ---------SEDRIKVIILLTDGEGYYDN------NLTTEAKNNGITIYTIGLGTSVDEN 633

Query: 335 FLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVT 367
            LR  A  +   ++ V +   +   F  I + +  
Sbjct: 634 LLRDIATQTGGMYFPVSSASQLPQVFKRITEIVTE 668


>gi|55741484|ref|NP_001006980.1| cartilage matrix protein [Rattus norvegicus]
 gi|54035339|gb|AAH83869.1| Matrilin 1, cartilage matrix protein [Rattus norvegicus]
 gi|149024105|gb|EDL80602.1| matrilin 1, cartilage matrix protein [Rattus norvegicus]
          Length = 498

 Score = 94.8 bits (234), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 36/221 (16%), Positives = 83/221 (37%), Gaps = 21/221 (9%)

Query: 155 VMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPD 214
            + + S  + +       D++ V+D SRS+         + +     ++ +++ + + P+
Sbjct: 25  SLGLASQPRGHLCRTRPTDLVFVVDSSRSVRP------VEFEKVKVFLSQVIKSLDVGPN 78

Query: 215 VNNVVQSGLVTFSNKIEEFFLLEWGVSHLQ--RKIKYLSKFGVSTNSTPGLKYAYNQIFD 272
                + GLV +++ ++  F L    S     + +  +      T +   L++A  +   
Sbjct: 79  A---TRVGLVNYASTVKPEFPLRAHTSKASLLQAVHRIQPLSTGTMTGLALQFAITKALS 135

Query: 273 MQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRS 332
                +      ++  K+++ +TDG    +  D         A+  G  ++AIG+  +  
Sbjct: 136 DAEGGRSR---SSDISKVVIVVTDGRPQDSVRDVS-----ERARASGIELFAIGVGRVD- 186

Query: 333 HEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
              LR  AS      V+   S Y+    + K         D
Sbjct: 187 KATLRQIASEPQDEHVDYVES-YNVIEKLAKKFQEAFCVSD 226



 Score = 86.4 bits (212), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 41/221 (18%), Positives = 85/221 (38%), Gaps = 30/221 (13%)

Query: 159 TSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNV 218
           T +V       +  D++ ++D S+S+           ++  K IN +++ + +      +
Sbjct: 262 TCNVCRGGGNGSATDLVFLIDGSKSVRP------ENFELVKKFINQIVDTLDVSD---RL 312

Query: 219 VQSGLVTFSNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAY-NQIFDMQG 275
            Q GLV +S+ I + F L        ++  ++ +S     T +   LKY   N      G
Sbjct: 313 AQVGLVQYSSSIRQEFPLGRFHTKKDIKAAVRNMSYMEKGTMTGAALKYLIDNSFTVSSG 372

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF 335
            R          +K+ +  TDG +     D        +AK  G  ++A+G+      E 
Sbjct: 373 ARPGA-------QKVGIVFTDGRSQDYINDA-----ARKAKDLGFKMFAVGVGNAVEEEL 420

Query: 336 LRACASP--NSFYLVENPHSMYDAFSHIGKDIVTKRIWYDK 374
               + P  + ++   +    +   + IGK +  K    ++
Sbjct: 421 REIASEPVADHYFYTAD----FKTINQIGKKLQKKICVEEE 457


>gi|73980586|ref|XP_540098.2| PREDICTED: similar to matrilin 3 precursor [Canis familiaris]
          Length = 481

 Score = 94.8 bits (234), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 34/210 (16%), Positives = 73/210 (34%), Gaps = 26/210 (12%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
            +          LD++ ++D SRS+        TK+   +  I      +  +       
Sbjct: 69  GARGAGVCKSRPLDLVFIIDSSRSVRPL---EFTKVKTFVSQI------IDTLDIGAADT 119

Query: 220 QSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           +  +V +++ ++  F L+       L++ +  ++     T S   ++ A ++ F  +   
Sbjct: 120 RVAVVNYASTVKIEFHLQTYSDKQSLKQAVARITPLSTGTMSGLAIQTAMDEAFTEE--- 176

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                  +N  K+ + +TDG         Q       A+  G  +YA+G+        L+
Sbjct: 177 AGARGPTSNIPKVAIIVTDGRPQD-----QVNEVAARARASGIELYAVGVDRADMES-LK 230

Query: 338 ACAS---PNSFYLVEN---PHSMYDAFSHI 361
             AS       + VE       +   F   
Sbjct: 231 IIASEPLDEHVFYVETYGVIEKLSSRFQET 260


>gi|301777181|ref|XP_002924014.1| PREDICTED: cartilage matrix protein-like [Ailuropoda melanoleuca]
          Length = 495

 Score = 94.5 bits (233), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 36/218 (16%), Positives = 82/218 (37%), Gaps = 21/218 (9%)

Query: 155 VMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPD 214
            + +T     +       D++ V+D SRS+         + +     ++ ++E + + P+
Sbjct: 22  ALGLTPQAGGHLCRTRPTDLVFVVDSSRSVRP------VEFEKVKVFLSQVIESLDVGPN 75

Query: 215 VNNVVQSGLVTFSNKIEEFFLLEWGVSHLQ--RKIKYLSKFGVSTNSTPGLKYAYNQIFD 272
                + G+V +++ +++ F L    S     R ++ +      T +   +++A  + F 
Sbjct: 76  A---TRVGVVNYASAVKQEFPLRAHGSKASLLRAVRRIQPLSTGTMTGLAIQFAITKAFS 132

Query: 273 MQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRS 332
                        +  K+++ +TDG    +  D  +      A+  G  ++AIG+  +  
Sbjct: 133 NTE---GGRARSPDISKVVIVVTDGRPQDSVRDVSAR-----ARANGIELFAIGVGRVD- 183

Query: 333 HEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
              LR  AS      V+   S Y     + K       
Sbjct: 184 KATLRQIASEPQDEHVDYVES-YSVIEKLSKKFQEAFC 220



 Score = 82.5 bits (202), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 39/220 (17%), Positives = 83/220 (37%), Gaps = 30/220 (13%)

Query: 159 TSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNV 218
           T +V       +  D++ ++D S+S+           ++  K IN +++ + +      +
Sbjct: 260 TCNVCSGGGGSSATDLVFLIDGSKSVRP------ENFELVKKFINQIVDTLDVSD---KL 310

Query: 219 VQSGLVTFSNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAY-NQIFDMQG 275
            Q GLV +S+ + + F L        ++  ++ +S     T +   LKY   N      G
Sbjct: 311 AQVGLVQYSSSVRQEFPLGRFHTKKDIKAAVRNMSYMEKGTMTGAALKYLIDNSFTVSSG 370

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF 335
            R          +K+ +  TDG +     +        +AK  G  ++A+G+      E 
Sbjct: 371 ARPGA-------QKVGIVFTDGRSQDYINNA-----AKKAKDLGFKMFAVGVGNAVEDEL 418

Query: 336 LRACASP--NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
               + P    ++   +    +   + IGK +  K    +
Sbjct: 419 REIASEPVAEHYFYTAD----FKTINQIGKRLQKKICVEE 454


>gi|28374313|gb|AAH45465.1| Matn1 protein [Danio rerio]
          Length = 507

 Score = 94.5 bits (233), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 35/244 (14%), Positives = 91/244 (37%), Gaps = 28/244 (11%)

Query: 126 GYSISAISRYKIPLKFCTFIPWYTNSR-HIVMPITSSVKVNSQTDARLDMMIVLDVSRSM 184
             S+    RY + L     +     ++  + +   +++          D++ ++D SRS+
Sbjct: 8   SRSLGLTPRYSMTLPGFVMLLCIMGAQATVDLRQAAAMAAGLCNTKPTDVVFIVDSSRSV 67

Query: 185 ESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQ 244
                   ++ +     +  +++ + + PD     + G+V ++++++    L+   +   
Sbjct: 68  RP------SEFEQVKVFLAKVIDGLSVGPDA---TRVGVVNYASRVKNEVSLKSHKTKAA 118

Query: 245 --RKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLST 302
             + +  +      T +   +++A N  F      +    +  +  K+ + +TDG     
Sbjct: 119 LVKAVSKIEPLSTGTMTGLAIQFAMNVAFSEAEGGR----KSPDISKVAIIVTDGRPQDN 174

Query: 303 KEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACAS---PNSFYLVEN---PHSMYD 356
             D         A++ G  ++AIG+  +     LR  AS    +    VE+      +  
Sbjct: 175 IRD-----IAARAREAGIEIFAIGVGRVD-MTTLRQMASEPLEDHVDYVESYSLIEKLTK 228

Query: 357 AFSH 360
            F  
Sbjct: 229 KFQE 232



 Score = 77.9 bits (190), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 36/213 (16%), Positives = 82/213 (38%), Gaps = 28/213 (13%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           ++ ++A  D++ ++D S+S+           ++  K IN +++++ +     +V   GLV
Sbjct: 278 SACSNAATDVVFLIDGSKSVRP------ENFELVKKWINLIIDKLDVSETNTHV---GLV 328

Query: 225 TFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S+ +++ F L        L+  +K ++     T +   L +  +  F           
Sbjct: 329 QYSSTVKQEFPLGRHNSKRSLKEAVKRMNYMERGTMTGHALSFLVDNSFGPNQ------G 382

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                 K+ +  TDG +     D        +AK  G  +YA+G+      E     + P
Sbjct: 383 ARPGVPKVGIVFTDGRSQDYIGDA-----AKKAKALGFKMYAVGVGNAVEDELREIASEP 437

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
             + ++   +  +M      I K +       +
Sbjct: 438 IADHYFYTADFKTMNQ----IAKKLQINVCQEE 466


>gi|293349448|ref|XP_002727144.1| PREDICTED: collagen type VI alpha 6-like [Rattus norvegicus]
          Length = 2264

 Score = 94.1 bits (232), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 56/337 (16%), Positives = 122/337 (36%), Gaps = 38/337 (11%)

Query: 41  SHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRD 100
            + F  +  + + ID+      T +     G+    +       +        F   + D
Sbjct: 675 LNTFMSQNDIANAIDQMAHIGETTL----TGSALTFVSQYFSPEKGARPNVRKFLILITD 730

Query: 101 NGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIP-------WYTNSRH 153
                +  DIV+  ++ +        YS+         L+  +  P        +   +H
Sbjct: 731 G----EAQDIVKDPAVALRKDG-VIIYSVGVFGSNVTQLEEISGKPEMVFYVENFDILQH 785

Query: 154 IVMPITSSVKVNSQTDAR---LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVK 210
           I   +   +    +   R   LD++ V+D S S+         + ++       M+  VK
Sbjct: 786 IEDDLVLGICSPREECKRIEVLDVVFVIDSSGSI------DYQEYNIMKDF---MIGLVK 836

Query: 211 LIPDVNNVVQSGLVTFSNKIEEFFLLEW-GVS-HLQRKIKYLSKFGVSTNSTPGLKYAYN 268
                 N V+ G + +++  E  F L+  G    +   ++     G +T +   L ++ +
Sbjct: 837 KADVGKNQVRFGALKYADDPEVLFYLDELGTKLEVISVLQNDQPMGGNTYTAEALAFSDH 896

Query: 269 QIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR 328
              + +G R H         ++++ +TDGE+    + ++        + +G +V A+GI 
Sbjct: 897 MFTEARGSRLHKG-----VPQVLIVITDGES---HDAEKLNATAKALRDKGILVLAVGIA 948

Query: 329 VIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDI 365
              + E L    S + +Y VE    +   FS +   +
Sbjct: 949 GANTWELLAMAGSSDKYYFVETFGGLKGIFSDVSASV 985



 Score = 91.0 bits (224), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 45/204 (22%), Positives = 83/204 (40%), Gaps = 27/204 (13%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
            +  D + D+M ++D S S+      + +K+ + +K++      V       + VQ G+V
Sbjct: 613 EACRDMKADIMFLVDSSGSIGLE---NFSKMKVFMKNL------VSKSQIGADRVQIGVV 663

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS++  E F L   +S   +   I  ++  G +T +   L +        +G R     
Sbjct: 664 QFSHENREEFQLNTFMSQNDIANAIDQMAHIGETTLTGSALTFVSQYFSPEKGAR----- 718

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
              N +K ++ +TDGE                 +K G I+Y++G+      +       P
Sbjct: 719 --PNVRKFLILITDGE-----AQDIVKDPAVALRKDGVIIYSVGVFGSNVTQLEEISGKP 771

Query: 343 NSFYLVENPHSMYDAFSHIGKDIV 366
              + VEN    +D   HI  D+V
Sbjct: 772 EMVFYVEN----FDILQHIEDDLV 791



 Score = 79.8 bits (195), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 36/214 (16%), Positives = 82/214 (38%), Gaps = 22/214 (10%)

Query: 154  IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
            +   + +S KV+     ++D++ ++D S S+         K+   + S+      V+   
Sbjct: 981  VSASVCNSSKVD-CEIEKVDLVFLMDGSNSIH---PDDFQKMKEFLASV------VQDFD 1030

Query: 214  DVNNVVQSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIF 271
               N V+ G+  FS+     FLL        +  +I+ + +    T+    L+   +   
Sbjct: 1031 VSLNRVRIGVAQFSDSYRSEFLLGTFTGEKEISTQIEAIQQIFGYTHIGDALRKVKHYFR 1090

Query: 272  DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR 331
               G R +  T      ++++ +TDG         +      E + +G  +Y++GI  + 
Sbjct: 1091 PDTGSRINAGTP-----QVLLVLTDGR-----SQDEVAQAAEELRHKGVDIYSVGIGDVD 1140

Query: 332  SHEFLRACASPNSFYLVENPHSMYDAFSHIGKDI 365
              + ++   +      V N   +      I ++I
Sbjct: 1141 DQQLIQITGTAEKKLTVHNFDELKKVKKRIVRNI 1174



 Score = 76.3 bits (186), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 48/359 (13%), Positives = 119/359 (33%), Gaps = 42/359 (11%)

Query: 34  LGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMS 93
           L M +  + +      L   + ++   AA +   +   + ++  +    + +I       
Sbjct: 282 LSMGVNKTEVLQRIQDLSPHVGQAYTGAALRKTRKEVFSAQRGSRKNQGVPQIAVLVTHR 341

Query: 94  FRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRY---KIPLKFCTFIPWYTN 150
             ++      VN   + V  T   + V   N    +  I+ Y   +   K   F    T+
Sbjct: 342 ASDDNVTKAAVNLRREGV--TVFTMGVEGANPE-QLEKIASYPAEQFTSKLSNFSELATH 398

Query: 151 SRH--------------IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKID 196
           ++               +    T ++K         D+ +++D S       ++  T   
Sbjct: 399 NQTFLKKLRNQITHTVSVFSERTETLKSACVDTEEADIYLLIDGSG------NTQPTDFH 452

Query: 197 MAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFG 254
                ++ +++   + P     V+ G V +++  +  F +        L + I  + + G
Sbjct: 453 EMKIFLSEVVDMFNIAPHK---VRVGAVQYADTWDLEFEISKYTNKPDLGKAIDNIRQMG 509

Query: 255 VSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNE 314
            +TN+   L +    +   +  R             +V +T+G           L   ++
Sbjct: 510 GNTNTGAALNFTLTLLQRAKKQR------GNKVPCHLVVLTNG-----MSQDSVLGPAHK 558

Query: 315 AKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
            ++    V+AIG++     +           Y V    ++ D  + + ++I  +    D
Sbjct: 559 LREENIRVHAIGVKEANQTQLREIAGDEKRVYYVHEFDALRDIRNQVVQEICAEEACRD 617



 Score = 64.0 bits (154), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 36/207 (17%), Positives = 75/207 (36%), Gaps = 26/207 (12%)

Query: 159 TSSVKVNSQTDARL-DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNN 217
           T  + V +     + D++ +LD++       + S   +D     +    E V  +    N
Sbjct: 213 TDDIIVEACQGPSVADVVFLLDMA------INGSQENLDHLKAFLG---ESVSALDIKEN 263

Query: 218 VVQSGLVTFSNKIEEFFLLEWGVSHLQ--RKIKYLSKFGVSTNSTPGLKYAYNQIFDMQG 275
            ++ GLV +SN+      L  GV+  +  ++I+ LS       +   L+    ++F    
Sbjct: 264 CMRVGLVAYSNETRVISSLSMGVNKTEVLQRIQDLSPHVGQAYTGAALRKTRKEVFSA-- 321

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF 335
             Q  + ++    +I V +T         D          ++ G  V+ +G+      + 
Sbjct: 322 --QRGSRKNQGVPQIAVLVT-----HRASDDNVTKAAVNLRREGVTVFTMGVEGANPEQL 374

Query: 336 LRACASPNSFYLVENPHSMYDAFSHIG 362
            +  +     Y  E   S    FS + 
Sbjct: 375 EKIAS-----YPAEQFTSKLSNFSELA 396



 Score = 50.9 bits (120), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 25/186 (13%), Positives = 63/186 (33%), Gaps = 24/186 (12%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D++ ++D S  +       +    +    I  ++  +   P   N  +  L  +S+ +  
Sbjct: 26  DVVFLVDSSDHLG------MKSFPLVKTFIQKLVSSL---PVEANKYRVALAQYSDALHN 76

Query: 233 FFLLEWGVSHLQRKIKYLSKF----GVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
            F L    +     + +L K     G S      L+ A+   F      +        + 
Sbjct: 77  EFHLGAFKNR-NPMLNHLKKNFGFIGGSLKIGNALQEAHRTYFSAPTNGRDKK----QFP 131

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLV 348
            I+V +      S + +          ++ G  + ++G++     + L+A A+    + +
Sbjct: 132 PILVVL-----ASAESEDDVEEASKALREDGVKIISVGVQKASEED-LKAMATSQFHFNL 185

Query: 349 ENPHSM 354
                +
Sbjct: 186 RTARDL 191


>gi|311253580|ref|XP_003125597.1| PREDICTED: matrilin-2-like [Sus scrofa]
          Length = 423

 Score = 94.1 bits (232), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 34/217 (15%), Positives = 79/217 (36%), Gaps = 26/217 (11%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           S       T+  +D++ V+D S+S+           ++  + +  +++ + + P      
Sbjct: 102 SWSGTRGCTEGPVDLVFVIDGSKSLGE------ENFEIVKQFVTGIIDSLTISPKAA--- 152

Query: 220 QSGLVTFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + GL+ +S ++   F L    S   +++ +  +   G  + +   LK+ + + F      
Sbjct: 153 RVGLLQYSTQVRTEFTLRNFGSAKDMKKAVASMKYMGKGSMTGLALKHMFERSFTQIE-- 210

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                  A   ++ +  TDG             + ++AK  G  +YA+G+      E   
Sbjct: 211 -GARPLSARVPRVAIVFTDGR-----AQDDVSEWASKAKANGITMYAVGVGKAIEEELQE 264

Query: 338 ACASP--NSFYLVENPHSMYDAFSHIGKDIVTKRIWY 372
             + P     +  E+    +     I   +  K I  
Sbjct: 265 IASEPTDKHLFYAED----FSTMGEISDKLQ-KGICE 296


>gi|311253578|ref|XP_001926459.2| PREDICTED: matrilin-2 [Sus scrofa]
          Length = 707

 Score = 94.1 bits (232), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 33/212 (15%), Positives = 78/212 (36%), Gaps = 26/212 (12%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              T+  +D++ V+D S+S+           ++  + +  +++ + + P      + GL+
Sbjct: 391 KRCTEGPVDLVFVIDGSKSLGE------ENFEIVKQFVTGIIDSLTISPKAA---RVGLL 441

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S ++   F L    S   +++ +  +   G  + +   LK+ + + F           
Sbjct: 442 QYSTQVRTEFTLRNFGSAKDMKKAVASMKYMGKGSMTGLALKHMFERSFTQIE---GARP 498

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
             A   ++ +  TDG             + ++AK  G  +YA+G+      E     + P
Sbjct: 499 LSARVPRVAIVFTDGR-----AQDDVSEWASKAKANGITMYAVGVGKAIEEELQEIASEP 553

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVTKRIWY 372
                +  E+    +     I   +  K I  
Sbjct: 554 TDKHLFYAED----FSTMGEISDKLQ-KGICE 580


>gi|32477945|ref|NP_870939.1| hypothetical protein RB13237 [Rhodopirellula baltica SH 1]
 gi|32448502|emb|CAD78017.1| conserved hypothetical protein [Rhodopirellula baltica SH 1]
          Length = 388

 Score = 94.1 bits (232), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 55/387 (14%), Positives = 129/387 (33%), Gaps = 46/387 (11%)

Query: 2   FSLNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHA 61
           F+LN+  +    +  G   ++  I LP++  V    I V ++   +T L    D +   A
Sbjct: 19  FTLNVVDKARLRSRSGTTVVMLVILLPVMLAVAAYCINVVYMEMARTELQISTDLATRAA 78

Query: 62  ATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVV 121
              +       ++ +           N +     +    +      +    +   +    
Sbjct: 79  GRVLA---VTGDKAEAIEAAERLLEANPYLDRTLSIGDADIIFGKSNRTEENRRYEFTPD 135

Query: 122 PQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPIT-SSVKVNSQTDARLDMMIVLDV 180
            +    S+ A     +P+ F            + +PI    +K    T   LD+ IVLD 
Sbjct: 136 KKVNSVSLRAFGADDVPMLF----------PTMGVPIEFRPIKQAVATQVELDIAIVLDR 185

Query: 181 SRSM------------------ESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSG 222
           S SM                        ++ +    + ++ A+   + ++ D ++  +  
Sbjct: 186 SGSMAFSHDEVAKNGSPSSAPPGWKMGHAVPENARWLDTVAAVNGFLDIMEDSSHDERVS 245

Query: 223 LVTFSNKIEEFFLLEWGVSHLQRKIKYLSK--FGVSTNSTPGLKYAYNQIFDMQGMRQHC 280
           L T+S+K +    L    + ++  +   S    G +TN   G+      + D +  R   
Sbjct: 246 LSTYSDKSKADVKLTGDYTEIRAAMNAHSTKFKGGATNIGSGILEGGATLGDKKLARSWA 305

Query: 281 NTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR-VIRSHEFLRAC 339
           +       ++++ M+DG         + +    +      +++ +         E  +  
Sbjct: 306 S-------RVLIVMSDG---IHNTGIEPIPAAQQVANEKIMIFTVTFSDEANVQEMEKVA 355

Query: 340 AS-PNSFYLVENPHSMYDAFSHIGKDI 365
            S     +  ++   + +AF  I K +
Sbjct: 356 VSGGGQHFHAKDSQQLTEAFRKIAKSL 382


>gi|293361343|ref|XP_236593.5| PREDICTED: collagen type VI alpha 6 [Rattus norvegicus]
          Length = 2264

 Score = 94.1 bits (232), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 56/337 (16%), Positives = 122/337 (36%), Gaps = 38/337 (11%)

Query: 41  SHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRD 100
            + F  +  + + ID+      T +     G+    +       +        F   + D
Sbjct: 675 LNTFMSQNDIANAIDQMAHIGETTL----TGSALTFVSQYFSPEKGARPNVRKFLILITD 730

Query: 101 NGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIP-------WYTNSRH 153
                +  DIV+  ++ +        YS+         L+  +  P        +   +H
Sbjct: 731 G----EAQDIVKDPAVALRKDG-VIIYSVGVFGSNVTQLEEISGKPEMVFYVENFDILQH 785

Query: 154 IVMPITSSVKVNSQTDAR---LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVK 210
           I   +   +    +   R   LD++ V+D S S+         + ++       M+  VK
Sbjct: 786 IEDDLVLGICSPREECKRIEVLDVVFVIDSSGSI------DYQEYNIMKDF---MIGLVK 836

Query: 211 LIPDVNNVVQSGLVTFSNKIEEFFLLEW-GVS-HLQRKIKYLSKFGVSTNSTPGLKYAYN 268
                 N V+ G + +++  E  F L+  G    +   ++     G +T +   L ++ +
Sbjct: 837 KADVGKNQVRFGALKYADDPEVLFYLDELGTKLEVISVLQNDQPMGGNTYTAEALAFSDH 896

Query: 269 QIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR 328
              + +G R H         ++++ +TDGE+    + ++        + +G +V A+GI 
Sbjct: 897 MFTEARGSRLHKG-----VPQVLIVITDGES---HDAEKLNATAKALRDKGILVLAVGIA 948

Query: 329 VIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDI 365
              + E L    S + +Y VE    +   FS +   +
Sbjct: 949 GANTWELLAMAGSSDKYYFVETFGGLKGIFSDVSASV 985



 Score = 90.6 bits (223), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 45/204 (22%), Positives = 83/204 (40%), Gaps = 27/204 (13%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
            +  D + D+M ++D S S+      + +K+ + +K++      V       + VQ G+V
Sbjct: 613 EACRDMKADIMFLVDSSGSIGLE---NFSKMKVFMKNL------VSKSQIGADRVQIGVV 663

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS++  E F L   +S   +   I  ++  G +T +   L +        +G R     
Sbjct: 664 QFSHENREEFQLNTFMSQNDIANAIDQMAHIGETTLTGSALTFVSQYFSPEKGAR----- 718

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
              N +K ++ +TDGE                 +K G I+Y++G+      +       P
Sbjct: 719 --PNVRKFLILITDGE-----AQDIVKDPAVALRKDGVIIYSVGVFGSNVTQLEEISGKP 771

Query: 343 NSFYLVENPHSMYDAFSHIGKDIV 366
              + VEN    +D   HI  D+V
Sbjct: 772 EMVFYVEN----FDILQHIEDDLV 791



 Score = 79.8 bits (195), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 36/214 (16%), Positives = 82/214 (38%), Gaps = 22/214 (10%)

Query: 154  IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
            +   + +S KV+     ++D++ ++D S S+         K+   + S+      V+   
Sbjct: 981  VSASVCNSSKVD-CEIEKVDLVFLMDGSNSIH---PDDFQKMKEFLASV------VQDFD 1030

Query: 214  DVNNVVQSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIF 271
               N V+ G+  FS+     FLL        +  +I+ + +    T+    L+   +   
Sbjct: 1031 VSLNRVRIGVAQFSDSYRSEFLLGTFTGEKEISTQIEAIQQIFGYTHIGDALRKVKHYFR 1090

Query: 272  DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR 331
               G R +  T      ++++ +TDG         +      E + +G  +Y++GI  + 
Sbjct: 1091 PDTGSRINAGTP-----QVLLVLTDGR-----SQDEVAQAAEELRHKGVDIYSVGIGDVD 1140

Query: 332  SHEFLRACASPNSFYLVENPHSMYDAFSHIGKDI 365
              + ++   +      V N   +      I ++I
Sbjct: 1141 DQQLIQITGTAEKKLTVHNFDELKKVKKRIVRNI 1174



 Score = 76.3 bits (186), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 48/359 (13%), Positives = 119/359 (33%), Gaps = 42/359 (11%)

Query: 34  LGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMS 93
           L M +  + +      L   + ++   AA +   +   + ++  +    + +I       
Sbjct: 282 LSMGVNKTEVLQRIQDLSPHVGQAYTGAALRKTRKEVFSAQRGSRKNQGVPQIAVLVTHR 341

Query: 94  FRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRY---KIPLKFCTFIPWYTN 150
             ++      VN   + V  T   + V   N    +  I+ Y   +   K   F    T+
Sbjct: 342 ASDDNVTKAAVNLRREGV--TVFTMGVEGANPE-QLEKIASYPAEQFTSKLSNFSELATH 398

Query: 151 SRH--------------IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKID 196
           ++               +    T ++K         D+ +++D S       ++  T   
Sbjct: 399 NQTFLKKLRNQITHTVSVFSERTETLKSACVDTEEADIYLLIDGSG------NTQPTDFH 452

Query: 197 MAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFG 254
                ++ +++   + P     V+ G V +++  +  F +        L + I  + + G
Sbjct: 453 EMKIFLSEVVDMFNIAPHK---VRVGAVQYADTWDLEFEISKYTNKPDLGKAIDNIRQMG 509

Query: 255 VSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNE 314
            +TN+   L +    +   +  R             +V +T+G           L   ++
Sbjct: 510 GNTNTGAALNFTLTLLQRAKKQR------GNKVPCHLVVLTNG-----MSQDSVLGPAHK 558

Query: 315 AKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
            ++    V+AIG++     +           Y V    ++ D  + + ++I  +    D
Sbjct: 559 LREENIRVHAIGVKEANQTQLREIAGDEKRVYYVHEFDALRDIRNQVVQEICAEEACRD 617



 Score = 64.0 bits (154), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 36/207 (17%), Positives = 75/207 (36%), Gaps = 26/207 (12%)

Query: 159 TSSVKVNSQTDARL-DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNN 217
           T  + V +     + D++ +LD++       + S   +D     +    E V  +    N
Sbjct: 213 TDDIIVEACQGPSVADVVFLLDMA------INGSQENLDHLKAFLG---ESVSALDIKEN 263

Query: 218 VVQSGLVTFSNKIEEFFLLEWGVSHLQ--RKIKYLSKFGVSTNSTPGLKYAYNQIFDMQG 275
            ++ GLV +SN+      L  GV+  +  ++I+ LS       +   L+    ++F    
Sbjct: 264 CMRVGLVAYSNETRVISSLSMGVNKTEVLQRIQDLSPHVGQAYTGAALRKTRKEVFSA-- 321

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF 335
             Q  + ++    +I V +T         D          ++ G  V+ +G+      + 
Sbjct: 322 --QRGSRKNQGVPQIAVLVT-----HRASDDNVTKAAVNLRREGVTVFTMGVEGANPEQL 374

Query: 336 LRACASPNSFYLVENPHSMYDAFSHIG 362
            +  +     Y  E   S    FS + 
Sbjct: 375 EKIAS-----YPAEQFTSKLSNFSELA 396



 Score = 50.9 bits (120), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 25/186 (13%), Positives = 63/186 (33%), Gaps = 24/186 (12%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D++ ++D S  +       +    +    I  ++  +   P   N  +  L  +S+ +  
Sbjct: 26  DVVFLVDSSDHLG------MKSFPLVKTFIQKLVSSL---PVEANKYRVALAQYSDALHN 76

Query: 233 FFLLEWGVSHLQRKIKYLSKF----GVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
            F L    +     + +L K     G S      L+ A+   F      +        + 
Sbjct: 77  EFHLGAFKNR-NPMLNHLKKNFGFIGGSLKIGNALQEAHRTYFSAPTNGRDKK----QFP 131

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLV 348
            I+V +      S + +          ++ G  + ++G++     + L+A A+    + +
Sbjct: 132 PILVVL-----ASAESEDDVEEASKALREDGVKIISVGVQKASEED-LKAMATSQFHFNL 185

Query: 349 ENPHSM 354
                +
Sbjct: 186 RTARDL 191


>gi|156616286|ref|NP_001096077.1| collagen alpha-6(VI) chain isoform 1 [Mus musculus]
 gi|189082903|sp|Q8C6K9|CO6A6_MOUSE RecName: Full=Collagen alpha-6(VI) chain; Flags: Precursor
          Length = 2265

 Score = 93.7 bits (231), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 46/204 (22%), Positives = 84/204 (41%), Gaps = 27/204 (13%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
            +  D + D+M ++D S S+      + +K+ M +K++      V       + VQ G+V
Sbjct: 613 EACRDMKADIMFLVDSSGSIGPE---NFSKMKMFMKNL------VSKSQIGADRVQIGVV 663

Query: 225 TFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS++ +E F L   +  S +   I  ++  G +T +   L +        +G R     
Sbjct: 664 QFSHENKEEFQLNTFMSQSDIANAIDRMTHIGETTLTGSALTFVSQYFSPDKGAR----- 718

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
              N +K ++ +TDGE                 +K G I+Y++G+      +       P
Sbjct: 719 --PNVRKFLILITDGE-----AQDIVRDPAIALRKEGVIIYSVGVFGSNVTQLEEISGKP 771

Query: 343 NSFYLVENPHSMYDAFSHIGKDIV 366
              + VEN    +D   HI  D+V
Sbjct: 772 EMVFYVEN----FDILQHIEDDLV 791



 Score = 91.8 bits (226), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 59/337 (17%), Positives = 123/337 (36%), Gaps = 38/337 (11%)

Query: 41  SHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRD 100
            + F  ++ + + IDR      T +     G+    +       +        F   + D
Sbjct: 675 LNTFMSQSDIANAIDRMTHIGETTL----TGSALTFVSQYFSPDKGARPNVRKFLILITD 730

Query: 101 NGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIP-------WYTNSRH 153
                +  DIVR  ++ +        YS+         L+  +  P        +   +H
Sbjct: 731 G----EAQDIVRDPAIALRKEG-VIIYSVGVFGSNVTQLEEISGKPEMVFYVENFDILQH 785

Query: 154 IVMPITSSVKVNSQTDAR---LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVK 210
           I   +   +    +   R   LD++ V+D S S+         + ++       M+  VK
Sbjct: 786 IEDDLVLGICSPREECKRIEVLDVVFVIDSSGSI------DYQEYNIMKDF---MIGLVK 836

Query: 211 LIPDVNNVVQSGLVTFSNKIEEFFLLEW-GVS-HLQRKIKYLSKFGVSTNSTPGLKYAYN 268
                 N V+ G + +++  E  F L+  G    +   ++     G +T +   L ++ +
Sbjct: 837 KADVGKNQVRFGALKYADDPEVLFYLDELGTKLEVVSVLQNDHPMGGNTYTAEALAFSDH 896

Query: 269 QIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR 328
              + +G R H         ++++ +TDGE+    + ++        + +G +V A+GI 
Sbjct: 897 MFTEARGSRLHKG-----VPQVLIVITDGES---HDAEKLNTTAKALRDKGILVLAVGIA 948

Query: 329 VIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDI 365
              S E L    S + +Y VE    +   FS +   +
Sbjct: 949 GANSWELLAMAGSSDKYYFVETFGGLKGIFSDVSASV 985



 Score = 77.1 bits (188), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 36/214 (16%), Positives = 81/214 (37%), Gaps = 22/214 (10%)

Query: 154  IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
            +   + +S KV+     ++D++ ++D S S+         K+   + S+      V+   
Sbjct: 981  VSASVCNSSKVD-CEIEKVDLVFLMDGSNSIH---PDDFQKMKGFLVSV------VQDFD 1030

Query: 214  DVNNVVQSGLVTFSNKIEEFFLLEWGVSH--LQRKIKYLSKFGVSTNSTPGLKYAYNQIF 271
               N V+ G+  FS+     FLL        +  +I+ + +    T+    L+    + +
Sbjct: 1031 VSLNRVRIGVAQFSDSYRSEFLLGTFTGEREISTQIEGIQQIFGYTHIGDALRKV--KYY 1088

Query: 272  DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR 331
                M    N       ++++ +TDG         +      E + +G  +Y++GI  + 
Sbjct: 1089 FQPDMGSRINAGT---PQVLLVLTDGR-----SQDEVAQAAEELRHKGVDIYSVGIGDVD 1140

Query: 332  SHEFLRACASPNSFYLVENPHSMYDAFSHIGKDI 365
              E ++   +      V N   +      I ++I
Sbjct: 1141 DQELVQITGTAEKKLTVHNFDELKKVKKRIVRNI 1174



 Score = 74.0 bits (180), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 32/227 (14%), Positives = 82/227 (36%), Gaps = 22/227 (9%)

Query: 149 TNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEE 208
           T++  +    T ++K         D+ +++D S S      +  T        ++ ++  
Sbjct: 411 THTVSVFSERTETLKSACVDTEEADIYLLIDGSGS------TQPTDFHEMKTFLSEVVGM 464

Query: 209 VKLIPDVNNVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYA 266
             + P     V+ G V +++  +  F +        L + I+ + + G +TN+   L + 
Sbjct: 465 FNIAPHK---VRVGAVQYADTWDLEFEISKYSNKPDLGKAIENIRQMGGNTNTGAALNFT 521

Query: 267 YNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIG 326
              +   +  R       +     +V +T+G           L   ++ ++    V+AIG
Sbjct: 522 LKLLQRAKKER------GSKVPCHLVVLTNG-----MSRDSVLGPAHKLREENIRVHAIG 570

Query: 327 IRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
           ++     +           Y V    ++ +  + + ++I  +    D
Sbjct: 571 VKEANQTQLREIAGEEKRVYYVHEFDALRNIRNQVVQEICAEEACRD 617



 Score = 61.7 bits (148), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 31/188 (16%), Positives = 70/188 (37%), Gaps = 21/188 (11%)

Query: 162 VKVNSQTDARL-DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQ 220
           + V +     + D++ +LD++       + S   +D     +    E +  +    N ++
Sbjct: 216 IIVEACQGPSVADVVFLLDMA------INGSQEDLDHLKAFLG---ESISALDIKENCMR 266

Query: 221 SGLVTFSNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQ 278
            GLVT+SN+      L  G   + + ++I+ LS       +   L+    +IF      Q
Sbjct: 267 VGLVTYSNETRVISSLSTGNNKTEVLQRIQDLSPQVGQAYTGAALRKTRKEIFSA----Q 322

Query: 279 HCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRA 338
             + ++    +I V +T         +          ++ G  ++ +GI      E  + 
Sbjct: 323 RGSRKNQGVPQIAVLVT-----HRASEDNVTKAAVNLRREGVTIFTMGIEGANPDELEKI 377

Query: 339 CASPNSFY 346
            + P   +
Sbjct: 378 ASHPAEQF 385



 Score = 54.0 bits (128), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 31/205 (15%), Positives = 70/205 (34%), Gaps = 29/205 (14%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D++ ++D S  +       +    +    I+ M+  +   P   N  +  L  +S+ +  
Sbjct: 26  DVVFLVDSSDHLG------LKSFPLVKTFIHKMISSL---PIEANKYRVALAQYSDALHN 76

Query: 233 FFLLEWGVSHLQRKIKYLSKF----GVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
            F L    +     + +L K     G S      L+ A+   F      +        + 
Sbjct: 77  EFQLGTFKNR-NPMLNHLKKNFGFIGGSLKIGNALQEAHRTYFSAPTNGRDKK----QFP 131

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLV 348
            I+V +      S + +          ++ G  + ++G++       L+A A+    + +
Sbjct: 132 PILVVL-----ASAESEDDVEEAAKALREDGVKIISVGVQKASEEN-LKAMATSQFHFNL 185

Query: 349 ENPHSMYDAFS----HIGKDIVTKR 369
                +   F+     I KD+   R
Sbjct: 186 RTARDL-SVFAPNMTEIIKDVTQYR 209


>gi|56675026|gb|AAW19655.1| matrilin-1 [Cervus elaphus]
          Length = 230

 Score = 93.7 bits (231), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 34/203 (16%), Positives = 77/203 (37%), Gaps = 21/203 (10%)

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
             D++ V+D SRS+         + +     ++ ++E + + P+     + GLV +++ +
Sbjct: 1   PTDLVFVVDSSRSVRP------VEFEKVKVFLSQVIESLDVGPNA---TRVGLVNYASSV 51

Query: 231 EEFFLLEWGVSHLQ--RKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
           ++ F L    S  +  + ++ +      T +   + +A  +                +  
Sbjct: 52  KQEFPLRAHSSKAELLQAVRRIQPLSTGTMTGLAIHFAITKALSDAE---GGRPRSPDIS 108

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLV 348
           K+++ +TDG    +  D  +      A+  G  ++AIG+  +     LR  AS      V
Sbjct: 109 KVVIVVTDGRPQDSVRDVSAR-----ARASGIELFAIGVGRVD-KATLRQIASEPQDEHV 162

Query: 349 ENPHSMYDAFSHIGKDIVTKRIW 371
           +   S Y     + K        
Sbjct: 163 DYVES-YRVIEKLSKKFQEAFCL 184


>gi|312793553|ref|YP_004026476.1| von willebrand factor type a [Caldicellulosiruptor kristjanssonii
           177R1B]
 gi|312180693|gb|ADQ40863.1| von Willebrand factor type A [Caldicellulosiruptor kristjanssonii
           177R1B]
          Length = 726

 Score = 93.7 bits (231), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 37/196 (18%), Positives = 70/196 (35%), Gaps = 29/196 (14%)

Query: 174 MMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEF 233
           ++ VLD S SM     +   KI     +  + ++ +          ++ +V F +     
Sbjct: 39  LVFVLDSSGSMSWNDPNGYRKI-----AAKSFVDALIQGD------RAAVVDFDDYGYLL 87

Query: 234 FLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVF 293
             L      ++  I  +  +G  TN   G++ A +Q+               +  K+I+ 
Sbjct: 88  QPLTTDFQTVKNAIDRIDSWG-GTNIAEGIRIANHQLISQS---------SDDRIKVIIL 137

Query: 294 MTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA--SPNSFYLVENP 351
           +TDGE               EAK  G  +Y IG+        LR  A  +   ++ V + 
Sbjct: 138 LTDGEGYYDN------NLTTEAKNNGITIYTIGLGTSVDENLLRNIATQTGGMYFPVSSA 191

Query: 352 HSMYDAFSHIGKDIVT 367
             +   F  I + +  
Sbjct: 192 SQLPQVFKRITEIVTE 207


>gi|257062895|ref|YP_003142567.1| hypothetical protein Shel_01450 [Slackia heliotrinireducens DSM
           20476]
 gi|256790548|gb|ACV21218.1| uncharacterized protein [Slackia heliotrinireducens DSM 20476]
          Length = 744

 Score = 93.3 bits (230), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 46/218 (21%), Positives = 75/218 (34%), Gaps = 28/218 (12%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
              KV+    +   +++ LD S SM+     + TK      +      +  +        
Sbjct: 368 GDSKVDPNDASSRHVVLALDTSGSMDGE-PLNETKTATREFASTIFKSDADVC------- 419

Query: 220 QSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQH 279
              LV++ +              L+  ++ LS  G  TN    L+ +Y ++         
Sbjct: 420 ---LVSYDSSARNVIDSTDNEYALKAAVRDLSA-GGGTNIEDALRVSYERLEGSGSD--- 472

Query: 280 CNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGI-----RVIRSHE 334
                   K+IIV M+DGE          + Y NE K  G  +Y +G             
Sbjct: 473 --------KRIIVLMSDGEANEGLVGDDLIAYANEIKDDGVTIYTLGFFQSVSDKAECQR 524

Query: 335 FLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIWY 372
            +   ASP   Y V++   +   F  IG DI   R  Y
Sbjct: 525 VMEGIASPGCHYEVDDASQLRYFFGDIGDDINGTRFIY 562


>gi|57524519|ref|NP_001004007.1| matrilin 3a [Danio rerio]
 gi|51330145|gb|AAH80220.1| Matrilin 3a [Danio rerio]
 gi|123233072|emb|CAM15633.1| novel protein similar to vertebrate matrilin 3 (MATN3) (zgc:101120)
           [Danio rerio]
 gi|158254363|gb|AAI54374.1| Matn3a protein [Danio rerio]
          Length = 337

 Score = 92.9 bits (229), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 35/209 (16%), Positives = 82/209 (39%), Gaps = 26/209 (12%)

Query: 161 SVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQ 220
           +   +      LD++ ++D SRS+         + +     +  M++ + + PD     +
Sbjct: 52  AATDSQCRSRPLDLVFIIDSSRSVRP------GEFEKVKIFLADMVDTLDVGPDA---TR 102

Query: 221 SGLVTFSNKIEEFFLLEWGVSH--LQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQ 278
             +V +++ ++  FLL+  ++   +++ I  +      T +   +K A ++ F     + 
Sbjct: 103 VAVVNYASTVKIEFLLKSHLTKDTIKQAITRIEPLAAGTMTGMAIKKAMDEAFT---EKS 159

Query: 279 HCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRA 338
               +  N  K+ + +TDG      E+  +      A+  G  +YA+G+        L+ 
Sbjct: 160 GARPKSKNISKVAIIVTDGRPQDQVEEVSAA-----ARASGIEIYAVGVDRADMRS-LKL 213

Query: 339 CAS---PNSFYLVEN---PHSMYDAFSHI 361
            AS    +  + VE       +   F   
Sbjct: 214 MASNPLEDHVFYVETYGVIEKLTSKFRET 242


>gi|77567855|gb|AAI07522.1| Matn3b protein [Danio rerio]
          Length = 299

 Score = 92.9 bits (229), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 34/209 (16%), Positives = 75/209 (35%), Gaps = 26/209 (12%)

Query: 161 SVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQ 220
                      LD++ ++D SRS+     +   K+ +       + E V  +   ++  +
Sbjct: 57  GAPAEPCKSRPLDLVFIIDSSRSVR---PAEFEKVKIF------LSEMVDSLDIGSDATR 107

Query: 221 SGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQ 278
             LV +++ +   F L+  +  + +++    +      T +   +K A  Q+F      +
Sbjct: 108 VALVNYASTVNIEFHLKKYFSKAEVKQAFSRIDPLSTGTMTGMAIKTAMEQVFTENAGAR 167

Query: 279 HCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRA 338
                     K+ + +TDG      E+  +      A+  G  +YA+G+        L+ 
Sbjct: 168 PLKKG---IGKVAIIVTDGRPQDKVEEVSAA-----ARASGIEIYAVGVDRAEVRS-LKQ 218

Query: 339 CAS---PNSFYLVEN---PHSMYDAFSHI 361
            AS    +  + VE       +   F   
Sbjct: 219 MASQPLDDHVFYVETYGVIEKLTSKFRET 247


>gi|47208180|emb|CAF89812.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 1636

 Score = 92.5 bits (228), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 50/271 (18%), Positives = 96/271 (35%), Gaps = 42/271 (15%)

Query: 103 FVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITS-- 160
           +   + D V    L+I   PQ   Y                F         I+  I S  
Sbjct: 591 YAIGVKDAVEKELLEISGEPQRTFYV-------------NNFDALKPIKDDIITDICSTD 637

Query: 161 ----SVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVN 216
               S+      D   D++ ++D S S+   +     K+   +KS+      V+      
Sbjct: 638 GSDLSLLSTVCKDVPGDLIFLIDSSGSI---YPEDYQKMKDFMKSL------VQKSNIGK 688

Query: 217 NVVQSGLVTFSNKIEEFFLL--EWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQ 274
           + V  G++ +S + +  F L   +    L + I  + + G  T++   +    ++ FD Q
Sbjct: 689 DQVHVGVLQYSTEQKLVFPLIQYYTKDQLSKAIDDMQQIGGGTHTGEAI-AVVSKYFDAQ 747

Query: 275 GMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHE 334
                 N    + K+ +V +TDGE                 + +G IVY+IG+    + +
Sbjct: 748 ------NGGRPDLKQRLVVVTDGE-----SQDDVKLPAEALRAKGVIVYSIGVVAANTSQ 796

Query: 335 FLRACASPNSFYLVENPHSMYDAFSHIGKDI 365
            L      +  Y   +  ++ D    +  +I
Sbjct: 797 LLEISGDADRMYAERDFDALKDLEKQMALEI 827



 Score = 90.6 bits (223), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 49/230 (21%), Positives = 86/230 (37%), Gaps = 34/230 (14%)

Query: 148 YTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMES--FFDSSITKIDMAIKSINAM 205
               + + + IT       +     D+  ++D S S+    F+D          K I   
Sbjct: 438 ELGVQQVAVVITDGCVETEEA----DIFFLIDQSGSIHPPDFYD--------MKKFILEF 485

Query: 206 LEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGL 263
           L+  ++ P   N V+ G+V +++     F L        L++ I  + + G  T +   L
Sbjct: 486 LQTFRVGP---NHVRIGVVKYADSPTLEFDLHTYTDVKSLEKAITNIHQVGGGTETGKAL 542

Query: 264 KYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVY 323
            +   Q       R H        K+ +V +TDG         +     ++ + +G +VY
Sbjct: 543 DFMRPQFDRAVTTRGHK------VKEYLVVITDG-----NSTDKVKDPADKLRAQGVVVY 591

Query: 324 AIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
           AIG++     E L     P   + V N    +DA   I  DI+T     D
Sbjct: 592 AIGVKDAVEKELLEISGEPQRTFYVNN----FDALKPIKDDIITDICSTD 637



 Score = 77.1 bits (188), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 36/200 (18%), Positives = 92/200 (46%), Gaps = 19/200 (9%)

Query: 167  QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
            +  A+ D++ ++DVS S+    + +   + + ++S+   + +  + P    + + G++TF
Sbjct: 847  KKTAQADIIFLVDVSTSI--LKEKAFPSVTVFMESV---VNQSSVGP---ELTRFGVITF 898

Query: 227  SNKIEEFFLLEWGVSH--LQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
            S  ++  F L+   S   + + +  ++  G +TN+   L Y+          ++H     
Sbjct: 899  STGVQSIFTLKQYSSKRDVLQAVGAVTAPGGNTNTGDALDYSLQYF-----GKEHGGRAA 953

Query: 285  ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF-LRACASPN 343
                +I++ +TDG   + +E  +        +K+G  V++IG++     +  + A   P+
Sbjct: 954  LKVPQILMVITDG---AAQEPSKLPGPSEALRKQGVSVFSIGVKNASREQLDIMAGNDPS 1010

Query: 344  SFYLVENPHSMYDAFSHIGK 363
              + V+   ++   + +I K
Sbjct: 1011 RVFFVDTFDALETLYKNISK 1030



 Score = 76.7 bits (187), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 58/352 (16%), Positives = 116/352 (32%), Gaps = 40/352 (11%)

Query: 31   FLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTW 90
            F V+     V  IF +K        R ++ A   +   G   N        +    K   
Sbjct: 893  FGVITFSTGVQSIFTLK---QYSSKRDVLQAVGAVTAPGGNTNTGDALDYSLQYFGKEHG 949

Query: 91   NMSFRNE-----LRDNGFVNDIDDI--------VRSTSLDIVVVPQNEGYSISAISRYKI 137
              +         +  +G   +   +         +  S+  + V       +  ++    
Sbjct: 950  GRAALKVPQILMVITDGAAQEPSKLPGPSEALRKQGVSVFSIGVKNASREQLDIMAGNDP 1009

Query: 138  PLKFC--TFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKI 195
               F   TF    T  ++I   + +  K       + D++ +LD S S++S   +++ K 
Sbjct: 1010 SRVFFVDTFDALETLYKNISKVLCNHTKP-VCEKQKADLVFLLDQSGSIQSDDYTTMKKF 1068

Query: 196  DMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSH--LQRKIKYLSKF 253
                      ++ +       ++V  GL  FS+  ++ F L        +   IK + + 
Sbjct: 1069 ---------TIDLINKFQISRDLVHVGLAQFSSTFKDEFYLNKFFDEQAISAHIKDMQQE 1119

Query: 254  GVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCN 313
               T     L           G R+          + +V +TDG++    E+   L    
Sbjct: 1120 EGGTLIGLALNSIRKYFEASHGSRK-----AEGISQNLVLITDGDSQDDVEEAARL---- 1170

Query: 314  EAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDI 365
              +  G  V+AIGI  +   E L+   +P + + V+N   +      +   I
Sbjct: 1171 -LRGLGVEVFAIGIGNVHDLELLQIAGTPENVFTVKNFDKLEGIHQKVVDTI 1221



 Score = 55.5 bits (132), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 26/160 (16%), Positives = 58/160 (36%), Gaps = 14/160 (8%)

Query: 213 PDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQ--RKIKYLSKFGVSTNSTPGLKYAYNQI 270
               +  + G V+ S++  + FLL++ +  +      +        T +   + +   Q 
Sbjct: 41  QPRQHPDRLGSVS-SDEPHQEFLLKYHIEKMNLLAAFESFPYRNGGTETGKAINFLRKQY 99

Query: 271 FDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI 330
           F  +   +     D    +I V +TDG++         +    E +K G IV+AIG+   
Sbjct: 100 FTKKAGSR----ADQRVPQIAVVITDGDSTD-----DVVVPARELRKHGVIVFAIGVGNA 150

Query: 331 RSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
              E       P+  +  +     + A   + + ++    
Sbjct: 151 NQGELKSIANRPSERF--KFTIDSFQALKRLTERLLETMC 188



 Score = 55.5 bits (132), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 26/137 (18%), Positives = 62/137 (45%), Gaps = 15/137 (10%)

Query: 163 KVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSG 222
           + + +     D++ ++D S S+ S      +   +    +++++  +++ P   N V+ G
Sbjct: 328 EAHCKAANIADIVFIIDESGSIGS------SDFQLVRTFLHSLVSGLEVSP---NRVRVG 378

Query: 223 LVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHC 280
           +V +  + +    L      S L   I+ L   G  TN+   L +  +Q+F    +R+  
Sbjct: 379 IVVYHGEPKAEVFLNTFTDKSELLDFIRILPYHGGGTNTGAALNFTQHQVF----VREKG 434

Query: 281 NTEDANYKKIIVFMTDG 297
           +  +   +++ V +TDG
Sbjct: 435 SRIELGVQQVAVVITDG 451



 Score = 41.7 bits (96), Expect = 0.21,   Method: Composition-based stats.
 Identities = 24/159 (15%), Positives = 60/159 (37%), Gaps = 25/159 (15%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D+ I+LD           +  +       + +++ ++   P      + GL  +   I+ 
Sbjct: 204 DVFILLDG--------GITQAEFRQIRTFLGSLVNQLNFSPS---TYRLGLAQYGQDIKV 252

Query: 233 FFLLEWGVSH------LQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
            FL +   ++      ++   +   +     N    L+YAY   F  +   +     D +
Sbjct: 253 DFLFKDHQTNKDLLTAVKNAQQRKLQPNEPRNLGKALQYAYKNFFTPEAGSR----NDQS 308

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAI 325
           +++ +V +T G++      +++  +C  A      V+ I
Sbjct: 309 FRQYLVVLT-GKDADDPVYEEA--HCKAANIADI-VFII 343


>gi|56797994|emb|CAG27564.2| matrilin-3b [Danio rerio]
 gi|220675932|emb|CAX12091.1| matrilin 3b [Danio rerio]
          Length = 343

 Score = 92.5 bits (228), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 34/209 (16%), Positives = 75/209 (35%), Gaps = 26/209 (12%)

Query: 161 SVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQ 220
                      LD++ ++D SRS+     +   K+ +       + E V  +   ++  +
Sbjct: 57  GAPAEPCKSRPLDLVFIIDSSRSVR---PAEFEKVKIF------LSEMVNSLDIGSDATR 107

Query: 221 SGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQ 278
             LV +++ +   F L+  +  + +++    +      T +   +K A  Q+F      +
Sbjct: 108 VALVNYASTVNIEFHLKKYFSKAEVKQAFSRIDPLSTGTMTGMAIKTAMEQVFTENAGAR 167

Query: 279 HCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRA 338
                     K+ + +TDG      E+  +      A+  G  +YA+G+        L+ 
Sbjct: 168 PLKKG---IGKVAIIVTDGRPQDKVEEVSAA-----ARASGIEIYAVGVDRAEMRS-LKQ 218

Query: 339 CAS---PNSFYLVEN---PHSMYDAFSHI 361
            AS    +  + VE       +   F   
Sbjct: 219 MASQPLDDHVFYVETYGVIEKLTSKFRET 247


>gi|149624864|ref|XP_001517479.1| PREDICTED: similar to Cartilage matrix protein precursor
           (Matrilin-1), partial [Ornithorhynchus anatinus]
          Length = 249

 Score = 92.1 bits (227), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 34/206 (16%), Positives = 77/206 (37%), Gaps = 21/206 (10%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
                 D++ ++D SRS+         + +     +  ++E + + P+     + G+V +
Sbjct: 21  CRTRPTDLVFIVDSSRSVRPH------EFEKVKVFLTQVIESLDVGPNA---TRVGVVNY 71

Query: 227 SNKIEEFFLLEWGVSHLQ--RKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
           ++ ++  F L+   S     + ++ L      T +   +++A ++ F             
Sbjct: 72  ASAVKHEFPLKAHRSKASLLQAVRRLEPLSTGTMTGLAIQFAISRAFSEVE---GARPLS 128

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNS 344
               K+ + +TDG      +D  +      A++ G  ++AIG+  +     LR  AS   
Sbjct: 129 PALSKVAIVVTDGRPQDDVKDVSAR-----AREAGIELFAIGVGRVD-KTTLRRIASEPL 182

Query: 345 FYLVENPHSMYDAFSHIGKDIVTKRI 370
              V+   S Y     + K       
Sbjct: 183 AEHVDYVES-YSVIEKLAKKFQEAFC 207


>gi|219804750|ref|NP_001137338.1| cartilage matrix protein [Bos taurus]
 gi|296490178|gb|DAA32291.1| matrilin 1, cartilage matrix protein [Bos taurus]
          Length = 497

 Score = 92.1 bits (227), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 33/211 (15%), Positives = 80/211 (37%), Gaps = 21/211 (9%)

Query: 163 KVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSG 222
           + +       D++ V+D SRS+         + +     ++ ++E + + P+     + G
Sbjct: 32  RGHLCRTRPTDLVFVVDSSRSVRP------VEFEKVKVFLSQVIESLDVGPNA---TRVG 82

Query: 223 LVTFSNKIEEFFLLEWGVSHLQ--RKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHC 280
           LV +++ +++ F L    S  +  + ++ +      T +   +++A  +           
Sbjct: 83  LVNYASSVKQEFPLRAHSSKAELLQAVRRIQPLSTGTMTGLAIQFAITKALSDAE---GG 139

Query: 281 NTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA 340
                +  K+++ +TDG    +  D  +      A+  G  ++AIG+  +     L+  A
Sbjct: 140 RPRSPDISKVVIVVTDGRPQDSVRDVSAR-----ARAGGIELFAIGVGRVD-KATLQQIA 193

Query: 341 SPNSFYLVENPHSMYDAFSHIGKDIVTKRIW 371
           S      V+   S Y     + K        
Sbjct: 194 SEPQDEHVDYVES-YSVIEKLSKKFQEAFCL 223



 Score = 85.2 bits (209), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 54/358 (15%), Positives = 118/358 (32%), Gaps = 66/358 (18%)

Query: 57  SLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNG-------FVNDIDD 109
           ++  A T+ +++  G   +      ++  + +        ++           F   +  
Sbjct: 124 AIQFAITKALSDAEGGRPRSPDISKVVIVVTDGRPQDSVRDVSARARAGGIELFAIGVGR 183

Query: 110 IVRSTSLDIVVVPQNE------GYSISAISRYKIPLKFCTFIPWYTNSRH----IVMPIT 159
           + ++T   I   PQ+E       YS+      K    FC          H    + +   
Sbjct: 184 VDKATLQQIASEPQDEHVDYVESYSVIEKLSKKFQEAFCLVSDLCATGDHDCEQVCVSSP 243

Query: 160 SSVKVNSQTDARL-------------------DMMIVLDVSRSMESFFDSSITKIDMAIK 200
            S     +    L                   D++ ++D S+S+           ++  K
Sbjct: 244 GSYTCACREGFTLNSDGKTCNVCNGGGGSSATDLVFLIDGSKSVRP------ENFELVKK 297

Query: 201 SINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTN 258
            IN +++ + +      + Q GLV +S+ + + F L        ++  ++ +S     T 
Sbjct: 298 FINQIVDTLDVSD---KLAQVGLVQYSSSVRQEFPLGRFHTKKDIKAAVRNMSYMEKGTM 354

Query: 259 STPGLKYAY-NQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKK 317
           +   LKY   N      G R          +K+ +  TDG +     D        +AK 
Sbjct: 355 TGAALKYLIDNSFTVSSGARPGA-------QKVGIVFTDGRSQDYINDA-----AKKAKD 402

Query: 318 RGAIVYAIGIRVIRSHEFLRACASP--NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
            G  ++A+G+      E     + P    ++   +    +   + IGK +  +    +
Sbjct: 403 LGFKMFAVGVGNAVEDELREIASEPVAEHYFYTAD----FKTINQIGKKLQKRICVEE 456


>gi|281353337|gb|EFB28921.1| hypothetical protein PANDA_013248 [Ailuropoda melanoleuca]
          Length = 471

 Score = 92.1 bits (227), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 35/210 (16%), Positives = 79/210 (37%), Gaps = 21/210 (10%)

Query: 163 KVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSG 222
             +       D++ V+D SRS+         + +     ++ ++E + + P+     + G
Sbjct: 15  TGHLCRTRPTDLVFVVDSSRSVRP------VEFEKVKVFLSQVIESLDVGPNA---TRVG 65

Query: 223 LVTFSNKIEEFFLLEWGVSHLQ--RKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHC 280
           +V +++ +++ F L    S     R ++ +      T +   +++A  + F         
Sbjct: 66  VVNYASAVKQEFPLRAHGSKASLLRAVRRIQPLSTGTMTGLAIQFAITKAFSNTE---GG 122

Query: 281 NTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA 340
                +  K+++ +TDG    +  D  +      A+  G  ++AIG+  +     LR  A
Sbjct: 123 RARSPDISKVVIVVTDGRPQDSVRDVSAR-----ARANGIELFAIGVGRVD-KATLRQIA 176

Query: 341 SPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           S      V+   S Y     + K       
Sbjct: 177 SEPQDEHVDYVES-YSVIEKLSKKFQEAFC 205



 Score = 82.1 bits (201), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 39/220 (17%), Positives = 83/220 (37%), Gaps = 30/220 (13%)

Query: 159 TSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNV 218
           T +V       +  D++ ++D S+S+           ++  K IN +++ + +      +
Sbjct: 245 TCNVCSGGGGSSATDLVFLIDGSKSVRP------ENFELVKKFINQIVDTLDVSD---KL 295

Query: 219 VQSGLVTFSNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAY-NQIFDMQG 275
            Q GLV +S+ + + F L        ++  ++ +S     T +   LKY   N      G
Sbjct: 296 AQVGLVQYSSSVRQEFPLGRFHTKKDIKAAVRNMSYMEKGTMTGAALKYLIDNSFTVSSG 355

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF 335
            R          +K+ +  TDG +     +        +AK  G  ++A+G+      E 
Sbjct: 356 ARPGA-------QKVGIVFTDGRSQDYINNA-----AKKAKDLGFKMFAVGVGNAVEDEL 403

Query: 336 LRACASP--NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
               + P    ++   +    +   + IGK +  K    +
Sbjct: 404 REIASEPVAEHYFYTAD----FKTINQIGKRLQKKICVEE 439


>gi|296228118|ref|XP_002759733.1| PREDICTED: collagen alpha-6(VI) chain [Callithrix jacchus]
          Length = 2267

 Score = 91.8 bits (226), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 44/196 (22%), Positives = 77/196 (39%), Gaps = 27/196 (13%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D+M ++D S S+      + +K+   +K++      V       N VQ G+V FS   +E
Sbjct: 621 DIMFLVDSSGSIGPE---NFSKMKTFMKNL------VSKSQIGANRVQIGVVQFSGVNKE 671

Query: 233 FFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKI 290
            F L   +S   +   I  +   G +T +   L +        +G R        N +K 
Sbjct: 672 EFQLNRFMSQSDISNAIDQMVHIGETTLTGSALSFVSQYFSPTKGARP-------NVRKF 724

Query: 291 IVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVEN 350
           ++ +TDGE                 ++ G I+Y++G+      +       P   + VEN
Sbjct: 725 LILITDGE-----AQDVVKEPAVALRQEGIIIYSVGVFGSNVTQLEEISGRPEMVFYVEN 779

Query: 351 PHSMYDAFSHIGKDIV 366
               +D   HI  D+V
Sbjct: 780 ----FDILQHIEDDLV 791



 Score = 86.7 bits (213), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 36/192 (18%), Positives = 77/192 (40%), Gaps = 19/192 (9%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ V+D S S++        + ++       M+  VK      N V+ G + +++  E
Sbjct: 807 LDVVFVIDSSGSIDH------DEYNIMKDF---MIGLVKKADVGKNRVRFGALKYADDPE 857

Query: 232 EFFLLEWGVSHLQ--RKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
             F L    + L+    ++     G +T ++  L   ++     +      N       +
Sbjct: 858 VLFYLGDFDTKLEVISVLQNDQPMGGNTYTSEAL--GFSDHMFTEAQGSRLNKG---VPQ 912

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVE 349
           +++ +TDGE+    +  +        + +G +V A+GI      E L    S + ++ VE
Sbjct: 913 VLIVITDGES---HDADKLNATAKALRDKGILVLAVGIAGANPVELLAMAGSSDKYFFVE 969

Query: 350 NPHSMYDAFSHI 361
               +   FS +
Sbjct: 970 TFGGLKGIFSDV 981



 Score = 85.6 bits (210), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 40/214 (18%), Positives = 87/214 (40%), Gaps = 22/214 (10%)

Query: 154  IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
            +   + +S KV+ + D  +D++ ++D S S+ S   S  TK+   + S+      V+   
Sbjct: 981  VTASVCNSSKVDCEIDK-VDLVFLMDGSNSIHS---SDFTKMKEFLVSV------VQDFD 1030

Query: 214  DVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIF 271
               N V+ G   FS+   + F L    G   +  +I+ + + G +T+    L+   +   
Sbjct: 1031 VSLNRVRIGAAQFSHNYRQEFPLGTFIGEKEISFQIENIQQLGGNTHIGDALRQVGHYFR 1090

Query: 272  DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR 331
               G R      +    ++++ +TDG+        +        + RG  +Y++GI  + 
Sbjct: 1091 PDMGSRI-----NTGTPQVLLVLTDGQ-----SQDEVAQAAEALRHRGIDIYSVGIGDVD 1140

Query: 332  SHEFLRACASPNSFYLVENPHSMYDAFSHIGKDI 365
              + ++   +      V N   +      I ++I
Sbjct: 1141 DQQLIQITGAAEKKLTVHNFDELKKVKKRIVRNI 1174



 Score = 82.5 bits (202), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 54/356 (15%), Positives = 117/356 (32%), Gaps = 40/356 (11%)

Query: 34  LGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIK------ 87
           L M I  S I      L      +   AA + + +   + R   +    + +I       
Sbjct: 282 LSMGINKSEILRNIQNLSPQTGNAYTGAAIKKLRKEVFSARNGSRKNQGVPQIAVLVTHR 341

Query: 88  ---NTWNMSFRNELRDNGFVNDID-DIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCT 143
              +    +  N  R+   +  +  +  R + L+ +     E Y     +   +     T
Sbjct: 342 ASEDNVTKAAVNLRREGVAIFTLGIEGARDSQLEKIASHPAEQYVSKLKTFADLAAHNQT 401

Query: 144 FIPWYTNSRHIVMPI----TSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAI 199
           F+    N     + +    T ++K         D+ +++D S S      +  T      
Sbjct: 402 FLKKLRNQITHTVSVFSERTETLKSGCVDTEEADIYLLIDGSGS------TQATDFHEMK 455

Query: 200 KSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVST 257
             ++ ++    + P     V+ G V +++  +  F +        L + I+ + + G +T
Sbjct: 456 SFLSEVVGMFNIAPHK---VRVGAVQYADSWDLEFEINKYSNKQDLGKAIENIRQMGGNT 512

Query: 258 NSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKK 317
           N+   L +  + +   +  R             +V +T+G           L   N  ++
Sbjct: 513 NTGAALNFTLSLLQKAKQQR------GNKVPCHLVVLTNG-----MSKDSILEPANRLRE 561

Query: 318 RGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
               VYAIG++     +           Y V +    +DA   I   +V +    +
Sbjct: 562 EHIRVYAIGVKEANKTQLREIAGEEKRVYYVHD----FDALKDIRNQVVQEICAEE 613



 Score = 62.5 bits (150), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 35/188 (18%), Positives = 67/188 (35%), Gaps = 21/188 (11%)

Query: 162 VKVNSQTDARL-DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQ 220
           + V       + D++ +LDVS       + S    D   + +    E V  +    N ++
Sbjct: 216 ILVEVCQGPSVADVVFLLDVS------VNGSEENFDFLKEFLE---ESVSALDIKENCMR 266

Query: 221 SGLVTFSNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQ 278
            GLV +SN+ +    L  G   S + R I+ LS    +  +   +K    ++F     R 
Sbjct: 267 VGLVAYSNETKVINSLSMGINKSEILRNIQNLSPQTGNAYTGAAIKKLRKEVFS---ARN 323

Query: 279 HCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRA 338
                     +I V +T         +          ++ G  ++ +GI   R  +  + 
Sbjct: 324 GSRKN-QGVPQIAVLVT-----HRASEDNVTKAAVNLRREGVAIFTLGIEGARDSQLEKI 377

Query: 339 CASPNSFY 346
            + P   Y
Sbjct: 378 ASHPAEQY 385



 Score = 53.2 bits (126), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 29/185 (15%), Positives = 64/185 (34%), Gaps = 22/185 (11%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D++ +LD S  + S               I  M+  +   P   +  +  L  +S+K+  
Sbjct: 26  DVVFLLDSSDHLGS------KSFPFVKMFITKMINSL---PIEADKYRVALAQYSDKLHS 76

Query: 233 FFLLEW--GVSHLQRKIKY-LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
            F L    G + +   +K      G S      L+ A+   F      +    +   +  
Sbjct: 77  EFHLSTFKGRNPMLNHLKKNFQFLGGSLQIGKALQEAHRTYFSAPTNGR----DRKQFPP 132

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVE 349
           I+V +      S + +          +K G  + ++G++       L+A A+ +  + + 
Sbjct: 133 ILVVL-----ASAESEDDVEEASKALQKDGVKIISVGVQDASEEN-LKAMATSHFHFNLR 186

Query: 350 NPHSM 354
               +
Sbjct: 187 TVRDL 191


>gi|332808244|ref|XP_001147912.2| PREDICTED: cartilage matrix protein [Pan troglodytes]
          Length = 717

 Score = 91.8 bits (226), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 36/210 (17%), Positives = 85/210 (40%), Gaps = 21/210 (10%)

Query: 163 KVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSG 222
           + N       D++ V+D SRS+         + +     ++ ++E + + P+     + G
Sbjct: 31  RGNLCRTRPTDLVFVVDSSRSVRP------VEFEKVKVFLSQVIESLDVGPNA---TRVG 81

Query: 223 LVTFSNKIEEFFLLEWGVSHLQ--RKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHC 280
           +V +++ +++ F L   VS     + ++ +      T +   +++A  + F   G  +  
Sbjct: 82  MVNYASTVKQEFSLRAHVSKAALLQAVRRIQPLSTGTMTGLAIQFAITKAF---GDAEGG 138

Query: 281 NTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA 340
           ++   +  K+++ +TDG    + +D  +      A+  G  ++AIG   +     LR  A
Sbjct: 139 HSRSPDISKVVIVVTDGRPHDSVQDVSAR-----ARASGVELFAIGFGRVD-KATLRQIA 192

Query: 341 SPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           S      V+   S Y     + +       
Sbjct: 193 SEPQDEHVDYVES-YSVIEKLSRKFQEAFC 221



 Score = 84.8 bits (208), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 40/217 (18%), Positives = 82/217 (37%), Gaps = 30/217 (13%)

Query: 159 TSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNV 218
           T +V       +  D++ ++D S+S+           ++  K IN +++ + +      +
Sbjct: 261 TCNVCSGGGGSSATDLVFLIDGSKSVRP------ENFELVKKFINQIVDTLDVSD---KL 311

Query: 219 VQSGLVTFSNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAY-NQIFDMQG 275
            Q GLV +S+ + + F L        ++  ++ +S     T +   LKY   N      G
Sbjct: 312 AQVGLVQYSSSVRQEFPLGRFHTKKDIKAAVRNMSYMEKGTMTGAALKYLIDNSFTVSSG 371

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF 335
            R          +K+ +  TDG +     D        +AK  G  ++A+G+      E 
Sbjct: 372 ARPGA-------QKVGIVFTDGRSQDYINDA-----AKKAKDLGFKMFAVGVGNAVEDEL 419

Query: 336 LRACASP--NSFYLVENPHSMYDAFSHIGKDIVTKRI 370
               + P    ++   +    +   + IGK +  K  
Sbjct: 420 REIASEPVAEHYFYTAD----FKTINQIGKKLQKKIC 452


>gi|291399639|ref|XP_002716220.1| PREDICTED: collagen, type VI, alpha 6 [Oryctolagus cuniculus]
          Length = 2273

 Score = 91.8 bits (226), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 44/204 (21%), Positives = 81/204 (39%), Gaps = 27/204 (13%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
            +  D + D+M ++D S S+      +  K+   +KS+      V       + VQ G+V
Sbjct: 613 EACKDLKADIMFLVDSSGSIGLE---NFGKMKTFMKSL------VSKSQIGAHRVQIGVV 663

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS+  +E F L+  +S   +   I  ++  G +T +   L +        +G R     
Sbjct: 664 QFSHINKEEFQLDTFMSQSDISNAIDRMAHIGETTLTGGALTFVSQYFSPAKGAR----- 718

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
              N +K ++ +TDGE                 ++ G I+Y++G+      +       P
Sbjct: 719 --PNVRKFLILITDGE-----AQDVVKEPAVALRQEGVIIYSVGVFGSNVTQLEEISGRP 771

Query: 343 NSFYLVENPHSMYDAFSHIGKDIV 366
              + VEN    +D    I  D+V
Sbjct: 772 EMVFYVEN----FDILQRIEDDLV 791



 Score = 84.1 bits (206), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 52/337 (15%), Positives = 118/337 (35%), Gaps = 38/337 (11%)

Query: 41  SHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRD 100
              F  ++ + + IDR      T +     G     +       +        F   + D
Sbjct: 675 LDTFMSQSDISNAIDRMAHIGETTL----TGGALTFVSQYFSPAKGARPNVRKFLILITD 730

Query: 101 NGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIP-------WYTNSRH 153
                +  D+V+  ++ +        YS+         L+  +  P        +   + 
Sbjct: 731 G----EAQDVVKEPAVALRQEG-VIIYSVGVFGSNVTQLEEISGRPEMVFYVENFDILQR 785

Query: 154 IVMPITSSVKVNSQTDAR---LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVK 210
           I   +   +    +   R   LD++ V+D S S+         + ++       M+  VK
Sbjct: 786 IEDDLVFGICSPREECKRIEVLDVVFVIDSSGSI------DYDEYNIMKDF---MIGLVK 836

Query: 211 LIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQ--RKIKYLSKFGVSTNSTPGLKYAYN 268
                   V+ G + +++  E  F L    + ++    ++     G +T +   L ++ +
Sbjct: 837 KADVGKAQVRFGALKYADDPEVLFYLGDLDTKMEVISMLQNDQPMGGNTYTAEALAFSDH 896

Query: 269 QIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR 328
              + +G R H         ++++ +TDGE+   ++   +       + +G +V A+GI 
Sbjct: 897 MFTEARGSRLHKG-----VPQVLIVITDGESHDAEKLNGTTK---ALRDKGILVLAVGIA 948

Query: 329 VIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDI 365
                E L    S + ++ VE    +   FS +   +
Sbjct: 949 GANPVELLAMAGSSDKYFFVETFGGLQGIFSDVSASV 985



 Score = 84.1 bits (206), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 36/214 (16%), Positives = 81/214 (37%), Gaps = 22/214 (10%)

Query: 154  IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
            +   + +S KV+     ++D++ ++D S S++    S   K+   + S+      V+   
Sbjct: 981  VSASVCNSSKVD-CEIEKVDLVFLMDGSNSID---PSDFKKMKEFVASV------VQDFD 1030

Query: 214  DVNNVVQSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIF 271
               N VQ G   FS+  +  F L        +   I+ + +    T+    L        
Sbjct: 1031 VSLNRVQIGAAQFSHTYQPEFPLGTFTDEKEVSFHIENIQQIFGYTHIGAALHQVGRYFQ 1090

Query: 272  DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR 331
               G R      +    ++++ +TDG+        +      E +  G  +Y++GI  + 
Sbjct: 1091 PDMGSRI-----NTGTPQVLLVLTDGQ-----SQDEVAQAAEELRHNGVDIYSVGIGNVD 1140

Query: 332  SHEFLRACASPNSFYLVENPHSMYDAFSHIGKDI 365
              + ++   + +    V+N   +      I ++I
Sbjct: 1141 HQQLIQITGTADKKLTVDNFDELKKIKKRIVRNI 1174



 Score = 79.4 bits (194), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 48/334 (14%), Positives = 108/334 (32%), Gaps = 32/334 (9%)

Query: 52  SMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRI-----KNTWNMSFRNELRDNGFVND 106
                + +    + +    G +RK      I+  +     ++    +  N  R    V  
Sbjct: 304 EAYTGAALRKIRKEVFGARGGSRKNQGVPQIVVLVTHRASEDNVTRAAVNLRRQGVTVFT 363

Query: 107 ID-DIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPI----TSS 161
           +  +   +T L+ +     E Y     +   +     TF+    N     + +    T +
Sbjct: 364 LGVEGASATQLEKIASHPAEQYVSKLPTFSDLAAHNQTFVKKLRNQITHTVSVLAERTET 423

Query: 162 VKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQS 221
           +K         D+ +++D S S      +  T        ++ +     + P     V+ 
Sbjct: 424 LKSGCVDTEEADIYLLIDGSGS------TQATDFQEMKTFLSEVASMFHIGPHK---VRV 474

Query: 222 GLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQH 279
           G V +++  +  F +        L R I+ + + G  TN+   L +    +   +  R  
Sbjct: 475 GAVQYASSWDLEFEIGKYSNKHDLGRAIENIRQLGGDTNTGAALNFTLRLLQKAKQQR-- 532

Query: 280 CNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRAC 339
                      +V +T+G           L      ++    VYAIG++     +     
Sbjct: 533 ----GNKVPCHLVVLTNG-----MSKDSILEPAKRLREENIRVYAIGVKEANQTQLREIA 583

Query: 340 ASPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
                 Y V +  ++ D  + + ++I  +    D
Sbjct: 584 GDEKRVYYVHDFDALKDIRNQVVQEICAEEACKD 617



 Score = 61.3 bits (147), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 41/249 (16%), Positives = 90/249 (36%), Gaps = 31/249 (12%)

Query: 111 VRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVK------- 163
                +  V V +     + A++  +      T     T S ++   I  +V+       
Sbjct: 155 RDGVRIISVGVQKAAEEDVKAMATSQFHFSLRTVRDLSTFSHNVTQAIRDAVQYRDAAVD 214

Query: 164 ---VNSQTDARL-DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
              V       + D++ +LDV+       + S+   D        + E V  +    + +
Sbjct: 215 DILVEVCQGPSVADVVFLLDVA------VNGSLEDFDHLKGF---LQESVSALDIKESCM 265

Query: 220 QSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + GLV +SN+ E    L  GV  S +  +I+ LS       +   L+    ++F  +G  
Sbjct: 266 RVGLVAYSNETEVIGSLSEGVNRSAVLHRIQSLSPGAGEAYTGAALRKIRKEVFGARGGS 325

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
           +    ++    +I+V +T         +          +++G  V+ +G+    + +  +
Sbjct: 326 R----KNQGVPQIVVLVT-----HRASEDNVTRAAVNLRRQGVTVFTLGVEGASATQLEK 376

Query: 338 ACASPNSFY 346
             + P   Y
Sbjct: 377 IASHPAEQY 385


>gi|126341670|ref|XP_001379945.1| PREDICTED: hypothetical protein [Monodelphis domestica]
          Length = 2439

 Score = 91.8 bits (226), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 50/340 (14%), Positives = 114/340 (33%), Gaps = 49/340 (14%)

Query: 43   IFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNG 102
            +F +K  +      + +  A +  +E +G  +       ++           +  L+++ 
Sbjct: 1060 VFHLKPKVGKAHTATALKFAKERFSEMHGGRQSLAVTQILVLITNKPTESEEKKYLQESA 1119

Query: 103  ----------FVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSR 152
                      F   I ++ R     I           S    Y +  K    I   +   
Sbjct: 1120 QTLQEAGIDVFAIGIKNVKRPELQAITKHRDRSFMVQSYNELYNLHEKVTHIICNESK-- 1177

Query: 153  HIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLI 212
                PI             +D++ ++D S S+      + T +   +K I      V   
Sbjct: 1178 ----PICG--------HREIDLVFLIDGSSSIH---PRNFTAMKTFMKQI------VNSF 1216

Query: 213  PDVNNVVQSGLVTFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQI 270
                + V+ G+  +S   ++ F L    S   + + I  +++    T +  GL++  +  
Sbjct: 1217 TIGKDRVRIGVAQYSTNPQKEFYLNTFYSGAEINQHIDKITQLRTQTYTGKGLRFVKSFF 1276

Query: 271  FDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI 330
                G R+     + +  + +V +TDG       +   +   N+ +     +++IGI VI
Sbjct: 1277 EPANGSRK-----NLHVLQSLVVITDG-----MSNDSVVEAANDLRNEKIQIFSIGIGVI 1326

Query: 331  RSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
               E      +    ++V +   +      I + +V +  
Sbjct: 1327 NLFELQLIAGNVKRVFVVGDFGQL----GSIERKVVRELC 1362



 Score = 85.6 bits (210), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 38/238 (15%), Positives = 81/238 (34%), Gaps = 26/238 (10%)

Query: 137 IPLKFCTFIPWYTNSRHIVMPITSSVKVNSQ-TDARLDMMIVLDVSRSMESFFDSSITKI 195
           I  K    +      +   +P+ +        +    D   ++D S S+         ++
Sbjct: 586 ITEKIKKRVCTEIVQKTFSVPVMTRTLQEGCVSTEEADFYFLIDGSGSINH---DDFAEM 642

Query: 196 DMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVS--HLQRKIKYLSKF 253
                    M+E +       + V+ G+V +S+     F +    S   L+  I  + + 
Sbjct: 643 KTF------MIELISTFRVGADHVRFGVVQYSDSPTVEFDIRQHSSVAQLKSAITKIWQT 696

Query: 254 GVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCN 313
           G  T +   L +   ++F                 + ++ +TDG+        Q      
Sbjct: 697 GGGTRTGEALTF-MKRLFS--------EVARDKVLRFLIVITDGQ-----SQDQVAQAAE 742

Query: 314 EAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIW 371
           E ++    +YAIG++   + E L    S N  + V +  S+      + +DI    + 
Sbjct: 743 ELRQENITIYAIGVKSAVTKELLEISGSQNRMFFVNDFDSLKPIQQEVIQDICFLEVC 800



 Score = 80.6 bits (197), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 37/186 (19%), Positives = 75/186 (40%), Gaps = 22/186 (11%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D++ ++D S S+      +  K+   + S+   LE         + V+ GL  F++ I +
Sbjct: 17  DLVFLVDSSTSIGPE---NFQKVKSFLYSLVLGLEI------GRDQVRVGLAQFNDNIYK 67

Query: 233 FFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKI 290
            FLL      S +  +I  L      T +   L +   + F      +  +    N  +I
Sbjct: 68  AFLLNQFPRKSDVLEQILSLPYRTGGTRTGSALNFLRTEFFTESAGSRAKD----NVPQI 123

Query: 291 IVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP--NSFYLV 348
           ++ +TDGE      + +     ++ K +G  +Y +GI V    E     + P     + +
Sbjct: 124 VILVTDGE-----SNDEVAEAASKLKGQGVSIYVVGINVQDVQELKTIASKPLEKFLFSI 178

Query: 349 ENPHSM 354
           E+ + +
Sbjct: 179 EDFNIL 184



 Score = 67.9 bits (164), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 33/199 (16%), Positives = 64/199 (32%), Gaps = 23/199 (11%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
                 + D++ ++D S   E        K+         M++ V         VQ GL+
Sbjct: 798 EVCKGMKADILFLVDGS---ERINTRDFDKMKEF------MMQMVNKSDLGPEKVQIGLL 848

Query: 225 TFSNKIEEFFLLEWGVSHLQ--RKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS+  +E F L    S +   R I  + +          L ++           +    
Sbjct: 849 QFSSNPQEEFRLNTYYSKVDILRAITGMVQIRAGARVGSALSFSLPYF-------ERSRG 901

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
              N  + ++ +  G     K            + +G  ++AIG+    + + L    + 
Sbjct: 902 GRLNVPQYLIIIISG-----KTGDAVKMPAKALRDKGIKIFAIGVHKANNSQLLEITGAQ 956

Query: 343 NSFYLVENPHSMYDAFSHI 361
           +  Y  EN  S+      I
Sbjct: 957 DKVYYEENFDSLLFLEKQI 975



 Score = 58.2 bits (139), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 40/229 (17%), Positives = 82/229 (35%), Gaps = 23/229 (10%)

Query: 147 WYTNSRHIVMPITSSVKVNSQTDARL-DMMIVLDVSRSMESFFDSSITKIDMAIKSINAM 205
             +  RH+  P      +   T A L D++ +++ S  +          ++    ++  +
Sbjct: 389 GSSGQRHLS-PEMGEETLAVCTSASLADIVFLVEASSRIG---------LENFQLAVELL 438

Query: 206 LEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGL 263
            + +  +    N V+ GLV +S++    F L   +  S +   +  L   G  T +   L
Sbjct: 439 RKIIHTLIIGPNKVRVGLVLYSDEPRLEFGLNTFLSQSEILSHLNKLPFIGGKTKTGAAL 498

Query: 264 KYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVY 323
            +  N +F  Q   ++        +++ V +T+G +    +   SL      ++ G  V+
Sbjct: 499 DFLRNTVFTQQKGSRY----RQGVQQLAVVITEGYSQDEVDRPASL-----LRRAGVTVF 549

Query: 324 AIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIWY 372
           A+G         L   AS           S     S I + I  +    
Sbjct: 550 AVGTLKASGSRDLNKIASHPPRKHAIYLESFLQ-LSVITEKIKKRVCTE 597



 Score = 56.7 bits (135), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 37/237 (15%), Positives = 91/237 (38%), Gaps = 22/237 (9%)

Query: 116 LDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMM 175
           +++  V + +  +   + ++   ++    +   + +    +      ++ + T +  D++
Sbjct: 155 INVQDVQELKTIASKPLEKFLFSIEDFNILEGLSGNILPTLCSAVENQIRAFTKSYADVV 214

Query: 176 IVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFL 235
            ++D S        +S    +     I  +++ +++  D +   Q GL  + N+    FL
Sbjct: 215 FLVDTS------EGTSSVSFNQMKDFICRVIDTLEVGRDKD---QIGLAQYGNQGHVEFL 265

Query: 236 LEW--GVSHLQRKIKY-LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIV 292
           L        +   I+      G +  +  GL+Y     F  +   +          +  V
Sbjct: 266 LNAYQNPVEMISHIQQNFLPRGGARKTGNGLQYIQETFFQEEAGSRFL----QGIPQYAV 321

Query: 293 FMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVE 349
            +T G+      +   L    + K+RG  +  +GI+   S E L+A A+P   + +E
Sbjct: 322 VITSGQ-----SEDLVLEKAQKLKERGVKIMVVGIQDFDSRE-LKAMATPPLVFEIE 372



 Score = 50.5 bits (119), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 70/156 (44%), Gaps = 8/156 (5%)

Query: 216  NNVVQSGLVTFSNKIEEFFLLEWGVSH--LQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM 273
             + V+ G +++S+  E  F L+  ++   ++  + +L       ++   LK+A  +  +M
Sbjct: 1027 KDNVRFGAISYSDNSEVLFSLDTYITKAQIRDAVFHLKPKVGKAHTATALKFAKERFSEM 1086

Query: 274  QGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSH 333
             G RQ          +I+V +T+ +   ++E +         ++ G  V+AIGI+ ++  
Sbjct: 1087 HGGRQ-----SLAVTQILVLITN-KPTESEEKKYLQESAQTLQEAGIDVFAIGIKNVKRP 1140

Query: 334  EFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKR 369
            E        +  ++V++ + +Y+    +   I  + 
Sbjct: 1141 ELQAITKHRDRSFMVQSYNELYNLHEKVTHIICNES 1176


>gi|194221587|ref|XP_001495285.2| PREDICTED: similar to collagen type VI alpha 6 [Equus caballus]
          Length = 2301

 Score = 91.4 bits (225), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 43/205 (20%), Positives = 82/205 (40%), Gaps = 27/205 (13%)

Query: 164 VNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGL 223
             +  + + D+M ++D S S+      + +K+ + +K++      V       + VQ G+
Sbjct: 647 QEACKEMKADIMFLVDSSGSIGPE---NFSKMKIFMKNL------VSKSQIGADRVQIGV 697

Query: 224 VTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCN 281
           V FS+  +E F L      S +   I  ++  G +T +   L +        +G R    
Sbjct: 698 VQFSHVNKEEFQLNRYMSQSEISDAIDRMAHIGETTLTGHALTFVSQYFSPAKGAR---- 753

Query: 282 TEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACAS 341
               N +K ++ +TDGE                 ++ G I+Y++G+      +       
Sbjct: 754 ---PNVRKFLILITDGE-----AQDIVKDPAVALRQEGIIIYSVGVFGSNVTQLEEISGR 805

Query: 342 PNSFYLVENPHSMYDAFSHIGKDIV 366
           P   + VEN    +D   HI  D+V
Sbjct: 806 PEMVFYVEN----FDILQHIEDDLV 826



 Score = 88.7 bits (218), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 33/214 (15%), Positives = 82/214 (38%), Gaps = 22/214 (10%)

Query: 154  IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
            +   + +S KV+     ++D++ ++D S S+         K+   + S+      V+   
Sbjct: 1016 VSASVCNSSKVD-CEIGQIDLVFLMDGSNSIH---PDDFKKMKAFLASV------VQDFD 1065

Query: 214  DVNNVVQSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIF 271
               N V+ G   FS+  +  F L        +  +I+ + +    T+    L+       
Sbjct: 1066 VTVNRVRIGAAQFSHNYQPEFPLGTFTGEEEISLQIEKIQQIFGYTHIGAALRRVGRYFR 1125

Query: 272  DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR 331
               G R +  T      ++++ +TDG+        +      + +++G  +Y++GI  + 
Sbjct: 1126 PDMGSRINAGTP-----QVLLVLTDGQ-----SQDEVAQAAEDLRRKGINIYSVGIGDVD 1175

Query: 332  SHEFLRACASPNSFYLVENPHSMYDAFSHIGKDI 365
              + ++   + +    V +   +      I + I
Sbjct: 1176 DQQLVQITGTADKKLTVHDFDELRKVKKRIVRHI 1209



 Score = 87.5 bits (215), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 52/337 (15%), Positives = 119/337 (35%), Gaps = 38/337 (11%)

Query: 41   SHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRD 100
             + +  ++ +   IDR      T +     G+    +       +        F   + D
Sbjct: 710  LNRYMSQSEISDAIDRMAHIGETTL----TGHALTFVSQYFSPAKGARPNVRKFLILITD 765

Query: 101  NGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIP-------WYTNSRH 153
                 +  DIV+  ++ +        YS+         L+  +  P        +   +H
Sbjct: 766  G----EAQDIVKDPAVALRQEG-IIIYSVGVFGSNVTQLEEISGRPEMVFYVENFDILQH 820

Query: 154  IVMPITSSVKVNSQTDAR---LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVK 210
            I   +   +    +   R   LD++ V+D S S+         + ++    +  +   VK
Sbjct: 821  IEDDLVFGICSPREECKRIEVLDVVFVIDSSGSI------DYDEYNIMKDFMTDL---VK 871

Query: 211  LIPDVNNVVQSGLVTFSNKIEEFFLLEW-GVS-HLQRKIKYLSKFGVSTNSTPGLKYAYN 268
                  N V+ G + +++  E  F L+  G    +   ++     G +T +   L ++ +
Sbjct: 872  KADVGKNQVRFGALKYADDPEVLFYLDTLGTKWEVISVLQNDQPMGGNTYTAEALAFSDH 931

Query: 269  QIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR 328
               + +G R           ++++ +TDGE+    +  +        + +G ++ A+GI 
Sbjct: 932  MFTEARGSRLQRG-----VPQVLIVITDGES---HDADKLNATAKALRDKGILILAVGIA 983

Query: 329  VIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDI 365
                 E L    S + ++ VE    +   FS +   +
Sbjct: 984  GANPVELLAMAGSSDKYFFVETFGGLKGIFSDVSASV 1020



 Score = 82.1 bits (201), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 49/351 (13%), Positives = 113/351 (32%), Gaps = 36/351 (10%)

Query: 37  IIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIK--------- 87
            I  S +      L      +   AA + + +     +   +    + +I          
Sbjct: 320 GINKSEVLQYIQNLSPQAGNAYTGAAIRKIRKEVFGAQNGSRKNQGVPQIAVLVTHRPSE 379

Query: 88  NTWNMSFRNELRDNGFVNDID-DIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIP 146
           +    +  N  R    +  +  +    T L+ +     E Y     S   +     TF+ 
Sbjct: 380 DNVTKAAVNLRRQGVTIFTMGIEGASDTQLEKIASHPAEQYVSKLKSFSDLAAHNQTFLK 439

Query: 147 WYTNSRHIVMPI----TSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSI 202
              N     + +    T ++K         D+ +++D S S      +  T        +
Sbjct: 440 KLRNQITHTLSVFSERTETLKSGCVDTEEADIYLLIDGSGS------TQATDFHEMKTFL 493

Query: 203 NAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNST 260
           + ++    + P     V+ G V +++  +  F +        L + I+ + + G +TN+ 
Sbjct: 494 SELVGMFNIAP---QKVRFGAVQYADSWDLEFEINKYSNKHDLGKAIENIRQMGGNTNTG 550

Query: 261 PGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGA 320
             L       F +  +++            +V +T+G           +   N  ++   
Sbjct: 551 AALN------FTLGLLQKAKKERGNKVPCHLVVLTNG-----VSKDSIVEPANRLREELI 599

Query: 321 IVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIW 371
            VYAIG+R     +           Y V +  ++ D  + + ++I  +   
Sbjct: 600 HVYAIGVREANQTQLREIAGEEKRMYYVHDFDALKDIRNQVVQEICAQEAC 650



 Score = 66.7 bits (161), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 40/249 (16%), Positives = 88/249 (35%), Gaps = 31/249 (12%)

Query: 111 VRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVK------- 163
                +  V V +    ++ A++  +      T     T S+++   I  + +       
Sbjct: 190 RDGVRIISVGVQKASEENLKAMATAQFHFNLRTVRDLSTFSQNMTQIIKDAAQYKDGAVN 249

Query: 164 ---VNSQTDARL-DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
              V       + D++ +LDVS       + S    D   + +    E V  +    N +
Sbjct: 250 DILVEVCQGPSVADVVFLLDVS------LNGSQENFDYLKEFLE---ESVSALDIKENCM 300

Query: 220 QSGLVTFSNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + GLV FSN+ +    L  G   S + + I+ LS    +  +   ++    ++F  Q   
Sbjct: 301 RVGLVAFSNETKVINSLSRGINKSEVLQYIQNLSPQAGNAYTGAAIRKIRKEVFGAQNGS 360

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
           +    ++    +I V +T         +          +++G  ++ +GI      +  +
Sbjct: 361 R----KNQGVPQIAVLVT-----HRPSEDNVTKAAVNLRRQGVTIFTMGIEGASDTQLEK 411

Query: 338 ACASPNSFY 346
             + P   Y
Sbjct: 412 IASHPAEQY 420


>gi|148689164|gb|EDL21111.1| RIKEN cDNA E330026B02 [Mus musculus]
          Length = 1482

 Score = 91.4 bits (225), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 46/204 (22%), Positives = 84/204 (41%), Gaps = 27/204 (13%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
            +  D + D+M ++D S S+      + +K+ M +K++      V       + VQ G+V
Sbjct: 613 EACRDMKADIMFLVDSSGSIGPE---NFSKMKMFMKNL------VSKSQIGADRVQIGVV 663

Query: 225 TFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS++ +E F L   +  S +   I  ++  G +T +   L +        +G R     
Sbjct: 664 QFSHENKEEFQLNTFMSQSDIANAIDRMTHIGETTLTGSALTFVSQYFSPDKGAR----- 718

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
              N +K ++ +TDGE                 +K G I+Y++G+      +       P
Sbjct: 719 --PNVRKFLILITDGE-----AQDIVRDPALALRKEGVIIYSVGVFGSNVTQLEEISGKP 771

Query: 343 NSFYLVENPHSMYDAFSHIGKDIV 366
              + VEN    +D   HI  D+V
Sbjct: 772 EMVFYVEN----FDILQHIEDDLV 791



 Score = 87.9 bits (216), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 60/337 (17%), Positives = 123/337 (36%), Gaps = 38/337 (11%)

Query: 41  SHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRD 100
            + F  ++ + + IDR      T +     G+    +       +        F   + D
Sbjct: 675 LNTFMSQSDIANAIDRMTHIGETTL----TGSALTFVSQYFSPDKGARPNVRKFLILITD 730

Query: 101 NGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIP-------WYTNSRH 153
                +  DIVR  +L +        YS+         L+  +  P        +   +H
Sbjct: 731 G----EAQDIVRDPALALRKEG-VIIYSVGVFGSNVTQLEEISGKPEMVFYVENFDILQH 785

Query: 154 IVMPITSSVKVNSQTDAR---LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVK 210
           I   +   +    +   R   LD++ V+D S S+         + ++       M+  VK
Sbjct: 786 IEDDLVLGICSPREECKRIEVLDVVFVIDSSGSI------DYQEYNIMKDF---MIGLVK 836

Query: 211 LIPDVNNVVQSGLVTFSNKIEEFFLLEW-GVS-HLQRKIKYLSKFGVSTNSTPGLKYAYN 268
                 N V+ G + +++  E  F L+  G    +   ++     G +T +   L ++ +
Sbjct: 837 KADVGKNQVRFGALKYADDPEVLFYLDELGTKLEVISVLQNDHPMGGNTYTAEALAFSNH 896

Query: 269 QIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR 328
              + +G R H         ++++ +TDGE+    + ++        + +G +V A+GI 
Sbjct: 897 MFTEARGSRLHKG-----VPQVLIVITDGES---HDAEKLNATAKALRDKGILVLAVGIA 948

Query: 329 VIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDI 365
              S E L    S + +Y VE    +   FS +   +
Sbjct: 949 GANSWELLAMAGSGDKYYFVETFGGLKGIFSDVSASV 985



 Score = 75.6 bits (184), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 37/214 (17%), Positives = 81/214 (37%), Gaps = 22/214 (10%)

Query: 154  IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
            +   + +S KV+     ++D++ ++D S S+         K+   + S+      V+   
Sbjct: 981  VSASVCNSSKVD-CEIEKVDLVFLMDGSNSIH---PDDFQKMKGFLVSV------VQDFD 1030

Query: 214  DVNNVVQSGLVTFSNKIEEFFLLEWGVSH--LQRKIKYLSKFGVSTNSTPGLKYAYNQIF 271
               N V+ G+  FS+     FLL        +  +I+ + +    T+    L+       
Sbjct: 1031 VSLNRVRIGVAQFSDSYRSEFLLGTFTGEREISTQIEGIQQIFGYTHIGDALRKVKYYFQ 1090

Query: 272  DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR 331
               G R +  T      ++++ +TDG         +      E + +G  +Y++GI  + 
Sbjct: 1091 PDTGSRINAGTP-----QVLLVLTDGR-----SQDEVAQAAEELRHKGVDIYSVGIGDVD 1140

Query: 332  SHEFLRACASPNSFYLVENPHSMYDAFSHIGKDI 365
              E ++   +      V N   +      I ++I
Sbjct: 1141 DQELVQITGTAEKKLTVHNFDELKKVKKRIVRNI 1174



 Score = 73.3 bits (178), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 32/227 (14%), Positives = 83/227 (36%), Gaps = 22/227 (9%)

Query: 149 TNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEE 208
           T++  +    T ++K         D+ +++D S S      +  T        ++ ++  
Sbjct: 411 THTVSVFSERTETLKSACVDTEEADIYLLIDGSGS------TQPTDFHEMKTFLSEVVGM 464

Query: 209 VKLIPDVNNVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYA 266
             + P     V+ G V +++  +  F +        L + I+ + + G +TN+   L + 
Sbjct: 465 FNIAPHK---VRVGAVQYADTWDLEFEISKYSNKPDLGKAIENIRQMGGNTNTGAALNFT 521

Query: 267 YNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIG 326
              +   +  R       +     +V +T+G           L   ++ ++    V+AIG
Sbjct: 522 LKLLQRAKKER------GSKVPCHLVVLTNG-----MSRDSVLGPAHKLREENIRVHAIG 570

Query: 327 IRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
           ++     +           Y V +  ++ +  + + ++I  +    D
Sbjct: 571 VKEANQMQLREIAGEEKRVYYVHDFDALRNIRNQVVQEICAEEACRD 617



 Score = 59.8 bits (143), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 31/188 (16%), Positives = 70/188 (37%), Gaps = 21/188 (11%)

Query: 162 VKVNSQTDARL-DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQ 220
           + V +     + D++ +LD++       + S   +D     +    E +  +    N ++
Sbjct: 216 IIVEACQGPSVADVVFLLDMA------INGSQEDLDHLKAFLG---ESISALDIKENCMR 266

Query: 221 SGLVTFSNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQ 278
            GLVT+SN+      L  G   + + ++I+ LS       +   L+    +IF      Q
Sbjct: 267 VGLVTYSNETRVISSLSTGNNKTEVLQRIQDLSPQVGQAYTGAALRKTRKEIFSA----Q 322

Query: 279 HCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRA 338
             + ++    +I V +T         +          ++ G  ++ +GI      E  + 
Sbjct: 323 RGSRKNQGVPQIAVLVT-----HRASEDNVTKAAVNLRREGVTIFTMGIEGANPDELEKI 377

Query: 339 CASPNSFY 346
            + P   +
Sbjct: 378 ASHPAEQF 385



 Score = 52.1 bits (123), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 31/205 (15%), Positives = 70/205 (34%), Gaps = 29/205 (14%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D++ ++D S  +       +    +    I+ M+  +   P   N  +  L  +S+ +  
Sbjct: 26  DVVFLVDSSDHLG------LKSFPLVKTFIHKMISSL---PIEANKYRVALAQYSDALHN 76

Query: 233 FFLLEWGVSHLQRKIKYLSKF----GVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
            F L    +     + +L K     G S      L+ A+   F      +        + 
Sbjct: 77  EFQLGTFKNR-NPMLNHLKKNFGFIGGSLKIGNALQEAHRTYFSAPTNGRDKK----QFP 131

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLV 348
            I+V +      S + +          ++ G  + ++G++       L+A A+    + +
Sbjct: 132 PILVVL-----ASAESEDDVEEAAKALREDGVKIISVGVQKASEEN-LKAMATSQFHFNL 185

Query: 349 ENPHSMYDAFS----HIGKDIVTKR 369
                +   F+     I KD+   R
Sbjct: 186 RTARDL-SVFAPNMTEIIKDVTQYR 209


>gi|171846231|ref|NP_034899.2| cartilage matrix protein precursor [Mus musculus]
 gi|28503027|gb|AAH47140.1| Matrilin 1, cartilage matrix protein [Mus musculus]
 gi|66350790|emb|CAC79633.1| cartilage matrix protein [Mus musculus]
 gi|123295072|emb|CAM17812.1| matrilin 1, cartilage matrix protein 1 [Mus musculus]
 gi|187466486|emb|CAQ51562.1| matrilin 1, cartilage matrix protein 1 [Mus musculus]
          Length = 500

 Score = 91.4 bits (225), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 35/218 (16%), Positives = 80/218 (36%), Gaps = 21/218 (9%)

Query: 155 VMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPD 214
            + +    + +       D++ V+D SRS+         + +     ++ ++E + + P+
Sbjct: 27  SLSLVPQPRGHLCRTRPTDLVFVVDSSRSVRP------VEFEKVKVFLSQVIESLDVGPN 80

Query: 215 VNNVVQSGLVTFSNKIEEFFLLEWGVSHLQ--RKIKYLSKFGVSTNSTPGLKYAYNQIFD 272
                + GLV +++ ++  F L    S     + ++ +      T +   L++A  +   
Sbjct: 81  A---TRVGLVNYASTVKPEFPLRAHGSKASLLQAVRRIQPLSTGTMTGLALQFAITKALS 137

Query: 273 MQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRS 332
                        +  K+++ +TDG    +  D         A+  G  ++AIG+  +  
Sbjct: 138 DAE---GGRARSPDISKVVIVVTDGRPQDSVRDVS-----ERARASGIELFAIGVGRVD- 188

Query: 333 HEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
              LR  AS      V+   S Y+    + K       
Sbjct: 189 KATLRQIASEPQDEHVDYVES-YNVIEKLAKKFQEAFC 225



 Score = 87.1 bits (214), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 40/220 (18%), Positives = 85/220 (38%), Gaps = 30/220 (13%)

Query: 159 TSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNV 218
           T +V     + +  D++ ++D S+S+           ++  K IN +++ + +      +
Sbjct: 265 TCNVCRGGGSGSATDLVFLIDGSKSVRP------ENFELVKKFINQIVDTLDVSD---RL 315

Query: 219 VQSGLVTFSNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAY-NQIFDMQG 275
            Q GLV +S+ I + F L        ++  ++ +S     T +   LKY   N      G
Sbjct: 316 AQVGLVQYSSSIRQEFPLGRFHTKKDIKAAVRNMSYMEKGTMTGAALKYLIDNSFTVSSG 375

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF 335
            R          +K+ +  TDG +     D        +AK  G  ++A+G+      E 
Sbjct: 376 ARPGA-------QKVGIVFTDGRSQDYINDA-----ARKAKDLGFKMFAVGVGNAVEEEL 423

Query: 336 LRACASP--NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
               + P  + ++   +    +   + IGK +  +    +
Sbjct: 424 REIASEPVADHYFYTAD----FKTINQIGKKLQKQICVEE 459


>gi|296207278|ref|XP_002750612.1| PREDICTED: cartilage matrix protein [Callithrix jacchus]
          Length = 496

 Score = 91.4 bits (225), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 33/210 (15%), Positives = 83/210 (39%), Gaps = 21/210 (10%)

Query: 163 KVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSG 222
           + +       D++ V+D SRS+         + +     ++ ++E + + P+     + G
Sbjct: 31  RGHLCRTRPTDLVFVVDSSRSVRPI------EFEKVKVFLSQVIESLDVGPNA---TRVG 81

Query: 223 LVTFSNKIEEFFLLEWGVSHLQ--RKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHC 280
           +V +++ +++ F L   VS     + ++ +      T +   +++A  + F      +  
Sbjct: 82  VVNYASTVKQEFPLRAHVSKAALLQAVRRIQPLSTGTMTGLAIQFAITKAFSDAEGGRSR 141

Query: 281 NTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA 340
                +  K+++ +TDG    +  D  +      A+  G  ++AIG+  +     L+  A
Sbjct: 142 ---SPDISKVVIVVTDGRPQDSVRDVSAR-----ARASGVELFAIGVGRVD-KATLQQIA 192

Query: 341 SPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           S      V+   S Y+    + +       
Sbjct: 193 SEPQEEHVDYVES-YNVIEKLSRKFQEAFC 221



 Score = 84.1 bits (206), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 40/220 (18%), Positives = 83/220 (37%), Gaps = 30/220 (13%)

Query: 159 TSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNV 218
           T +V       +  D++ ++D S+S+           ++  K IN +++ + +      +
Sbjct: 261 TCNVCSGGGGSSATDLVFLIDGSKSVRP------ENFELVKKFINQIVDTLDVSD---KL 311

Query: 219 VQSGLVTFSNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAY-NQIFDMQG 275
            Q GLV +S+ + + F L        ++  ++ +S     T +   LKY   N      G
Sbjct: 312 AQVGLVQYSSSVRQEFPLGRFHTKKDIKAAVRNMSYMEKGTMTGAALKYLIDNSFTVSSG 371

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF 335
            R          +K+ +  TDG +     D        +AK  G  ++A+G+      E 
Sbjct: 372 ARPGA-------QKVGIVFTDGRSQDYINDA-----AKKAKDLGFKMFAVGVGNAVEDEL 419

Query: 336 LRACASP--NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
               + P    ++   +    +   + IGK +  K    +
Sbjct: 420 REIASEPVAEHYFYTAD----FKTINQIGKKLQKKICVEE 455


>gi|149018699|gb|EDL77340.1| rCG25821 [Rattus norvegicus]
          Length = 1513

 Score = 91.4 bits (225), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 56/337 (16%), Positives = 122/337 (36%), Gaps = 38/337 (11%)

Query: 41  SHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRD 100
            + F  +  + + ID+      T +     G+    +       +        F   + D
Sbjct: 675 LNTFMSQNDIANAIDQMAHIGETTL----TGSALTFVSQYFSPEKGARPNVRKFLILITD 730

Query: 101 NGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIP-------WYTNSRH 153
                +  DIV+  ++ +        YS+         L+  +  P        +   +H
Sbjct: 731 G----EAQDIVKDPAVALRKDG-VIIYSVGVFGSNVTQLEEISGKPEMVFYVENFDILQH 785

Query: 154 IVMPITSSVKVNSQTDAR---LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVK 210
           I   +   +    +   R   LD++ V+D S S+         + ++       M+  VK
Sbjct: 786 IEDDLVLGICSPREECKRIEVLDVVFVIDSSGSI------DYQEYNIMKDF---MIGLVK 836

Query: 211 LIPDVNNVVQSGLVTFSNKIEEFFLLEW-GVS-HLQRKIKYLSKFGVSTNSTPGLKYAYN 268
                 N V+ G + +++  E  F L+  G    +   ++     G +T +   L ++ +
Sbjct: 837 KADVGKNQVRFGALKYADDPEVLFYLDELGTKLEVISVLQNDQPMGGNTYTAEALAFSDH 896

Query: 269 QIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR 328
              + +G R H         ++++ +TDGE+    + ++        + +G +V A+GI 
Sbjct: 897 MFTEARGSRLHKG-----VPQVLIVITDGES---HDAEKLNATAKALRDKGILVLAVGIA 948

Query: 329 VIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDI 365
              + E L    S + +Y VE    +   FS +   +
Sbjct: 949 GANTWELLAMAGSSDKYYFVETFGGLKGIFSDVSASV 985



 Score = 88.7 bits (218), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 45/204 (22%), Positives = 83/204 (40%), Gaps = 27/204 (13%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
            +  D + D+M ++D S S+      + +K+ + +K++      V       + VQ G+V
Sbjct: 613 EACRDMKADIMFLVDSSGSIGLE---NFSKMKVFMKNL------VSKSQIGADRVQIGVV 663

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS++  E F L   +S   +   I  ++  G +T +   L +        +G R     
Sbjct: 664 QFSHENREEFQLNTFMSQNDIANAIDQMAHIGETTLTGSALTFVSQYFSPEKGAR----- 718

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
              N +K ++ +TDGE                 +K G I+Y++G+      +       P
Sbjct: 719 --PNVRKFLILITDGE-----AQDIVKDPAVALRKDGVIIYSVGVFGSNVTQLEEISGKP 771

Query: 343 NSFYLVENPHSMYDAFSHIGKDIV 366
              + VEN    +D   HI  D+V
Sbjct: 772 EMVFYVEN----FDILQHIEDDLV 791



 Score = 77.9 bits (190), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 36/214 (16%), Positives = 82/214 (38%), Gaps = 22/214 (10%)

Query: 154  IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
            +   + +S KV+     ++D++ ++D S S+         K+   + S+      V+   
Sbjct: 981  VSASVCNSSKVD-CEIEKVDLVFLMDGSNSIH---PDDFQKMKEFLASV------VQDFD 1030

Query: 214  DVNNVVQSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIF 271
               N V+ G+  FS+     FLL        +  +I+ + +    T+    L+   +   
Sbjct: 1031 VSLNRVRIGVAQFSDSYRSEFLLGTFTGEKEISTQIEAIQQIFGYTHIGDALRKVKHYFR 1090

Query: 272  DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR 331
               G R +  T      ++++ +TDG         +      E + +G  +Y++GI  + 
Sbjct: 1091 PDTGSRINAGTP-----QVLLVLTDGR-----SQDEVAQAAEELRHKGVDIYSVGIGDVD 1140

Query: 332  SHEFLRACASPNSFYLVENPHSMYDAFSHIGKDI 365
              + ++   +      V N   +      I ++I
Sbjct: 1141 DQQLIQITGTAEKKLTVHNFDELKKVKKRIVRNI 1174



 Score = 74.0 bits (180), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 44/356 (12%), Positives = 118/356 (33%), Gaps = 36/356 (10%)

Query: 34  LGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMS 93
           L M +  + +      L   + ++   AA +   +   + ++  +    + +I       
Sbjct: 282 LSMGVNKTEVLQRIQDLSPHVGQAYTGAALRKTRKEVFSAQRGSRKNQGVPQIAVLVTHR 341

Query: 94  FRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRH 153
             ++      VN   + V   ++ +      +   I++    +   K   F    T+++ 
Sbjct: 342 ASDDNVTKAAVNLRREGVTVFTMGVEGANPEQLEKIASYPAEQFTSKLSNFSELATHNQT 401

Query: 154 --------------IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAI 199
                         +    T ++K         D+ +++D S       ++  T      
Sbjct: 402 FLKKLRNQITHTVSVFSERTETLKSACVDTEEADIYLLIDGSG------NTQPTDFHEMK 455

Query: 200 KSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVST 257
             ++ +++   + P     V+ G V +++  +  F +        L + I  + + G +T
Sbjct: 456 IFLSEVVDMFNIAPHK---VRVGAVQYADTWDLEFEISKYTNKPDLGKAIDNIRQMGGNT 512

Query: 258 NSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKK 317
           N+   L +    +   +  R             +V +T+G           L   ++ ++
Sbjct: 513 NTGAALNFTLTLLQRAKKQR------GNKVPCHLVVLTNG-----MSQDSVLGPAHKLRE 561

Query: 318 RGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
               V+AIG++     +           Y V    ++ D  + + ++I  +    D
Sbjct: 562 ENIRVHAIGVKEANQTQLREIAGDEKRVYYVHEFDALRDIRNQVVQEICAEEACRD 617



 Score = 62.5 bits (150), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 36/207 (17%), Positives = 75/207 (36%), Gaps = 26/207 (12%)

Query: 159 TSSVKVNSQTDARL-DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNN 217
           T  + V +     + D++ +LD++       + S   +D     +    E V  +    N
Sbjct: 213 TDDIIVEACQGPSVADVVFLLDMA------INGSQENLDHLKAFLG---ESVSALDIKEN 263

Query: 218 VVQSGLVTFSNKIEEFFLLEWGVSHLQ--RKIKYLSKFGVSTNSTPGLKYAYNQIFDMQG 275
            ++ GLV +SN+      L  GV+  +  ++I+ LS       +   L+    ++F    
Sbjct: 264 CMRVGLVAYSNETRVISSLSMGVNKTEVLQRIQDLSPHVGQAYTGAALRKTRKEVFSA-- 321

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF 335
             Q  + ++    +I V +T         D          ++ G  V+ +G+      + 
Sbjct: 322 --QRGSRKNQGVPQIAVLVT-----HRASDDNVTKAAVNLRREGVTVFTMGVEGANPEQL 374

Query: 336 LRACASPNSFYLVENPHSMYDAFSHIG 362
            +  +     Y  E   S    FS + 
Sbjct: 375 EKIAS-----YPAEQFTSKLSNFSELA 396



 Score = 49.4 bits (116), Expect = 0.001,   Method: Composition-based stats.
 Identities = 25/186 (13%), Positives = 63/186 (33%), Gaps = 24/186 (12%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D++ ++D S  +       +    +    I  ++  +   P   N  +  L  +S+ +  
Sbjct: 26  DVVFLVDSSDHLG------MKSFPLVKTFIQKLVSSL---PVEANKYRVALAQYSDALHN 76

Query: 233 FFLLEWGVSHLQRKIKYLSKF----GVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
            F L    +     + +L K     G S      L+ A+   F      +        + 
Sbjct: 77  EFHLGAFKNR-NPMLNHLKKNFGFIGGSLKIGNALQEAHRTYFSAPTNGRDKK----QFP 131

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLV 348
            I+V +      S + +          ++ G  + ++G++     + L+A A+    + +
Sbjct: 132 PILVVL-----ASAESEDDVEEASKALREDGVKIISVGVQKASEED-LKAMATSQFHFNL 185

Query: 349 ENPHSM 354
                +
Sbjct: 186 RTARDL 191


>gi|126330546|ref|XP_001381755.1| PREDICTED: similar to Cartilage matrix protein precursor
           (Matrilin-1) [Monodelphis domestica]
          Length = 495

 Score = 91.4 bits (225), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 32/211 (15%), Positives = 82/211 (38%), Gaps = 24/211 (11%)

Query: 157 PITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVN 216
            +    + +       D++ ++D SRS+         + +     ++ ++E + + P   
Sbjct: 24  GVPPQARGHLCRTRPTDLVFIIDSSRSVRPH------EFEKVKVFLSQVIESLDVGP--- 74

Query: 217 NVVQSGLVTFSNKIEEFFLLEWGVSHLQ--RKIKYLSKFGVSTNSTPGLKYAYNQIFDMQ 274
           N  + G++ +++ ++  F L+   S     + ++ +      T +   +++A N+ F   
Sbjct: 75  NTTRVGVINYASAVKHEFPLKAHRSKASLLQAVRKIEPLSTGTMTGLAIQFAINKAFSEV 134

Query: 275 GMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHE 334
              +          K+ + +TDG      +D  +      AK+ G  ++AIG+  +  H 
Sbjct: 135 EGSRLKFP---EISKVAIVVTDGRPQDGVKDVSAR-----AKQSGIELFAIGVGRVDKHT 186

Query: 335 FLRACASP--NSFYLVEN---PHSMYDAFSH 360
             +  + P  +    VE+      +   F  
Sbjct: 187 LRQIASEPLDDHVDYVESYSVIEKLSKKFQE 217



 Score = 82.1 bits (201), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 40/220 (18%), Positives = 83/220 (37%), Gaps = 30/220 (13%)

Query: 159 TSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNV 218
           T S    +   +  D++ ++D S+S+           ++  + IN +++ + +      +
Sbjct: 260 TCSACNGAAGGSATDLVFLIDGSKSVRP------ENFELVKRFINQIVDSLDVSD---KL 310

Query: 219 VQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAY-NQIFDMQG 275
            Q GLV +S+ + + F L        ++  +K +S     T +   LKY   N      G
Sbjct: 311 AQVGLVQYSSSVRQEFPLGRYKTKKDIKAAVKKMSYMEKGTMTGAALKYLIDNTFTISSG 370

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF 335
            R          +K+ +  TDG +     D        +AK  G  ++A+G+      E 
Sbjct: 371 ARPGA-------QKVGIVFTDGRSQDYINDA-----AKKAKDLGFKMFAVGVGNAVEDEL 418

Query: 336 LRACASP--NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
               + P    ++   +    +   + IGK +  K    +
Sbjct: 419 REIASEPVAEHYFYTAD----FKTINQIGKKLQKKICVEE 454


>gi|118086119|ref|XP_426008.2| PREDICTED: similar to alpha 3 type VI collagen [Gallus gallus]
          Length = 2533

 Score = 91.0 bits (224), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 44/277 (15%), Positives = 108/277 (38%), Gaps = 33/277 (11%)

Query: 103 FVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYK---IPLKFCTFIPWYTNSRHIVMPIT 159
           +   + +I   + LD +       +  +     +   I  K    +     ++  V+P+ 
Sbjct: 576 YAVGVKNITEGSKLDKIATYPPRNHVTTLKYFLQLSNIRWKIKKQLCNEIVTKTFVVPLQ 635

Query: 160 S-SVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNV 218
           S S+K         D+  ++D S S+   + S    +   +  +      +++     N 
Sbjct: 636 SRSLKKGCMDTEEADIYFLIDGSGSI---YPSDFKDMKTFMNEV------IRIFQLGANN 686

Query: 219 VQSGLVTFSNKIEEFFLLEWGVSHLQ--RKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGM 276
           V+ G+V ++++ +   ++      ++    I+ +++ G  T +   L  +   +F     
Sbjct: 687 VRFGVVQYASESKTEIIIGQHSQMMRLTEAIENINQIGGGTRTGNAL-RSMKSLF----- 740

Query: 277 RQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFL 336
                    N  +I++ +TDG     K + +      + +++G ++YAIGI+     E  
Sbjct: 741 ---QMAYRENVPQILIVITDG-----KSEDKVNQAARDLRQQGIVIYAIGIKDAVQQELE 792

Query: 337 RACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
               + N  + V +    +D+  HI  +IV +    +
Sbjct: 793 EIAETKNRMFFVND----FDSLKHIKHEIVQEVCSTN 825



 Score = 87.9 bits (216), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 41/218 (18%), Positives = 89/218 (40%), Gaps = 22/218 (10%)

Query: 152  RHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKL 211
             ++   +  S K         D++ ++D S S+      S + +   +K +      V  
Sbjct: 1191 ENLTQTVCESSKPVCSNHVA-DLIFLIDGSESISEN---SFSTMKTFMKDV------VDS 1240

Query: 212  IPDVNNVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQ 269
                 + V+ G+V +S + +  F L   +  + ++ +I  + +   ST +  GL++  + 
Sbjct: 1241 FDISRDKVRLGVVQYSQEPQREFYLNEFYSDTIIKEQINRIEQLRSSTFTGKGLRFVQSL 1300

Query: 270  IFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV 329
                 G R+     +    + +V +TDG +  + +D          +  G  V+A+G+ +
Sbjct: 1301 FESANGGRK-----NQGVSQNLVVITDGYSADSVDDA-----AMALRSNGIHVFAVGVGI 1350

Query: 330  IRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVT 367
            + S E LR        + VEN +++    S I  +I  
Sbjct: 1351 VNSFELLRIAGDARRVFTVENFNALKTIKSTIINEICE 1388



 Score = 83.3 bits (204), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 39/262 (14%), Positives = 89/262 (33%), Gaps = 36/262 (13%)

Query: 93  SFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSR 152
               +LR  G V     I  +   ++  + + +                   I       
Sbjct: 766 QAARDLRQQGIVIYAIGIKDAVQQELEEIAETKNRMFFVN-----DFDSLKHIKHEIVQE 820

Query: 153 HIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLI 212
                +  +V+         D++ ++D S S+ +   +   KI   ++S       V  +
Sbjct: 821 VCSTNVCKNVRA--------DIVFLVDSSNSIRA---AEFQKIKDFMQS------FVIKV 863

Query: 213 PDVNNVVQSGLVTFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQI 270
               + V+ GL+ FS++I E F L+   +   +QR I+ + +  + T +   L +A +  
Sbjct: 864 DVGLDNVRIGLIQFSSEIREEFQLDRYSTIADVQRAIQEMQQIKLGTLTGKALTFAASYF 923

Query: 271 FDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI 330
                            K+ ++ +TDGE                 + +G  +YAI +   
Sbjct: 924 -------DRPKGGRPELKQYLIVITDGE-----AQDSVKSPARAIRDKGITIYAIDMLQA 971

Query: 331 RSHEFLRACASPNSFYLVENPH 352
            + + +    + +  +     +
Sbjct: 972 NNSQLVEITGAQDKVFFESEMN 993



 Score = 64.4 bits (155), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 46/260 (17%), Positives = 102/260 (39%), Gaps = 29/260 (11%)

Query: 118 IVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIV 177
            V  P ++ Y I  +     P++    +     S  ++  + SS      +    D++ +
Sbjct: 389 TVREPSSKVYQIYEVESID-PVQQ-NIVNNIETSLQMLYDLDSSAPAVCSSATVADIVFL 446

Query: 178 LDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLE 237
           +D S  + S          +    +  ++  + + P     V+ GLV +SN+    F L+
Sbjct: 447 VDESSKIGS------KNFQLIRAFLLKIVNALDIAPSN---VRVGLVLYSNEPRLEFTLD 497

Query: 238 WGVSHLQ--RKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMT 295
                L+    +K L   G    +   +++  N++F  +   +         ++I V +T
Sbjct: 498 TFKDKLEILNYLKNLPYRGGQAYTGIAIEFLRNKVFTQEAGSRKK----QGVQQIAVVIT 553

Query: 296 DGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACAS--PNSF-----YLV 348
           DG++L        +   ++ ++    VYA+G++ I     L   A+  P +      Y +
Sbjct: 554 DGQSLD-----DYIEPASKLRRESVTVYAVGVKNITEGSKLDKIATYPPRNHVTTLKYFL 608

Query: 349 ENPHSMYDAFSHIGKDIVTK 368
           +  +  +     +  +IVTK
Sbjct: 609 QLSNIRWKIKKQLCNEIVTK 628



 Score = 64.4 bits (155), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 35/195 (17%), Positives = 75/195 (38%), Gaps = 21/195 (10%)

Query: 156 MPITSSVKVNSQTDARL-DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPD 214
              T   +  + + A + D++ ++D S S+      +  K+   + S+      V  +  
Sbjct: 28  TFGTIDAQQTACSKATVADVVFIVDTSTSIAQE---NFQKVKNFLSSL------VSSLDI 78

Query: 215 VNNVVQSGLVTFSNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFD 272
             ++++ GL  +S++  + FLL      S +  +I  L   G  T +   L +   + F 
Sbjct: 79  GLDMIRVGLAQYSDEAYQVFLLNQYLLKSDVLDQIGNLPYRGGETYTGRALDFVSTRYFT 138

Query: 273 MQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRS 332
                           ++ V +T GE      + +      + + RG  +Y +GI +  +
Sbjct: 139 --ESAGSRAKG--YVPQLAVLITSGE-----SNDEVEQPAKKLRYRGISIYVVGIGIQNT 189

Query: 333 HEFLRACASPNSFYL 347
            E  +  + P   YL
Sbjct: 190 TELQQIASKPFRRYL 204



 Score = 47.1 bits (110), Expect = 0.004,   Method: Composition-based stats.
 Identities = 27/184 (14%), Positives = 60/184 (32%), Gaps = 16/184 (8%)

Query: 173  DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
            D+M V+  S  +    D     +   ++++      V    +    VQ G++ +S+  E 
Sbjct: 1017 DIMFVVHGSSGVT---DLQFKNMLQLVEAVVN--NSVVGKDN----VQFGVLVYSSNPEV 1067

Query: 233  FFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKI 290
             F L      S ++  +  L        +   L +A        G+            +I
Sbjct: 1068 QFSLNSYASKSQIREAVFSLKPLSGQPFTARALSFARQTF----GVNYGGRASSLAVARI 1123

Query: 291  IVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVEN 350
            +V +TD E     +           K+   ++ A+G+      E           +  ++
Sbjct: 1124 LVLITD-EPTVPSDRDNLPMAIRALKEDKIVLIAVGVSKASREELEEITEDQKRLFFAQS 1182

Query: 351  PHSM 354
              ++
Sbjct: 1183 YDAL 1186


>gi|114589213|ref|XP_516745.2| PREDICTED: hypothetical protein [Pan troglodytes]
          Length = 1859

 Score = 91.0 bits (224), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 47/258 (18%), Positives = 92/258 (35%), Gaps = 30/258 (11%)

Query: 111  VRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDA 170
               T L  +   +   Y +     +         +     +    +    S    +  D 
Sbjct: 795  ANQTQLREIAGEEKRVYYVH---NFDALKDIRNQVVQEICTEEADLNKHHSFSYAACKDM 851

Query: 171  RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
            + D+M ++D S S+      + +K+   +K++      V       + VQ G+V FS+  
Sbjct: 852  KADIMFLVDSSGSIGPE---NFSKMKTFMKNL------VSKSQIGPDRVQIGVVQFSDIN 902

Query: 231  EEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
            +E F L   +S   +   I  ++  G +T +   L +        +G R        N +
Sbjct: 903  KEEFQLNRFMSQSDISNAIDQMAHIGQTTLTGSALSFVSQYFSPTKGAR-------PNIR 955

Query: 289  KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLV 348
            K ++ +TDGE                 ++ G I+Y++G+      +       P   + V
Sbjct: 956  KFLILITDGE-----AQDIVKEPAVVLRQEGVIIYSVGVFGSNVTQLEEISGRPEMVFYV 1010

Query: 349  ENPHSMYDAFSHIGKDIV 366
            EN    +D    I  D+V
Sbjct: 1011 EN----FDILQRIEDDLV 1024



 Score = 87.5 bits (215), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 56/356 (15%), Positives = 119/356 (33%), Gaps = 40/356 (11%)

Query: 34  LGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIK------ 87
           L M I  S +      L     ++   AA + + +   + R   +    + +I       
Sbjct: 503 LSMGINKSEVLQHIQNLSPRTGKAYTGAAIKKLRKEVFSARNGSRKNQGVPQIAVLVTHR 562

Query: 88  ---NTWNMSFRNELRDNGFVNDID-DIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCT 143
              +    +  N  R+   +  +  +    T L+ +     E Y     +   +     T
Sbjct: 563 DSEDNVTKAAVNLRREGVTIFTLGIEGASDTQLEKIASHPAEQYVSKLKTFADLAAHNQT 622

Query: 144 FIPWYTNSRHIVMPI----TSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAI 199
           F+    N     + +    T ++K         D+ +++D S S      +  T      
Sbjct: 623 FLKKLRNQITHTVSVFSERTETLKSGCVDTEEADIYLLIDGSGS------TQATDFHEMK 676

Query: 200 KSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVST 257
             ++ ++    + P     V+ G V +++  +  F +        L + I+ + + G +T
Sbjct: 677 TFLSEVVGMFNIAPHK---VRVGAVQYADSWDLEFEINKYSNKQDLGKAIENIRQMGGNT 733

Query: 258 NSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKK 317
           N+   L +  + +   +  +Q  N         +V +T+G           L   N  ++
Sbjct: 734 NTGAALNFTLSLL--QKAKKQRGNK----VPCHLVVLTNG-----MSKDSILEPANRLRE 782

Query: 318 RGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
               VYAIGI+     +           Y V N    +DA   I   +V +    +
Sbjct: 783 EHIRVYAIGIKEANQTQLREIAGEEKRVYYVHN----FDALKDIRNQVVQEICTEE 834



 Score = 85.2 bits (209), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 37/192 (19%), Positives = 75/192 (39%), Gaps = 19/192 (9%)

Query: 172  LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
            LD++ V+D S S+         + ++       M+  VK      N V+ G + +++  E
Sbjct: 1040 LDVVFVIDSSGSI------DYDEYNIMKDF---MIGLVKKADVGKNQVRFGALKYADDPE 1090

Query: 232  EFFLLEW-GVS-HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
              F L+  G    +   ++     G ST +   L   ++     +      N       +
Sbjct: 1091 VLFYLDDFGTKLEVISVLQNDQAMGGSTYTAEAL--GFSDHMFTEARGSRLNKG---VPQ 1145

Query: 290  IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVE 349
            +++ +TDGE+    +  +        + +G +V A+GI      E L    S + ++ VE
Sbjct: 1146 VLIVITDGES---HDADKLNATAKALRDKGILVLAVGIDGANPMELLAMAGSSDKYFFVE 1202

Query: 350  NPHSMYDAFSHI 361
                +   FS +
Sbjct: 1203 TFGGLKGIFSDV 1214



 Score = 81.0 bits (198), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 36/214 (16%), Positives = 83/214 (38%), Gaps = 22/214 (10%)

Query: 154  IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
            +   + +S KV+ + D  +D++ ++D S S++        K+   + S+      V+   
Sbjct: 1214 VTASVCNSSKVDCEIDK-VDLVFLMDGSTSIQPN---DFKKMKEFLASV------VQDFD 1263

Query: 214  DVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIF 271
               N V+ G   FS+     F L    G   +  +I+ + +   +T+    L+   +   
Sbjct: 1264 VSLNRVRIGAAQFSDTYHPEFPLGTFIGEKEISFQIENIKQIFGNTHIGAALREVEHYFR 1323

Query: 272  DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR 331
               G R      +    ++++ +TDG+        +        + RG  +Y++GI  + 
Sbjct: 1324 PDMGSRI-----NTGTPQVLLVLTDGQ-----SQDEVAQAAEALRHRGIDIYSVGIGDVD 1373

Query: 332  SHEFLRACASPNSFYLVENPHSMYDAFSHIGKDI 365
              + ++   +      V N   +      I ++I
Sbjct: 1374 DQQLIQITGTAEKKLTVHNFDELKKVNKRIVRNI 1407



 Score = 60.9 bits (146), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 39/249 (15%), Positives = 81/249 (32%), Gaps = 31/249 (12%)

Query: 111 VRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVK------- 163
                +  V V +    ++ A++  +      T       S+++   I    K       
Sbjct: 376 KDGVKIISVGVQKASEENLKAMATSQFHFNLRTVRDLSMFSQNMTHIIKDVTKYKEGAVD 435

Query: 164 ---VNSQTDARL-DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
              V +     + D++ +LD+S       + S    D     +    E V  +    N +
Sbjct: 436 DIFVEACQGPSMADVVFLLDMS------INGSEENFDYLKGFLE---ESVSALDIKENCM 486

Query: 220 QSGLVTFSNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + GLV +SN+ +    L  G   S + + I+ LS       +   +K    ++F     R
Sbjct: 487 RVGLVAYSNETKVINSLSMGINKSEVLQHIQNLSPRTGKAYTGAAIKKLRKEVFS---AR 543

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                      +I V +T         +          ++ G  ++ +GI      +  +
Sbjct: 544 NGSRKN-QGVPQIAVLVT-----HRDSEDNVTKAAVNLRREGVTIFTLGIEGASDTQLEK 597

Query: 338 ACASPNSFY 346
             + P   Y
Sbjct: 598 IASHPAEQY 606



 Score = 53.2 bits (126), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 33/201 (16%), Positives = 69/201 (34%), Gaps = 25/201 (12%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D++ ++D S  + S               I  M+  +   P   +  +  L  +S+K+  
Sbjct: 247 DVVFLVDSSDRLGS------KSFPFVKMFITKMISSL---PIEADKYRVALAQYSDKLHS 297

Query: 233 FFLLEW--GVSHLQRKIKY-LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
            F L    G S +   ++      G S      L+ A+   F      +        +  
Sbjct: 298 EFHLSTFKGRSPMLNHLRKNFGFIGGSLQIGKALQEAHRTYFSAPTNGRDKK----QFPP 353

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYL-- 347
           I+V +      S++ +          +K G  + ++G++       L+A A+    +   
Sbjct: 354 ILVVL-----ASSESEDDVEEASKALRKDGVKIISVGVQKASEEN-LKAMATSQFHFNLR 407

Query: 348 -VENPHSMYDAFSHIGKDIVT 367
            V +        +HI KD+  
Sbjct: 408 TVRDLSMFSQNMTHIIKDVTK 428


>gi|297665730|ref|XP_002811194.1| PREDICTED: cartilage matrix protein-like [Pongo abelii]
          Length = 495

 Score = 91.0 bits (224), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 33/210 (15%), Positives = 82/210 (39%), Gaps = 21/210 (10%)

Query: 163 KVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSG 222
           + +       D++ V+D SRS+         + +     ++ ++E + + P+     + G
Sbjct: 31  RGHLCRTRPTDLVFVVDSSRSVRP------VEFEKVKVFLSQVIESLDVGPNA---TRVG 81

Query: 223 LVTFSNKIEEFFLLEWGVSHLQ--RKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHC 280
           +V +++ +++ F L   +S     + ++ +      T +   +++A  + F      +  
Sbjct: 82  MVNYASTVKQEFSLRAHISKAALLQAVRRIQPLSTGTMTGLAIQFAITKAFSDAEGGRSR 141

Query: 281 NTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA 340
                +  K+++ +TDG      +D  +      A+  G  ++AIG+  +     LR  A
Sbjct: 142 ---SPDISKVVIVVTDGRPQDNVQDVSAR-----ARASGVELFAIGVGRVD-KATLRQIA 192

Query: 341 SPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           S      V+   S Y     + +       
Sbjct: 193 SEPQDEHVDYVES-YSVIEKLSRKFQEAFC 221



 Score = 71.3 bits (173), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 30/171 (17%), Positives = 64/171 (37%), Gaps = 19/171 (11%)

Query: 207 EEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLK 264
           + V  +   + + Q GLV +S+ + + F L        ++  ++ +S     T +   LK
Sbjct: 299 QIVDTLDVSDKLAQVGLVQYSSSVRQEFPLGRFHTKKDIKAAVRNMSYMEKGTMTGAALK 358

Query: 265 YAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYA 324
           Y  +  F +       +      +K+ +  TDG +     D        +AK  G  ++A
Sbjct: 359 YLIDNSFTVS------SGARPRAQKVGIVFTDGRSQDYINDA-----AKKAKDLGFKMFA 407

Query: 325 IGIRVIRSHEFLRACASP--NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
           +G+      E     + P    ++   +    +   + IGK +  K    +
Sbjct: 408 VGVGNAVEDELREIASEPVAEHYFYTAD----FKTINQIGKKLQKKICVEE 454


>gi|224081306|ref|XP_002190595.1| PREDICTED: matrilin 1, cartilage matrix protein [Taeniopygia
           guttata]
          Length = 493

 Score = 91.0 bits (224), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 42/230 (18%), Positives = 85/230 (36%), Gaps = 28/230 (12%)

Query: 148 YTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLE 207
             +   +     +    N    + LD++ ++D S+S+           ++  K IN +++
Sbjct: 247 CRDGFSLNNDGKTCTACNGGLGSALDLVFLIDGSKSVRP------ENFELVKKFINQIVD 300

Query: 208 EVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSH--LQRKIKYLSKFGVSTNSTPGLKY 265
            +++      V   GLV +S+ + + F L    S   ++  +K +S     T +   LKY
Sbjct: 301 SLEVSDKQAQV---GLVQYSSSVRQEFPLGQFKSKKDIKAAVKKMSYMEKGTMTGQALKY 357

Query: 266 AYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAI 325
             +  F         N       K+ +  TDG +     D        +AK  G  ++A+
Sbjct: 358 LVDSSFSA------INGARPGVPKVGIVFTDGRSQDYISDA-----AKKAKDSGFRMFAV 406

Query: 326 GIRVIRSHEFLRACASP--NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
           G+      E     + P    ++   +    +   S IGK +  K    +
Sbjct: 407 GVGNAVEDELREIASEPVAEHYFYTAD----FRTISKIGKKLQMKICVEE 452



 Score = 88.3 bits (217), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 31/202 (15%), Positives = 78/202 (38%), Gaps = 26/202 (12%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
                 D++ ++D SRS+         + +     ++ ++E + + P+     + G++ +
Sbjct: 33  CRTKPTDLVFIIDSSRSVRPH------EFEKIKVFVSRVIEALDVGPNA---TRVGVINY 83

Query: 227 SNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
           ++ +     L+     + L + ++ +      T +   +++A ++ F      +      
Sbjct: 84  ASAVRNELSLQGPHSKAALLQAVRRIQPLSTGTMTGLAIQFAISRAFSAAEGGRGSAPN- 142

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACAS--- 341
             +KK+ + +TDG      +D  +      A+  G  ++AIG+  +     LR  AS   
Sbjct: 143 --FKKVAIVVTDGRPQDGVQDVSAR-----ARAAGIEIFAIGVGRVDMGT-LRQMASEPL 194

Query: 342 PNSFYLVEN---PHSMYDAFSH 360
                 VE+      +   F  
Sbjct: 195 DEHVDYVESYSVIEKLTHKFQE 216


>gi|149632101|ref|XP_001514410.1| PREDICTED: hypothetical protein [Ornithorhynchus anatinus]
          Length = 2392

 Score = 91.0 bits (224), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 43/196 (21%), Positives = 80/196 (40%), Gaps = 19/196 (9%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ V+D S S++S   + +            M++ VK      N VQ G + +S+  E
Sbjct: 806 LDIVFVIDSSGSIDSNEYNIMKAF---------MIDLVKKADVGKNQVQFGALKYSDFPE 856

Query: 232 EFFLLEWGVSH--LQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
             F L    S   +   I+     G ST +   L ++ +   +  G R H         +
Sbjct: 857 VLFNLNEFSSKSEIISFIQNDHPRGGSTYTAKALAHSAHLFSESLGSRMHRG-----VPQ 911

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVE 349
           +++ +TDGE+        +       + +G +V A+GI      E L    S + ++ VE
Sbjct: 912 VLIVITDGESHDAHLLNAT---ARALRDKGILVLAVGIEGANHEELLSMAGSTDRYFFVE 968

Query: 350 NPHSMYDAFSHIGKDI 365
           N   +   F ++   +
Sbjct: 969 NFEGLKGIFENVSASV 984



 Score = 85.2 bits (209), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 43/199 (21%), Positives = 74/199 (37%), Gaps = 23/199 (11%)

Query: 158 ITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNN 217
           + S     +  +   D+M ++D S S+      +  K+   +K++      V       N
Sbjct: 605 VRSICSEEACKEMSADIMFLVDSSGSIG---GDNFEKMKTFMKNV------VNRTKIGAN 655

Query: 218 VVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQG 275
            VQ GLV FS+  +E F L      + +   I  LS  G  T     L +  +     +G
Sbjct: 656 QVQVGLVQFSDINKEGFQLNQYDTKTKISDAIDGLSLIGRGTLIGGALTFVSDYFSVSKG 715

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF 335
            R        N KK +V +TDG     K            ++ G I+Y++G+      + 
Sbjct: 716 AR-------PNVKKFLVLLTDG-----KSQDAVKEAAVALRQDGVIIYSVGVFGSEYSQL 763

Query: 336 LRACASPNSFYLVENPHSM 354
                  +  + VEN   +
Sbjct: 764 EEISGRSDMVFYVENFDIL 782



 Score = 84.1 bits (206), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 56/357 (15%), Positives = 114/357 (31%), Gaps = 41/357 (11%)

Query: 34  LGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMS 93
           LG     S I      L     R+L  AA  +  +   +     +    + +I       
Sbjct: 281 LGTGTNKSDILQQIDGLSPKAGRALTGAAINVTRKEIFSRGAGSRKSQGVLQITVLITHR 340

Query: 94  FRNE---------LRDNGFVNDID-DIVRSTSLDIVVVPQNEGYSISAISRYKIPL---K 140
              +          R+   V  +  +    T LD +     E Y     S   +      
Sbjct: 341 SSEDNVSEAALSLRREGVTVFAVGIEGANETQLDQIASYPREQYVSMVKSYSDMGAYYRI 400

Query: 141 FCTFIPWYTNSR-HIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAI 199
           F   +     ++  +    T  +K         D+ +++D S S+       +       
Sbjct: 401 FQKKLRNEIQNKVSVASEQTERLKSGCADTEAADIYLLIDGSGSI------QVADFQEMK 454

Query: 200 KSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVST 257
           + +  ++    + P     V+ G V +S+  E  F ++     + L + ++ + + G +T
Sbjct: 455 RFLAEVIGMFNIGPHK---VRFGAVQYSHLWEWEFEMDRYSNKNDLVKAVENIRQLGGNT 511

Query: 258 NSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKK 317
           ++   L      +   Q  RQ          + +V +TDG                  + 
Sbjct: 512 DTGAALD---KMLPLFQRARQQRAR---KVPQHLVVLTDG-----LSHDSVREPAGRLRG 560

Query: 318 RGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYDK 374
               VYAIG++     +      S +  Y V N    +D+   I   +V + I  ++
Sbjct: 561 DNINVYAIGVKEANHTQLEEIAGSDSRVYYVHN----FDSLKDIKNRVV-RSICSEE 612



 Score = 78.3 bits (191), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 31/216 (14%), Positives = 85/216 (39%), Gaps = 22/216 (10%)

Query: 152  RHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKL 211
             ++   + ++ KV+       D++ ++D S S+    +    K+      +  ++ +  +
Sbjct: 978  ENVSASVCNTSKVD-CELGMADLVFLIDGSTSI---LEEDFKKM---KDFLVTIVNDFDI 1030

Query: 212  IPDVNNVVQSGLVTFSNKIEEFFLLEWGVSH--LQRKIKYLSKFGVSTNSTPGLKYAYNQ 269
             P     V  GL  FS++    F L        ++ +I  + +   +T     L+   + 
Sbjct: 1031 RP---GKVHVGLAQFSHEYRPEFSLIPFRDKIEVKNQIGRIQQIFGNTLIGAALRNVGSY 1087

Query: 270  IFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV 329
             +   G R      +A  +++++ +TDG+        +      + + +G  +Y++G+  
Sbjct: 1088 FWPDFGSRI-----NAGVQQVLLVLTDGQ-----SQDEVAQAAEDLRNKGIDIYSLGVGQ 1137

Query: 330  IRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDI 365
            +   + ++   S      V+N   +      + +D+
Sbjct: 1138 VNDQQLIQISGSAKKKLTVDNFSELDKIKKRVVRDV 1173



 Score = 59.8 bits (143), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 32/209 (15%), Positives = 71/209 (33%), Gaps = 26/209 (12%)

Query: 168 TDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFS 227
             + +D++ ++D S       + +    +        ++E +       N ++ GLV +S
Sbjct: 222 DASVVDIVFLVDES------VNGTDENFEHLKGF---LVETIDSFDVKENCMRIGLVMYS 272

Query: 228 NKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDA 285
           N+ +    L  G   S + ++I  LS       +   +     +IF      +    +  
Sbjct: 273 NETKLVSRLGTGTNKSDILQQIDGLSPKAGRALTGAAINVTRKEIFSRGAGSR----KSQ 328

Query: 286 NYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSF 345
              +I V +T         +          ++ G  V+A+GI      +  +  + P   
Sbjct: 329 GVLQITVLIT-----HRSSEDNVSEAALSLRREGVTVFAVGIEGANETQLDQIASYPREQ 383

Query: 346 Y-----LVENPHSMYDAF-SHIGKDIVTK 368
           Y        +  + Y  F   +  +I  K
Sbjct: 384 YVSMVKSYSDMGAYYRIFQKKLRNEIQNK 412


>gi|119628048|gb|EAX07643.1| matrilin 1, cartilage matrix protein, isoform CRA_b [Homo sapiens]
          Length = 519

 Score = 91.0 bits (224), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 35/210 (16%), Positives = 85/210 (40%), Gaps = 21/210 (10%)

Query: 163 KVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSG 222
           + +       D++ V+D SRS+         + +     ++ ++E + + P+     + G
Sbjct: 31  RGHLCRTRPTDLVFVVDSSRSVRP------VEFEKVKVFLSQVIESLDVGPNA---TRVG 81

Query: 223 LVTFSNKIEEFFLLEWGVSHLQ--RKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHC 280
           +V +++ +++ F L   VS     + ++ +      T +   +++A  + F   G  +  
Sbjct: 82  MVNYASTVKQEFSLRAHVSKAALLQAVRRIQPLSTGTMTGLAIQFAITKAF---GDAEGG 138

Query: 281 NTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA 340
            +   +  K+++ +TDG    + +D  +      A+  G  ++AIG+  +     LR  A
Sbjct: 139 RSRSPDISKVVIVVTDGRPQDSVQDVSAR-----ARASGVELFAIGVGSVD-KATLRQIA 192

Query: 341 SPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           S      V+   S Y     + +       
Sbjct: 193 SEPQDEHVDYVES-YSVIEKLSRKFQEAFC 221



 Score = 84.1 bits (206), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 39/220 (17%), Positives = 83/220 (37%), Gaps = 30/220 (13%)

Query: 159 TSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNV 218
           T +V       +  D++ ++D S+S+           ++  K I+ +++ + +      +
Sbjct: 261 TCNVCSGGGGSSATDLVFLIDGSKSVRP------ENFELVKKFISQIVDTLDVSD---KL 311

Query: 219 VQSGLVTFSNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAY-NQIFDMQG 275
            Q GLV +S+ + + F L        ++  ++ +S     T +   LKY   N      G
Sbjct: 312 AQVGLVQYSSSVRQEFPLGRFHTKKDIKAAVRNMSYMEKGTMTGAALKYLIDNSFTVSSG 371

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF 335
            R          +K+ +  TDG +     D        +AK  G  ++A+G+      E 
Sbjct: 372 ARPGA-------QKVGIVFTDGRSQDYINDA-----AKKAKDLGFKMFAVGVGNAVEDEL 419

Query: 336 LRACASP--NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
               + P    ++   +    +   + IGK +  K    +
Sbjct: 420 REIASEPVAEHYFYTAD----FKTINQIGKKLQKKICVEE 455


>gi|56797861|emb|CAG27403.1| matrilin-3b [Danio rerio]
 gi|220675930|emb|CAX12089.1| matrilin 3b [Danio rerio]
          Length = 299

 Score = 90.6 bits (223), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 34/209 (16%), Positives = 75/209 (35%), Gaps = 26/209 (12%)

Query: 161 SVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQ 220
                      LD++ ++D SRS+     +   K+ +       + E V  +   ++  +
Sbjct: 57  GAPAEPCKSRPLDLVFIIDSSRSVR---PAEFEKVKIF------LSEMVNSLDIGSDATR 107

Query: 221 SGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQ 278
             LV +++ +   F L+  +  + +++    +      T +   +K A  Q+F      +
Sbjct: 108 VALVNYASTVNIEFHLKKYFSKAEVKQAFSRIDPLSTGTMTGMAIKTAMEQVFTENAGAR 167

Query: 279 HCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRA 338
                     K+ + +TDG      E+  +      A+  G  +YA+G+        L+ 
Sbjct: 168 PLKKG---IGKVAIIVTDGRPQDKVEEVSAA-----ARASGIEIYAVGVDRAEMRS-LKQ 218

Query: 339 CAS---PNSFYLVEN---PHSMYDAFSHI 361
            AS    +  + VE       +   F   
Sbjct: 219 MASQPLDDHVFYVETYGVIEKLTSKFRET 247


>gi|1705570|sp|P51942|MATN1_MOUSE RecName: Full=Cartilage matrix protein; AltName: Full=Matrilin-1;
           Flags: Precursor
 gi|1163179|gb|AAB06521.1| cartilage matrix protein precursor [Mus musculus]
          Length = 500

 Score = 90.6 bits (223), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 35/218 (16%), Positives = 80/218 (36%), Gaps = 21/218 (9%)

Query: 155 VMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPD 214
            + +    + +       D++ V+D SRS+         + +     ++ ++E + + P+
Sbjct: 27  SLSLVPQPRGHLCRTRPTDLVFVVDSSRSVRP------VEFEKVKVFLSQVIESLDVGPN 80

Query: 215 VNNVVQSGLVTFSNKIEEFFLLEWGVSHLQ--RKIKYLSKFGVSTNSTPGLKYAYNQIFD 272
                + GLV +++ ++  F L    S     + ++ +      T +   L++A  +   
Sbjct: 81  A---TRVGLVNYASTVKPEFPLRAHGSKASLLQAVRRIQPLSTGTMTGLALQFAITKALS 137

Query: 273 MQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRS 332
                        +  K+++ +TDG    +  D         A+  G  ++AIG+  +  
Sbjct: 138 DAE---GGRARSPDISKVVIVVTDGRPQDSVRDVS-----ERARASGIELFAIGLGRVD- 188

Query: 333 HEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
              LR  AS      V+   S Y+    + K       
Sbjct: 189 KATLRQIASEPQDEHVDYVES-YNVIEKLAKKFQEAFC 225



 Score = 87.1 bits (214), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 40/220 (18%), Positives = 86/220 (39%), Gaps = 30/220 (13%)

Query: 159 TSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNV 218
           T +V     + +  D++ ++D S+S+           ++  K IN +++ + +      +
Sbjct: 265 TCNVCRGGGSGSATDLVFLIDGSKSVRP------ENFELVKKFINQIVDTLDVSD---RL 315

Query: 219 VQSGLVTFSNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAY-NQIFDMQG 275
            Q GLV +S+ I + F L        ++ +++ +S     T +   LKY   N      G
Sbjct: 316 AQVGLVQYSSSIRQEFPLGRFHSKKDIKARVRNMSYMEKGTMTGAALKYLIDNSFTVSSG 375

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF 335
            R          +K+ +  TDG +     D        +AK  G  ++A+G+      E 
Sbjct: 376 ARPGA-------QKVGIVFTDGRSQDYINDA-----ARKAKDLGFKMFAVGVGNAVEEEL 423

Query: 336 LRACASP--NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
               + P  + ++   +    +   + IGK +  +    +
Sbjct: 424 REIASEPVADHYFYTAD----FKTINQIGKKLQKQICVEE 459


>gi|56797851|emb|CAF33338.1| matrilin-3a [Danio rerio]
          Length = 295

 Score = 90.6 bits (223), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 35/209 (16%), Positives = 82/209 (39%), Gaps = 26/209 (12%)

Query: 161 SVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQ 220
           +   +      LD++ ++D SRS+         + +     +  M++ + + PD     +
Sbjct: 52  AATDSQCRSRPLDLVFIIDSSRSVRP------GEFEKVKIFLADMVDTLDVGPDA---TR 102

Query: 221 SGLVTFSNKIEEFFLLEWGVSH--LQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQ 278
             +V +++ ++  FLL+  ++   +++ I  +      T +   +K A ++ F     + 
Sbjct: 103 VAVVNYASTVKIEFLLKSHLTKDTIKQAITRIEPLAAGTMTGMAIKKAMDEAFT---EKS 159

Query: 279 HCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRA 338
               +  N  K+ + +TDG      E+  +      A+  G  +YA+G+        L+ 
Sbjct: 160 GARPKSKNISKVAIIVTDGRPQDQVEEVSAA-----ARASGIEIYAVGVDRADMRS-LKL 213

Query: 339 CAS---PNSFYLVEN---PHSMYDAFSHI 361
            AS    +  + VE       +   F   
Sbjct: 214 MASNPLEDHVFYVETYGVIEKLTSKFRET 242


>gi|73990557|ref|XP_853279.1| PREDICTED: similar to alpha 3 type VI collagen isoform 1 precursor
           [Canis familiaris]
          Length = 1634

 Score = 90.6 bits (223), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 54/337 (16%), Positives = 122/337 (36%), Gaps = 38/337 (11%)

Query: 41  SHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRD 100
            + +  +  + + IDR      T +     G+    +       +        F   + D
Sbjct: 674 LNRYMSQNEISNAIDRMAHIGETTL----TGSALTFVSQYFSPAKGARPNVRRFLILITD 729

Query: 101 NGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIP-------WYTNSRH 153
                +  DIV+  ++ +        YS+         L+  +  P        +   +H
Sbjct: 730 G----EAQDIVKDPAVALRQEG-IIIYSVGVFGSNVTQLEEISGRPEMVFYVENFDILQH 784

Query: 154 IVMPITSSVKVNSQTDAR---LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVK 210
           I   +   +    +   R   LD++ V+D S S++        + ++       M++ VK
Sbjct: 785 IEDDLVFGICSPREECKRIEVLDVVFVIDSSGSIDH------DEYNIMKDF---MVDLVK 835

Query: 211 LIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSH--LQRKIKYLSKFGVSTNSTPGLKYAYN 268
                 N V+ G + +++  E  F L+   +   +   ++     G +T +   L ++ +
Sbjct: 836 KADVGKNQVRFGALKYADDPEVLFYLDDLSTKWEVISVLQKDQPMGGNTYTAEALGFSDH 895

Query: 269 QIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR 328
              + +G R H         ++++ +TDGE+    +  +        + +G +V A+GI 
Sbjct: 896 MFTEARGSRLHKG-----VPQVLIVITDGES---HDADKLNDTAKALRDKGILVLAVGIA 947

Query: 329 VIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDI 365
                E L    S + ++ VE    +   FS +   +
Sbjct: 948 GANPVELLAMAGSSDKYFFVETFGGLKGIFSDVSASV 984



 Score = 85.6 bits (210), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 41/196 (20%), Positives = 77/196 (39%), Gaps = 27/196 (13%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D+M ++D S S+      +  K+   +K++      V       + VQ G+V FS+  +E
Sbjct: 620 DIMFLVDSSGSIGLE---NFIKMKTFMKNL------VSKSQIGADRVQIGVVQFSDINKE 670

Query: 233 FFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKI 290
            F L      + +   I  ++  G +T +   L +        +G R        N ++ 
Sbjct: 671 EFQLNRYMSQNEISNAIDRMAHIGETTLTGSALTFVSQYFSPAKGAR-------PNVRRF 723

Query: 291 IVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVEN 350
           ++ +TDGE                 ++ G I+Y++G+      +       P   + VEN
Sbjct: 724 LILITDGE-----AQDIVKDPAVALRQEGIIIYSVGVFGSNVTQLEEISGRPEMVFYVEN 778

Query: 351 PHSMYDAFSHIGKDIV 366
               +D   HI  D+V
Sbjct: 779 ----FDILQHIEDDLV 790



 Score = 80.2 bits (196), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 42/294 (14%), Positives = 101/294 (34%), Gaps = 31/294 (10%)

Query: 87  KNTWNMSFRNELRDNGFVNDID-DIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFI 145
           ++    +  N  R+   +  +  +    + L+ +     E +     +  ++     TF+
Sbjct: 343 EDNVTKAAVNLRREGVTIFTMGIEGASDSQLEKIASHPAEQHVSKLKTFSELAAHNQTFL 402

Query: 146 PWYTNSRHIVMPI----TSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKS 201
               N   + + +    T ++K         D+ +++D S S      +  T        
Sbjct: 403 KKLRNQITLTVSVFSERTETLKSGCVDTEEADIYLLIDGSGS------TQATDFHEMKTF 456

Query: 202 INAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNS 259
           ++ ++    + P     V+ G V +++  +  F +        L + I+ + + G +TN+
Sbjct: 457 LSEVVGMFNIAP---QKVRVGAVQYADSWDLEFEINKYTNKHDLGKAIENIRQMGGNTNT 513

Query: 260 TPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRG 319
              L       F +  +++            +V +T+G           L   N  ++  
Sbjct: 514 GAALN------FTLGLLQKAKKQRGNRVPCHLVVLTNG-----MSKDSILEPANRLREEL 562

Query: 320 AIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
             VYAIG++     +           Y V +    +DA   I   +V +    +
Sbjct: 563 IRVYAIGVKEANQTQLREIAGEDKRVYYVHD----FDALKDIRNQVVQEICAEE 612



 Score = 79.4 bits (194), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 36/214 (16%), Positives = 83/214 (38%), Gaps = 22/214 (10%)

Query: 154  IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
            +   + +S KV+     ++D++ ++D S S+         K+   + S+      V+   
Sbjct: 980  VSASVCNSSKVD-CEIEKVDLVFLMDGSNSIH---PDDFKKMKEFLASV------VQDFD 1029

Query: 214  DVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIF 271
               N V+ G   FS+     F L    G   +  +I+ + +    T+    L+   +   
Sbjct: 1030 VSVNRVRIGAAQFSHTYRPEFPLGTFIGKKEISFQIENIQQIFGYTHIGAALREVGDYFR 1089

Query: 272  DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR 331
               G R +  T      ++++ +TDG+        +      E + +G  +Y++GI  + 
Sbjct: 1090 PDMGSRINAGTP-----QVLLVLTDGQ-----SQDEVAQAAEELRHKGIDIYSVGIGDVD 1139

Query: 332  SHEFLRACASPNSFYLVENPHSMYDAFSHIGKDI 365
              + ++   + +    V N   +      I ++I
Sbjct: 1140 DQQLIQITGTADKKLTVHNFDELTKVKKRIVRNI 1173



 Score = 62.1 bits (149), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 38/207 (18%), Positives = 72/207 (34%), Gaps = 26/207 (12%)

Query: 159 TSSVKVNSQTDARL-DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNN 217
           T  + V       + D++ +LDVS       + S    D   + +    E V  +    N
Sbjct: 212 TDDILVEVCQGPSVADLVFLLDVS------VNGSQENFDYLKEFLE---ESVSALDIKEN 262

Query: 218 VVQSGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQG 275
            ++ GLVT+SN+ +    L  GV  S + + I+ LS       +   ++    ++F    
Sbjct: 263 CMRVGLVTYSNETKVINSLSRGVNKSEVLQNIQNLSPRAGKAYTGAAIRKIRKEVFS--- 319

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF 335
            R           +I V +T         +          ++ G  ++ +GI      + 
Sbjct: 320 ARNGSRKN-QGVPQIAVLVT-----HRPSEDNVTKAAVNLRREGVTIFTMGIEGASDSQL 373

Query: 336 LRACASPNSFYLVENPHSMYDAFSHIG 362
            +  + P      E   S    FS + 
Sbjct: 374 EKIASHP-----AEQHVSKLKTFSELA 395



 Score = 49.4 bits (116), Expect = 0.001,   Method: Composition-based stats.
 Identities = 33/210 (15%), Positives = 72/210 (34%), Gaps = 30/210 (14%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D++ ++D S  +            +    IN M+  +   P   +  +  L  +S+++  
Sbjct: 25  DVVFLVDSSDHLG------AKSFPLVKTFINRMISSL---PIEAHKYRVALAQYSDQLHS 75

Query: 233 FFLLEWGVSHLQRKIKYLSKF----GVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
            F L    S     + +L K     G S      L+ A+   F     R     +   + 
Sbjct: 76  EFQLGTFKSR-NPMLNHLKKNFGFVGGSLRIGQALREAHRTYFS----RPDSGRDKKQFP 130

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLV 348
            I+V +      S + +          +  G  + ++G++     E L+A A+    + +
Sbjct: 131 PILVVL-----ASAESEDDVEEPSKALRGDGVRIISVGLQSASEQE-LKAMATGQFHFNL 184

Query: 349 ENPHSMYDAF-----SHIGKDIVTKRIWYD 373
            +   +  AF       I +    + +  D
Sbjct: 185 RSARDL-GAFAPNMTQIIKEATQYREVATD 213


>gi|317483048|ref|ZP_07942050.1| von Willebrand factor type A domain-containing protein
           [Bifidobacterium sp. 12_1_47BFAA]
 gi|316915549|gb|EFV36969.1| von Willebrand factor type A domain-containing protein
           [Bifidobacterium sp. 12_1_47BFAA]
          Length = 813

 Score = 89.8 bits (221), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 49/289 (16%), Positives = 97/289 (33%), Gaps = 22/289 (7%)

Query: 60  HAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIV 119
            A               +    +L  +      +  ++   +   +   D   + S    
Sbjct: 9   AAVGAAAGRSGKRLVAVVAAVAMLGGVAGVSATAMADDGNASTTQSQTTDEKAAASAPAP 68

Query: 120 VVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQ---TDARLDMMI 176
           +  +     +        P +  T       +  + + +T +    +    T+  LD+++
Sbjct: 69  LSTEGTN-GVPDDPTLSAPAREKTVTANGDGTYKVALNVTGAKSAGTGAIVTNQPLDIVL 127

Query: 177 VLDVSRSMESFFDSSITKIDMAIKSINAML----EEVKLIPDVNNVVQSGLVTF-----S 227
           VLDVS SM         KID    ++N  +    +E   I D +   +  LV F     +
Sbjct: 128 VLDVSGSMADNLSGGPKKIDALKTAVNGFIDATADENAKITDQSQRNRIALVKFAGTEKT 187

Query: 228 NKIEEFFLLEWGVSHLQRKIKYLSKFGVS-TNSTPGLKYAYNQIFDMQGMRQHCN---TE 283
           +   +F+   W   +  + +  L+      T++  GL  +     D    R         
Sbjct: 188 SVGNDFYREGWSSYNYTQIVSNLTYDVSGLTSTVNGLSASGATSADYAFNRAQAALTYQP 247

Query: 284 DANYKKIIVFMTDGENLS-----TKEDQQSLYYCNEAKKRGAIVYAIGI 327
            AN KK+++F TDGE              ++      K  G  +Y+IG+
Sbjct: 248 RANAKKVVIFFTDGEPNHGSGFDPTVAATAVNKAKSLKDAGTTIYSIGV 296


>gi|156616288|ref|NP_766515.2| collagen alpha-6(VI) chain isoform 2 [Mus musculus]
          Length = 1182

 Score = 89.8 bits (221), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 46/204 (22%), Positives = 84/204 (41%), Gaps = 27/204 (13%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
            +  D + D+M ++D S S+      + +K+ M +K++      V       + VQ G+V
Sbjct: 613 EACRDMKADIMFLVDSSGSIGPE---NFSKMKMFMKNL------VSKSQIGADRVQIGVV 663

Query: 225 TFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS++ +E F L   +  S +   I  ++  G +T +   L +        +G R     
Sbjct: 664 QFSHENKEEFQLNTFMSQSDIANAIDRMTHIGETTLTGSALTFVSQYFSPDKGAR----- 718

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
              N +K ++ +TDGE                 +K G I+Y++G+      +       P
Sbjct: 719 --PNVRKFLILITDGE-----AQDIVRDPAIALRKEGVIIYSVGVFGSNVTQLEEISGKP 771

Query: 343 NSFYLVENPHSMYDAFSHIGKDIV 366
              + VEN    +D   HI  D+V
Sbjct: 772 EMVFYVEN----FDILQHIEDDLV 791



 Score = 87.1 bits (214), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 59/337 (17%), Positives = 123/337 (36%), Gaps = 38/337 (11%)

Query: 41  SHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRD 100
            + F  ++ + + IDR      T +     G+    +       +        F   + D
Sbjct: 675 LNTFMSQSDIANAIDRMTHIGETTL----TGSALTFVSQYFSPDKGARPNVRKFLILITD 730

Query: 101 NGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIP-------WYTNSRH 153
                +  DIVR  ++ +        YS+         L+  +  P        +   +H
Sbjct: 731 G----EAQDIVRDPAIALRKEG-VIIYSVGVFGSNVTQLEEISGKPEMVFYVENFDILQH 785

Query: 154 IVMPITSSVKVNSQTDAR---LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVK 210
           I   +   +    +   R   LD++ V+D S S++    + +            M+  VK
Sbjct: 786 IEDDLVLGICSPREECKRIEVLDVVFVIDSSGSIDYQEYNIMKDF---------MIGLVK 836

Query: 211 LIPDVNNVVQSGLVTFSNKIEEFFLLEW-GVS-HLQRKIKYLSKFGVSTNSTPGLKYAYN 268
                 N V+ G + +++  E  F L+  G    +   ++     G +T +   L ++ +
Sbjct: 837 KADVGKNQVRFGALKYADDPEVLFYLDELGTKLEVVSVLQNDHPMGGNTYTAEALAFSDH 896

Query: 269 QIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR 328
              + +G R H         ++++ +TDGE+    + ++        + +G +V A+GI 
Sbjct: 897 MFTEARGSRLHKG-----VPQVLIVITDGES---HDAEKLNTTAKALRDKGILVLAVGIA 948

Query: 329 VIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDI 365
              S E L    S + +Y VE    +   FS +   +
Sbjct: 949 GANSWELLAMAGSSDKYYFVETFGGLKGIFSDVSASV 985



 Score = 73.7 bits (179), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 36/214 (16%), Positives = 81/214 (37%), Gaps = 22/214 (10%)

Query: 154  IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
            +   + +S KV+     ++D++ ++D S S+         K+   + S+      V+   
Sbjct: 981  VSASVCNSSKVD-CEIEKVDLVFLMDGSNSIH---PDDFQKMKGFLVSV------VQDFD 1030

Query: 214  DVNNVVQSGLVTFSNKIEEFFLLEWGVSH--LQRKIKYLSKFGVSTNSTPGLKYAYNQIF 271
               N V+ G+  FS+     FLL        +  +I+ + +    T+    L+    + +
Sbjct: 1031 VSLNRVRIGVAQFSDSYRSEFLLGTFTGEREISTQIEGIQQIFGYTHIGDALRKV--KYY 1088

Query: 272  DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR 331
                M    N       ++++ +TDG         +      E + +G  +Y++GI  + 
Sbjct: 1089 FQPDMGSRINAGT---PQVLLVLTDGR-----SQDEVAQAAEELRHKGVDIYSVGIGDVD 1140

Query: 332  SHEFLRACASPNSFYLVENPHSMYDAFSHIGKDI 365
              E ++   +      V N   +      I ++I
Sbjct: 1141 DQELVQITGTAEKKLTVHNFDELKKVKKRIVRNI 1174



 Score = 71.0 bits (172), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 32/227 (14%), Positives = 82/227 (36%), Gaps = 22/227 (9%)

Query: 149 TNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEE 208
           T++  +    T ++K         D+ +++D S S      +  T        ++ ++  
Sbjct: 411 THTVSVFSERTETLKSACVDTEEADIYLLIDGSGS------TQPTDFHEMKTFLSEVVGM 464

Query: 209 VKLIPDVNNVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYA 266
             + P     V+ G V +++  +  F +        L + I+ + + G +TN+   L + 
Sbjct: 465 FNIAPHK---VRVGAVQYADTWDLEFEISKYSNKPDLGKAIENIRQMGGNTNTGAALNFT 521

Query: 267 YNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIG 326
              +   +  R       +     +V +T+G           L   ++ ++    V+AIG
Sbjct: 522 LKLLQRAKKER------GSKVPCHLVVLTNG-----MSRDSVLGPAHKLREENIRVHAIG 570

Query: 327 IRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
           ++     +           Y V    ++ +  + + ++I  +    D
Sbjct: 571 VKEANQTQLREIAGEEKRVYYVHEFDALRNIRNQVVQEICAEEACRD 617



 Score = 59.0 bits (141), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 31/188 (16%), Positives = 70/188 (37%), Gaps = 21/188 (11%)

Query: 162 VKVNSQTDARL-DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQ 220
           + V +     + D++ +LD++       + S   +D     +    E +  +    N ++
Sbjct: 216 IIVEACQGPSVADVVFLLDMA------INGSQEDLDHLKAFLG---ESISALDIKENCMR 266

Query: 221 SGLVTFSNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQ 278
            GLVT+SN+      L  G   + + ++I+ LS       +   L+    +IF      Q
Sbjct: 267 VGLVTYSNETRVISSLSTGNNKTEVLQRIQDLSPQVGQAYTGAALRKTRKEIFSA----Q 322

Query: 279 HCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRA 338
             + ++    +I V +T         +          ++ G  ++ +GI      E  + 
Sbjct: 323 RGSRKNQGVPQIAVLVT-----HRASEDNVTKAAVNLRREGVTIFTMGIEGANPDELEKI 377

Query: 339 CASPNSFY 346
            + P   +
Sbjct: 378 ASHPAEQF 385



 Score = 50.9 bits (120), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 31/205 (15%), Positives = 70/205 (34%), Gaps = 29/205 (14%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D++ ++D S  +       +    +    I+ M+  +   P   N  +  L  +S+ +  
Sbjct: 26  DVVFLVDSSDHLG------LKSFPLVKTFIHKMISSL---PIEANKYRVALAQYSDALHN 76

Query: 233 FFLLEWGVSHLQRKIKYLSKF----GVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
            F L    +     + +L K     G S      L+ A+   F      +        + 
Sbjct: 77  EFQLGTFKNR-NPMLNHLKKNFGFIGGSLKIGNALQEAHRTYFSAPTNGRDKK----QFP 131

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLV 348
            I+V +      S + +          ++ G  + ++G++       L+A A+    + +
Sbjct: 132 PILVVL-----ASAESEDDVEEAAKALREDGVKIISVGVQKASEEN-LKAMATSQFHFNL 185

Query: 349 ENPHSMYDAFS----HIGKDIVTKR 369
                +   F+     I KD+   R
Sbjct: 186 RTARDL-SVFAPNMTEIIKDVTQYR 209


>gi|223462569|gb|AAI50696.1| RIKEN cDNA E330026B02 gene [Mus musculus]
          Length = 1182

 Score = 89.8 bits (221), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 46/204 (22%), Positives = 84/204 (41%), Gaps = 27/204 (13%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
            +  D + D+M ++D S S+      + +K+ M +K++      V       + VQ G+V
Sbjct: 613 EACRDMKADIMFLVDSSGSIGPE---NFSKMKMFMKNL------VSKSQIGADRVQIGVV 663

Query: 225 TFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS++ +E F L   +  S +   I  ++  G +T +   L +        +G R     
Sbjct: 664 QFSHENKEEFQLNTFMSQSDIANAIDRMTHIGETTLTGSALTFVSQYFSPDKGAR----- 718

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
              N +K ++ +TDGE                 +K G I+Y++G+      +       P
Sbjct: 719 --PNVRKFLILITDGE-----AQDIVRDPALALRKEGVIIYSVGVFGSNVTQLEEISGKP 771

Query: 343 NSFYLVENPHSMYDAFSHIGKDIV 366
              + VEN    +D   HI  D+V
Sbjct: 772 EMVFYVEN----FDILQHIEDDLV 791



 Score = 86.4 bits (212), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 60/337 (17%), Positives = 123/337 (36%), Gaps = 38/337 (11%)

Query: 41  SHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRD 100
            + F  ++ + + IDR      T +     G+    +       +        F   + D
Sbjct: 675 LNTFMSQSDIANAIDRMTHIGETTL----TGSALTFVSQYFSPDKGARPNVRKFLILITD 730

Query: 101 NGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIP-------WYTNSRH 153
                +  DIVR  +L +        YS+         L+  +  P        +   +H
Sbjct: 731 G----EAQDIVRDPALALRKEG-VIIYSVGVFGSNVTQLEEISGKPEMVFYVENFDILQH 785

Query: 154 IVMPITSSVKVNSQTDAR---LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVK 210
           I   +   +    +   R   LD++ V+D S S++    + +            M+  VK
Sbjct: 786 IEDDLVLGICSPREECKRIEVLDVVFVIDSSGSIDYQEYNIMKDF---------MIGLVK 836

Query: 211 LIPDVNNVVQSGLVTFSNKIEEFFLLEW-GVS-HLQRKIKYLSKFGVSTNSTPGLKYAYN 268
                 N V+ G + +++  E  F L+  G    +   ++     G +T +   L ++ +
Sbjct: 837 KADVGKNQVRFGALKYADDPEVLFYLDELGTKLEVISVLQNDHPMGGNTYTAEALAFSNH 896

Query: 269 QIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR 328
              + +G R H         ++++ +TDGE+    + ++        + +G +V A+GI 
Sbjct: 897 MFTEARGSRLHKG-----VPQVLIVITDGES---HDAEKLNATAKALRDKGILVLAVGIA 948

Query: 329 VIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDI 365
              S E L    S + +Y VE    +   FS +   +
Sbjct: 949 GANSWELLAMAGSGDKYYFVETFGGLKGIFSDVSASV 985



 Score = 74.0 bits (180), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 37/214 (17%), Positives = 81/214 (37%), Gaps = 22/214 (10%)

Query: 154  IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
            +   + +S KV+     ++D++ ++D S S+         K+   + S+      V+   
Sbjct: 981  VSASVCNSSKVD-CEIEKVDLVFLMDGSNSIH---PDDFQKMKGFLVSV------VQDFD 1030

Query: 214  DVNNVVQSGLVTFSNKIEEFFLLEWGVSH--LQRKIKYLSKFGVSTNSTPGLKYAYNQIF 271
               N V+ G+  FS+     FLL        +  +I+ + +    T+    L+       
Sbjct: 1031 VSLNRVRIGVAQFSDSYRSEFLLGTFTGEREISTQIEGIQQIFGYTHIGDALRKVKYYFQ 1090

Query: 272  DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR 331
               G R +  T      ++++ +TDG         +      E + +G  +Y++GI  + 
Sbjct: 1091 PDTGSRINAGTP-----QVLLVLTDGR-----SQDEVAQAAEELRHKGVDIYSVGIGDVD 1140

Query: 332  SHEFLRACASPNSFYLVENPHSMYDAFSHIGKDI 365
              E ++   +      V N   +      I ++I
Sbjct: 1141 DQELVQITGTAEKKLTVHNFDELKKVKKRIVRNI 1174



 Score = 72.1 bits (175), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 32/227 (14%), Positives = 83/227 (36%), Gaps = 22/227 (9%)

Query: 149 TNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEE 208
           T++  +    T ++K         D+ +++D S S      +  T        ++ ++  
Sbjct: 411 THTVSVFSERTETLKSACVDTEEADIYLLIDGSGS------TQPTDFHEMKTFLSEVVGM 464

Query: 209 VKLIPDVNNVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYA 266
             + P     V+ G V +++  +  F +        L + I+ + + G +TN+   L + 
Sbjct: 465 FNIAPHK---VRVGAVQYADTWDLEFEISKYSNKPDLGKAIENIRQMGGNTNTGAALNFT 521

Query: 267 YNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIG 326
              +   +  R       +     +V +T+G           L   ++ ++    V+AIG
Sbjct: 522 LKLLQRAKKER------GSKVPCHLVVLTNG-----MSRDSVLGPAHKLREENIRVHAIG 570

Query: 327 IRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
           ++     +           Y V +  ++ +  + + ++I  +    D
Sbjct: 571 VKEANQMQLREIAGEEKRVYYVHDFDALRNIRNQVVQEICAEEACRD 617



 Score = 58.2 bits (139), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 31/188 (16%), Positives = 69/188 (36%), Gaps = 21/188 (11%)

Query: 162 VKVNSQTDARL-DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQ 220
           + V +     + D++ +LD++       + S   +D     +    E +  +    N ++
Sbjct: 216 IIVEACQGPSVADVVFLLDMA------INGSQEDLDHLKAFLG---ESISALDIKENCMR 266

Query: 221 SGLVTFSNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQ 278
            GLVT+SN+      L  G   + + + I+ LS       +   L+    +IF      Q
Sbjct: 267 VGLVTYSNETRVISSLSTGNNKTEVLQLIQDLSPQVGQAYTGAALRKTRKEIFSA----Q 322

Query: 279 HCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRA 338
             + ++    +I V +T         +          ++ G  ++ +GI      E  + 
Sbjct: 323 RGSRKNQGVPQIAVLVT-----HRASEDNVTKAAVNLRREGVTIFTMGIEGANPDELEKI 377

Query: 339 CASPNSFY 346
            + P   +
Sbjct: 378 ASHPAEQF 385



 Score = 50.9 bits (120), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 31/204 (15%), Positives = 68/204 (33%), Gaps = 27/204 (13%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D++ ++D S  +       +    +    I+ M+  +   P   N  +  L  +S+ +  
Sbjct: 26  DVVFLVDSSDHLG------LKSFPLVKTFIHKMISSL---PIEANKYRVALAQYSDALHN 76

Query: 233 FFLLEWGVSH---LQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
            F L    +    L    K     G S      L+ A+   F      +        +  
Sbjct: 77  EFQLGTFKNRNPMLNHLKKNFGFIGGSLKIGNALQEAHRTYFSAPTNGRDKK----QFPP 132

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVE 349
           I+V +      S + +          ++ G  + ++G++       L+A A+    + + 
Sbjct: 133 ILVVL-----ASAESEDDVEEAAKALREDGVKIISVGVQKASEEN-LKAMATSQFHFNLR 186

Query: 350 NPHSMYDAFS----HIGKDIVTKR 369
               +   F+     I KD+   R
Sbjct: 187 TARDL-SVFAPNMTEIIKDVTQYR 209


>gi|297462925|ref|XP_608567.5| PREDICTED: collagen type VI alpha 6-like [Bos taurus]
          Length = 2343

 Score = 89.8 bits (221), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 43/196 (21%), Positives = 76/196 (38%), Gaps = 27/196 (13%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D+M ++D S S+      +  K+   +K++      V       + VQ G+V FS+  +E
Sbjct: 618 DIMFLVDSSGSIGLE---NFIKMKTFMKNL------VSKSQIRADRVQIGVVQFSDVNKE 668

Query: 233 FFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKI 290
            F L    S   +   I  ++  G +T     L +        +G R        N +K 
Sbjct: 669 EFQLNRYTSQEEISDAIDRMAHIGETTLMGSALTFVSQYFSPAKGAR-------PNVRKF 721

Query: 291 IVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVEN 350
           ++ +TDGE                 ++ G I+Y++G+      +       P   + VEN
Sbjct: 722 LILITDGE-----AQDIVKDPAVALREEGIIIYSVGVFGSNVTQLEEISGRPEMVFYVEN 776

Query: 351 PHSMYDAFSHIGKDIV 366
               +D   HI  D+V
Sbjct: 777 ----FDILKHIEDDLV 788



 Score = 89.1 bits (219), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 55/337 (16%), Positives = 120/337 (35%), Gaps = 38/337 (11%)

Query: 41  SHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRD 100
            + +  +  +   IDR      T +M    G+    +       +        F   + D
Sbjct: 672 LNRYTSQEEISDAIDRMAHIGETTLM----GSALTFVSQYFSPAKGARPNVRKFLILITD 727

Query: 101 NGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIP-------WYTNSRH 153
                +  DIV+  ++ +        YS+         L+  +  P        +   +H
Sbjct: 728 G----EAQDIVKDPAVALREEG-IIIYSVGVFGSNVTQLEEISGRPEMVFYVENFDILKH 782

Query: 154 IVMPITSSVKVNSQTDAR---LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVK 210
           I   +   +    +   R   LD++ V+D S S++        + ++       M+  VK
Sbjct: 783 IEDDLVFGICSPHEECKRIEVLDVVFVIDSSGSIDH------DEYNIMKDF---MINLVK 833

Query: 211 LIPDVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYN 268
                 N V+ G + +++  E  F L+       +   ++     G +T +   L ++ +
Sbjct: 834 KADVGKNHVRFGALKYADDPEVLFYLDNLDTKWEVISVLQNDQPLGGNTYTAEALGFSDH 893

Query: 269 QIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR 328
              + +G R H         ++++ +TDGE+    +  +        + +G +V A+GI 
Sbjct: 894 MFTEARGSRLHKG-----VPQVLIVITDGES---HDADKLNATAKALRDKGILVLAVGIA 945

Query: 329 VIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDI 365
                E L    S + ++ VE    +   FS +   +
Sbjct: 946 GANPVELLAMAGSSDKYFFVETFGGLKGIFSDVSASV 982



 Score = 86.0 bits (211), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 38/214 (17%), Positives = 85/214 (39%), Gaps = 22/214 (10%)

Query: 154  IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
            +   + +S KV+     ++D++ ++D S S+         K+   + S+      ++   
Sbjct: 978  VSASVCNSSKVD-CEIEKVDLVFLMDGSNSIH---PDDFRKMKEFLASV------IQDFD 1027

Query: 214  DVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIF 271
              NN V+ G   FS+  +  F L    G   +  +I+ + +    T+    L+   +   
Sbjct: 1028 ISNNRVRIGAAQFSHTYQPEFPLGMFIGKEEISFQIENIKQIFGYTHIGAALRQVGHYFR 1087

Query: 272  DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR 331
               G R H  T      ++++ +TDG+        +      E + +G  +Y++GI  + 
Sbjct: 1088 PDMGSRIHAGTP-----QVLLVLTDGQ-----SQDEVAQAAEELRHKGIDIYSVGIGDVD 1137

Query: 332  SHEFLRACASPNSFYLVENPHSMYDAFSHIGKDI 365
              + ++   + N    V N   +      I ++I
Sbjct: 1138 DQQLVQITGTANKKLTVHNFDELKKVKKRIVRNI 1171



 Score = 81.7 bits (200), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 45/294 (15%), Positives = 98/294 (33%), Gaps = 31/294 (10%)

Query: 87  KNTWNMSFRNELRDNGFVNDID-DIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFI 145
           ++    +  N  R    V  I  +    T L+ +     E Y     S   +     TF+
Sbjct: 341 QDNVTKAAVNLRRQGVIVFTIGVEGASDTQLEKIASHPAEQYVSQLRSFSDLAAHNQTFL 400

Query: 146 P----WYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKS 201
                  T++  ++   T ++K         D+ +++D S S      +  T        
Sbjct: 401 KKLRNQITHTVSVISERTETLKAGCVDTEEADIYLLIDGSGS------TQATDFQEMKTF 454

Query: 202 INAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNS 259
           ++ +     + P     V+ G V ++++ +  F +        +++ I+ + + G + N+
Sbjct: 455 LSEVAGMFNIAP---QKVRVGAVQYADRWDLEFEISKYTNKHDVRKAIENIRQMGGNRNT 511

Query: 260 TPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRG 319
              L       F +  +++            +V +T+G               N   +  
Sbjct: 512 GAALN------FTLGLLQRAKQQRGGRVPCHLVVLTNG-----ASRDSVSGPANRLSEEL 560

Query: 320 AIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
             VYAIG+R     +           Y V +    +DA   I   +V +    +
Sbjct: 561 IHVYAIGVREANQTQLREIAGEEKRVYYVHD----FDALKDIRNQVVQEICAEE 610



 Score = 68.3 bits (165), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 34/188 (18%), Positives = 73/188 (38%), Gaps = 21/188 (11%)

Query: 162 VKVNSQTDARL-DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQ 220
           + V       + D++ +LD+S       +SS    D   + +    E +  +    + ++
Sbjct: 213 ILVEVCQGPSVADVVFLLDMST------NSSWEDFDYLKEFLE---ESISALDIKEHCMR 263

Query: 221 SGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQ 278
            GLV +SN+ +    L  GV  S + + I+ L+       +   L+    ++F      Q
Sbjct: 264 VGLVAYSNETKVISTLSRGVNKSEVLQDIQSLAPQAGKAYTGAALRKIRKEVFSA----Q 319

Query: 279 HCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRA 338
           H + ++    +I V +T      +             +++G IV+ IG+      +  + 
Sbjct: 320 HGSRKNQGVPQIAVLVT-----HSPSQDNVTKAAVNLRRQGVIVFTIGVEGASDTQLEKI 374

Query: 339 CASPNSFY 346
            + P   Y
Sbjct: 375 ASHPAEQY 382



 Score = 45.5 bits (106), Expect = 0.013,   Method: Composition-based stats.
 Identities = 34/185 (18%), Positives = 64/185 (34%), Gaps = 25/185 (13%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D++ ++D S  +       I         IN M+  +   P   +    GL  +S+ +  
Sbjct: 26  DVVFLVDSSDHLG------IKSFPFVKAFINKMISSL---PIEADKYHVGLAQYSDGLHR 76

Query: 233 FFLLEWGVSH---LQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
            FLL    S    L    K     G S      L+  +   F     R+        +  
Sbjct: 77  EFLLSTFKSRGPMLNHLKKNFGFLGGSLQVGKALREVHRAYFSSGRDRKQ-------FPP 129

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVE 349
           I+V +  GE+    E+          +K G  + ++G++ +     L+A A+    Y + 
Sbjct: 130 ILVVLASGESEDAVEEAA-----EALRKDGVRIVSVGMQGVSEKT-LKAMATGQFHYNLR 183

Query: 350 NPHSM 354
               +
Sbjct: 184 TVRDL 188


>gi|297471452|ref|XP_002685218.1| PREDICTED: collagen, type VI, alpha 1-like [Bos taurus]
 gi|296490817|gb|DAA32930.1| collagen, type VI, alpha 1-like [Bos taurus]
          Length = 2268

 Score = 89.8 bits (221), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 43/196 (21%), Positives = 76/196 (38%), Gaps = 27/196 (13%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D+M ++D S S+      +  K+   +K++      V       + VQ G+V FS+  +E
Sbjct: 618 DIMFLVDSSGSIGLE---NFIKMKTFMKNL------VSKSQIRADRVQIGVVQFSDVNKE 668

Query: 233 FFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKI 290
            F L    S   +   I  ++  G +T     L +        +G R        N +K 
Sbjct: 669 EFQLNRYTSQEEISDAIDRMAHIGETTLMGSALTFVSQYFSPAKGAR-------PNVRKF 721

Query: 291 IVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVEN 350
           ++ +TDGE                 ++ G I+Y++G+      +       P   + VEN
Sbjct: 722 LILITDGE-----AQDIVKDPAVALREEGIIIYSVGVFGSNVTQLEEISGRPEMVFYVEN 776

Query: 351 PHSMYDAFSHIGKDIV 366
               +D   HI  D+V
Sbjct: 777 ----FDILKHIEDDLV 788



 Score = 89.1 bits (219), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 55/337 (16%), Positives = 120/337 (35%), Gaps = 38/337 (11%)

Query: 41  SHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRD 100
            + +  +  +   IDR      T +M    G+    +       +        F   + D
Sbjct: 672 LNRYTSQEEISDAIDRMAHIGETTLM----GSALTFVSQYFSPAKGARPNVRKFLILITD 727

Query: 101 NGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIP-------WYTNSRH 153
                +  DIV+  ++ +        YS+         L+  +  P        +   +H
Sbjct: 728 G----EAQDIVKDPAVALREEG-IIIYSVGVFGSNVTQLEEISGRPEMVFYVENFDILKH 782

Query: 154 IVMPITSSVKVNSQTDAR---LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVK 210
           I   +   +    +   R   LD++ V+D S S++        + ++       M+  VK
Sbjct: 783 IEDDLVFGICSPHEECKRIEVLDVVFVIDSSGSIDH------DEYNIMKDF---MINLVK 833

Query: 211 LIPDVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYN 268
                 N V+ G + +++  E  F L+       +   ++     G +T +   L ++ +
Sbjct: 834 KADVGKNHVRFGALKYADDPEVLFYLDNLDTKWEVISVLQNDQPLGGNTYTAEALGFSDH 893

Query: 269 QIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR 328
              + +G R H         ++++ +TDGE+    +  +        + +G +V A+GI 
Sbjct: 894 MFTEARGSRLHKG-----VPQVLIVITDGES---HDADKLNATAKALRDKGILVLAVGIA 945

Query: 329 VIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDI 365
                E L    S + ++ VE    +   FS +   +
Sbjct: 946 GANPVELLAMAGSSDKYFFVETFGGLKGIFSDVSASV 982



 Score = 86.0 bits (211), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 38/214 (17%), Positives = 85/214 (39%), Gaps = 22/214 (10%)

Query: 154  IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
            +   + +S KV+     ++D++ ++D S S+         K+   + S+      ++   
Sbjct: 978  VSASVCNSSKVD-CEIEKVDLVFLMDGSNSIH---PDDFRKMKEFLASV------IQDFD 1027

Query: 214  DVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIF 271
              NN V+ G   FS+  +  F L    G   +  +I+ + +    T+    L+   +   
Sbjct: 1028 ISNNRVRIGAAQFSHTYQPEFPLGMFIGKEEISFQIENIKQIFGYTHIGAALRQVGHYFR 1087

Query: 272  DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR 331
               G R H  T      ++++ +TDG+        +      E + +G  +Y++GI  + 
Sbjct: 1088 PDMGSRIHAGTP-----QVLLVLTDGQ-----SQDEVAQAAEELRHKGIDIYSVGIGDVD 1137

Query: 332  SHEFLRACASPNSFYLVENPHSMYDAFSHIGKDI 365
              + ++   + N    V N   +      I ++I
Sbjct: 1138 DQQLVQITGTANKKLTVHNFDELKKVKKRIVRNI 1171



 Score = 81.7 bits (200), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 45/294 (15%), Positives = 98/294 (33%), Gaps = 31/294 (10%)

Query: 87  KNTWNMSFRNELRDNGFVNDID-DIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFI 145
           ++    +  N  R    V  I  +    T L+ +     E Y     S   +     TF+
Sbjct: 341 QDNVTKAAVNLRRQGVIVFTIGVEGASDTQLEKIASHPAEQYVSQLRSFSDLAAHNQTFL 400

Query: 146 P----WYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKS 201
                  T++  ++   T ++K         D+ +++D S S      +  T        
Sbjct: 401 KKLRNQITHTVSVISERTETLKAGCVDTEEADIYLLIDGSGS------TQATDFQEMKTF 454

Query: 202 INAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNS 259
           ++ +     + P     V+ G V ++++ +  F +        +++ I+ + + G + N+
Sbjct: 455 LSEVAGMFNIAP---QKVRVGAVQYADRWDLEFEISKYTNKHDVRKAIENIRQMGGNRNT 511

Query: 260 TPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRG 319
              L       F +  +++            +V +T+G               N   +  
Sbjct: 512 GAALN------FTLGLLQRAKQQRGGRVPCHLVVLTNG-----ASRDSVSGPANRLSEEL 560

Query: 320 AIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
             VYAIG+R     +           Y V +    +DA   I   +V +    +
Sbjct: 561 IHVYAIGVREANQTQLREIAGEEKRVYYVHD----FDALKDIRNQVVQEICAEE 610



 Score = 68.3 bits (165), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 34/188 (18%), Positives = 73/188 (38%), Gaps = 21/188 (11%)

Query: 162 VKVNSQTDARL-DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQ 220
           + V       + D++ +LD+S       +SS    D   + +    E +  +    + ++
Sbjct: 213 ILVEVCQGPSVADVVFLLDMST------NSSWEDFDYLKEFLE---ESISALDIKEHCMR 263

Query: 221 SGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQ 278
            GLV +SN+ +    L  GV  S + + I+ L+       +   L+    ++F      Q
Sbjct: 264 VGLVAYSNETKVISTLSRGVNKSEVLQDIQSLAPQAGKAYTGAALRKIRKEVFSA----Q 319

Query: 279 HCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRA 338
           H + ++    +I V +T      +             +++G IV+ IG+      +  + 
Sbjct: 320 HGSRKNQGVPQIAVLVT-----HSPSQDNVTKAAVNLRRQGVIVFTIGVEGASDTQLEKI 374

Query: 339 CASPNSFY 346
            + P   Y
Sbjct: 375 ASHPAEQY 382



 Score = 45.5 bits (106), Expect = 0.012,   Method: Composition-based stats.
 Identities = 34/185 (18%), Positives = 64/185 (34%), Gaps = 25/185 (13%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D++ ++D S  +       I         IN M+  +   P   +    GL  +S+ +  
Sbjct: 26  DVVFLVDSSDHLG------IKSFPFVKAFINKMISSL---PIEADKYHVGLAQYSDGLHR 76

Query: 233 FFLLEWGVSH---LQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
            FLL    S    L    K     G S      L+  +   F     R+        +  
Sbjct: 77  EFLLSTFKSRGPMLNHLKKNFGFLGGSLQVGKALREVHRAYFSSGRDRKQ-------FPP 129

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVE 349
           I+V +  GE+    E+          +K G  + ++G++ +     L+A A+    Y + 
Sbjct: 130 ILVVLASGESEDAVEEAA-----EALRKDGVRIVSVGMQGVSEKT-LKAMATGQFHYNLR 183

Query: 350 NPHSM 354
               +
Sbjct: 184 TVRDL 188


>gi|26344185|dbj|BAC35749.1| unnamed protein product [Mus musculus]
          Length = 1182

 Score = 89.8 bits (221), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 46/204 (22%), Positives = 84/204 (41%), Gaps = 27/204 (13%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
            +  D + D+M ++D S S+      + +K+ M +K++      V       + VQ G+V
Sbjct: 613 EACRDMKADIMFLVDSSGSIGPE---NFSKMKMFMKNL------VSKSQIGADRVQIGVV 663

Query: 225 TFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS++ +E F L   +  S +   I  ++  G +T +   L +        +G R     
Sbjct: 664 QFSHENKEEFQLNTFMSQSDIANAIDRMTHIGETTLTGSALTFVSQYFSPDKGAR----- 718

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
              N +K ++ +TDGE                 +K G I+Y++G+      +       P
Sbjct: 719 --PNVRKFLILITDGE-----AQDIVRDPAIALRKEGVIIYSVGVFGSNVTQLEEISGKP 771

Query: 343 NSFYLVENPHSMYDAFSHIGKDIV 366
              + VEN    +D   HI  D+V
Sbjct: 772 EMVFYVEN----FDILQHIEDDLV 791



 Score = 88.7 bits (218), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 59/337 (17%), Positives = 122/337 (36%), Gaps = 38/337 (11%)

Query: 41  SHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRD 100
            + F  ++ + + IDR      T +     G+    +       +        F   + D
Sbjct: 675 LNTFMSQSDIANAIDRMTHIGETTL----TGSALTFVSQYFSPDKGARPNVRKFLILITD 730

Query: 101 NGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIP-------WYTNSRH 153
                +  DIVR  ++ +        YS+         L+  +  P        +   +H
Sbjct: 731 G----EAQDIVRDPAIALRKEG-VIIYSVGVFGSNVTQLEEISGKPEMVFYVENFDILQH 785

Query: 154 IVMPITSSVKVNSQTDAR---LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVK 210
           I   +   +    +   R   LD++ V+D S S++    + +            M+  VK
Sbjct: 786 IEDDLVLGICSPREECKRIEVLDVVFVIDSSGSIDYQEYNIMKDF---------MIGLVK 836

Query: 211 LIPDVNNVVQSGLVTFSNKIEEFFLLEW-GVS-HLQRKIKYLSKFGVSTNSTPGLKYAYN 268
                 N V+ G + +++  E  F L+  G    +   ++     G +T +   L ++ +
Sbjct: 837 KADVGKNQVRFGALKYADDPEVLFYLDELGTKLEVVSVLQNDHPMGGNTYTAEALAFSDH 896

Query: 269 QIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR 328
              + +G R H         ++++ +TDGE+      ++        + +G +V A+GI 
Sbjct: 897 MFTEARGSRLHKG-----VPQVLIVITDGESNDA---EKLNTTAKALRDKGILVLAVGIA 948

Query: 329 VIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDI 365
              S E L    S + +Y VE    +   FS +   +
Sbjct: 949 GANSWELLAMAGSSDKYYFVETFGGLKGIFSDVSASV 985



 Score = 73.7 bits (179), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 36/214 (16%), Positives = 81/214 (37%), Gaps = 22/214 (10%)

Query: 154  IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
            +   + +S KV+     ++D++ ++D S S+         K+   + S+      V+   
Sbjct: 981  VSASVCNSSKVD-CEIEKVDLVFLMDGSNSIH---PDDFQKMKGFLVSV------VQDFD 1030

Query: 214  DVNNVVQSGLVTFSNKIEEFFLLEWGVSH--LQRKIKYLSKFGVSTNSTPGLKYAYNQIF 271
               N V+ G+  FS+     FLL        +  +I+ + +    T+    L+    + +
Sbjct: 1031 VSLNRVRIGVAQFSDSYRSEFLLGTFTGEREISTQIEGIQQIFGYTHIGDALRKV--KYY 1088

Query: 272  DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR 331
                M    N       ++++ +TDG         +      E + +G  +Y++GI  + 
Sbjct: 1089 FQPDMGSRINAGT---PQVLLVLTDGR-----SQDEVAQAAEELRHKGVDIYSVGIGDVD 1140

Query: 332  SHEFLRACASPNSFYLVENPHSMYDAFSHIGKDI 365
              E ++   +      V N   +      I ++I
Sbjct: 1141 DQELVQITGTAEKKLTVHNFDELKKVKKRIVRNI 1174



 Score = 71.0 bits (172), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 32/227 (14%), Positives = 82/227 (36%), Gaps = 22/227 (9%)

Query: 149 TNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEE 208
           T++  +    T ++K         D+ +++D S S      +  T        ++ ++  
Sbjct: 411 THTVSVFSERTETLKSACVDTEEADIYLLIDGSGS------TQPTDFHEMKTFLSEVVGM 464

Query: 209 VKLIPDVNNVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYA 266
             + P     V+ G V +++  +  F +        L + I+ + + G +TN+   L + 
Sbjct: 465 FNIAPHK---VRVGAVQYADTWDLEFEISKYSNKPDLGKAIENIRQMGGNTNTGAALNFT 521

Query: 267 YNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIG 326
              +   +  R       +     +V +T+G           L   ++ ++    V+AIG
Sbjct: 522 LKLLQRAKKER------GSKVPCHLVVLTNG-----MSRDSVLGPAHKLREENIRVHAIG 570

Query: 327 IRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
           ++     +           Y V    ++ +  + + ++I  +    D
Sbjct: 571 VKEANQTQLREIAGEEKRVYYVHEFDALRNIRNQVVQEICAEEACRD 617



 Score = 58.6 bits (140), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 31/188 (16%), Positives = 70/188 (37%), Gaps = 21/188 (11%)

Query: 162 VKVNSQTDARL-DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQ 220
           + V +     + D++ +LD++       + S   +D     +    E +  +    N ++
Sbjct: 216 IIVEACQGPSVADVVFLLDMA------INGSQEDLDHLKAFLG---ESISALDIKENCMR 266

Query: 221 SGLVTFSNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQ 278
            GLVT+SN+      L  G   + + ++I+ LS       +   L+    +IF      Q
Sbjct: 267 VGLVTYSNETRVISSLSTGNNKTEVLQRIQDLSPQVGQAYTGAALRKTRKEIFSA----Q 322

Query: 279 HCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRA 338
             + ++    +I V +T         +          ++ G  ++ +GI      E  + 
Sbjct: 323 RGSRKNQGVPQIAVLVT-----HRASEDNVTKAAVNLRREGVTIFTMGIEGANPDELEKI 377

Query: 339 CASPNSFY 346
            + P   +
Sbjct: 378 ASHPAEQF 385



 Score = 50.9 bits (120), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 31/204 (15%), Positives = 68/204 (33%), Gaps = 27/204 (13%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D++ ++D S  +       +    +    I+ M+  +   P   N  +  L  +S+ +  
Sbjct: 26  DVVFLVDSSDHLG------LKSFPLVKTFIHKMISSL---PIEANKYRVALAQYSDALHN 76

Query: 233 FFLLEWGVSH---LQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
            F L    +    L    K     G S      L+ A+   F      +        +  
Sbjct: 77  EFQLGTFKNRNPMLNHLKKNFGFIGGSLKIGNALQEAHRTYFSAPTNGRDKK----QFPP 132

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVE 349
           I+V +      S + +          ++ G  + ++G++       L+A A+    + + 
Sbjct: 133 ILVVL-----ASAESEDDVEEAAKALREDGVKIISVGVQKASEEN-LKAMATSQFHFNLR 186

Query: 350 NPHSMYDAFS----HIGKDIVTKR 369
               +   F+     I KD+   R
Sbjct: 187 TARDL-SVFAPNMTEIIKDVTQYR 209


>gi|149773091|emb|CAO01895.1| collagen type VI alpha 6 [Mus musculus]
          Length = 1162

 Score = 89.4 bits (220), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 46/204 (22%), Positives = 84/204 (41%), Gaps = 27/204 (13%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
            +  D + D+M ++D S S+      + +K+ M +K++      V       + VQ G+V
Sbjct: 593 EACRDMKADIMFLVDSSGSIGPE---NFSKMKMFMKNL------VSKSQIGADRVQIGVV 643

Query: 225 TFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS++ +E F L   +  S +   I  ++  G +T +   L +        +G R     
Sbjct: 644 QFSHENKEEFQLNTFMSQSDIANAIDRMTHIGETTLTGSALTFVSQYFSPDKGAR----- 698

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
              N +K ++ +TDGE                 +K G I+Y++G+      +       P
Sbjct: 699 --PNVRKFLILITDGE-----AQDIVRDPAIALRKEGVIIYSVGVFGSNVTQLEEISGKP 751

Query: 343 NSFYLVENPHSMYDAFSHIGKDIV 366
              + VEN    +D   HI  D+V
Sbjct: 752 EMVFYVEN----FDILQHIEDDLV 771



 Score = 86.7 bits (213), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 59/337 (17%), Positives = 123/337 (36%), Gaps = 38/337 (11%)

Query: 41  SHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRD 100
            + F  ++ + + IDR      T +     G+    +       +        F   + D
Sbjct: 655 LNTFMSQSDIANAIDRMTHIGETTL----TGSALTFVSQYFSPDKGARPNVRKFLILITD 710

Query: 101 NGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIP-------WYTNSRH 153
                +  DIVR  ++ +        YS+         L+  +  P        +   +H
Sbjct: 711 G----EAQDIVRDPAIALRKEG-VIIYSVGVFGSNVTQLEEISGKPEMVFYVENFDILQH 765

Query: 154 IVMPITSSVKVNSQTDAR---LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVK 210
           I   +   +    +   R   LD++ V+D S S++    + +            M+  VK
Sbjct: 766 IEDDLVLGICSPREECKRIEVLDVVFVIDSSGSIDYQEYNIMKDF---------MIGLVK 816

Query: 211 LIPDVNNVVQSGLVTFSNKIEEFFLLEW-GVS-HLQRKIKYLSKFGVSTNSTPGLKYAYN 268
                 N V+ G + +++  E  F L+  G    +   ++     G +T +   L ++ +
Sbjct: 817 KADVGKNQVRFGALKYADDPEVLFYLDELGTKLEVVSVLQNDHPMGGNTYTAEALAFSDH 876

Query: 269 QIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR 328
              + +G R H         ++++ +TDGE+    + ++        + +G +V A+GI 
Sbjct: 877 MFTEARGSRLHKG-----VPQVLIVITDGES---HDAEKLNTTAKALRDKGILVLAVGIA 928

Query: 329 VIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDI 365
              S E L    S + +Y VE    +   FS +   +
Sbjct: 929 GANSWELLAMAGSSDKYYFVETFGGLKGIFSDVSASV 965



 Score = 73.7 bits (179), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 36/214 (16%), Positives = 81/214 (37%), Gaps = 22/214 (10%)

Query: 154  IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
            +   + +S KV+     ++D++ ++D S S+         K+   + S+      V+   
Sbjct: 961  VSASVCNSSKVD-CEIEKVDLVFLMDGSNSIH---PDDFQKMKGFLVSV------VQDFD 1010

Query: 214  DVNNVVQSGLVTFSNKIEEFFLLEWGVSH--LQRKIKYLSKFGVSTNSTPGLKYAYNQIF 271
               N V+ G+  FS+     FLL        +  +I+ + +    T+    L+    + +
Sbjct: 1011 VSLNRVRIGVAQFSDSYRSEFLLGTFTGEREISTQIEGIQQIFGYTHIGDALRKV--KYY 1068

Query: 272  DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR 331
                M    N       ++++ +TDG         +      E + +G  +Y++GI  + 
Sbjct: 1069 FQPDMGSRINAGT---PQVLLVLTDGR-----SQDEVAQAAEELRHKGVDIYSVGIGDVD 1120

Query: 332  SHEFLRACASPNSFYLVENPHSMYDAFSHIGKDI 365
              E ++   +      V N   +      I ++I
Sbjct: 1121 DQELVQITGTAEKKLTVHNFDELKKVKKRIVRNI 1154



 Score = 71.0 bits (172), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 32/227 (14%), Positives = 82/227 (36%), Gaps = 22/227 (9%)

Query: 149 TNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEE 208
           T++  +    T ++K         D+ +++D S S      +  T        ++ ++  
Sbjct: 391 THTVSVFSERTETLKSACVDTEEADIYLLIDGSGS------TQPTDFHEMKTFLSEVVGM 444

Query: 209 VKLIPDVNNVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYA 266
             + P     V+ G V +++  +  F +        L + I+ + + G +TN+   L + 
Sbjct: 445 FNIAPHK---VRVGAVQYADTWDLEFEISKYSNKPDLGKAIENIRQMGGNTNTGAALNFT 501

Query: 267 YNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIG 326
              +   +  R       +     +V +T+G           L   ++ ++    V+AIG
Sbjct: 502 LKLLQRAKKER------GSKVPCHLVVLTNG-----MSRDSVLGPAHKLREENIRVHAIG 550

Query: 327 IRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
           ++     +           Y V    ++ +  + + ++I  +    D
Sbjct: 551 VKEANQTQLREIAGEEKRVYYVHEFDALRNIRNQVVQEICAEEACRD 597



 Score = 58.6 bits (140), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 31/188 (16%), Positives = 70/188 (37%), Gaps = 21/188 (11%)

Query: 162 VKVNSQTDARL-DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQ 220
           + V +     + D++ +LD++       + S   +D     +    E +  +    N ++
Sbjct: 196 IIVEACQGPSVADVVFLLDMA------INGSQEDLDHLKAFLG---ESISALDIKENCMR 246

Query: 221 SGLVTFSNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQ 278
            GLVT+SN+      L  G   + + ++I+ LS       +   L+    +IF      Q
Sbjct: 247 VGLVTYSNETRVISSLSTGNNKTEVLQRIQDLSPQVGQAYTGAALRKTRKEIFSA----Q 302

Query: 279 HCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRA 338
             + ++    +I V +T         +          ++ G  ++ +GI      E  + 
Sbjct: 303 RGSRKNQGVPQIAVLVT-----HRASEDNVTKAAVNLRREGVTIFTMGIEGANPDELEKI 357

Query: 339 CASPNSFY 346
            + P   +
Sbjct: 358 ASHPAEQF 365



 Score = 50.5 bits (119), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 31/204 (15%), Positives = 68/204 (33%), Gaps = 27/204 (13%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D++ ++D S  +       +    +    I+ M+  +   P   N  +  L  +S+ +  
Sbjct: 6   DVVFLVDSSDHLG------LKSFPLVKTFIHKMISSL---PIEANKYRVALAQYSDALHN 56

Query: 233 FFLLEWGVSH---LQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
            F L    +    L    K     G S      L+ A+   F      +        +  
Sbjct: 57  EFQLGTFKNRNPMLNHLKKNFGFIGGSLKIGNALQEAHRTYFSAPTNGRDKK----QFPP 112

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVE 349
           I+V +      S + +          ++ G  + ++G++       L+A A+    + + 
Sbjct: 113 ILVVL-----ASAESEDDVEEAAKALREDGVKIISVGVQKASEEN-LKAMATSQFHFNLR 166

Query: 350 NPHSMYDAFS----HIGKDIVTKR 369
               +   F+     I KD+   R
Sbjct: 167 TARDL-SVFAPNMTEIIKDVTQYR 189


>gi|281345782|gb|EFB21366.1| hypothetical protein PANDA_017603 [Ailuropoda melanoleuca]
          Length = 2245

 Score = 89.4 bits (220), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 54/337 (16%), Positives = 118/337 (35%), Gaps = 38/337 (11%)

Query: 41  SHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRD 100
            + +  +  + + IDR      T +     G+    +       +        F   + D
Sbjct: 655 LNRYMSQNEISNAIDRMTHIGETTL----TGSALTFVSQYFSPAKGARPNVRRFLILITD 710

Query: 101 NGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIP-------WYTNSRH 153
                +  DIV+  ++ +        YS+         L+  +  P        +   +H
Sbjct: 711 G----EAQDIVKDPAVALRQEG-IIIYSVGVFGSNVTQLEEISGRPEMVFYVENFDILQH 765

Query: 154 IVMPITSSVKVNSQTDAR---LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVK 210
           I   +   +    +   R   LD++ V+D S S++    S +            M++ VK
Sbjct: 766 IEDDLVFGICSPREECKRIEVLDVVFVIDSSGSIDHDEYSIMKDF---------MVDLVK 816

Query: 211 LIPDVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYN 268
                 N V+ G + +++  E  F L        +   ++     G +T +   L ++ +
Sbjct: 817 KADVGKNQVRFGALKYADDPEVLFYLGDLGSKWEVISVLQKDQPMGGNTYTAEALGFSDH 876

Query: 269 QIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR 328
              + +G R           ++++ +TDGE+    +  +        + +G +V A+GI 
Sbjct: 877 MFTEARGSRLQKG-----VPQVLIVITDGES---HDADKLNATAKALRDKGILVLAVGIA 928

Query: 329 VIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDI 365
                E L    S + ++ VE    +   FS +   +
Sbjct: 929 GANPVELLAMAGSSDKYFFVETFGGLKGIFSDVSASV 965



 Score = 88.7 bits (218), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 41/196 (20%), Positives = 77/196 (39%), Gaps = 27/196 (13%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D+M ++D S S+      +  K+   +K++      V       + VQ G+V FS+  +E
Sbjct: 601 DIMFLVDSSGSIGLE---NFIKMKTFMKNL------VSKSQIGADRVQIGVVQFSDVNKE 651

Query: 233 FFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKI 290
            F L      + +   I  ++  G +T +   L +        +G R        N ++ 
Sbjct: 652 EFQLNRYMSQNEISNAIDRMTHIGETTLTGSALTFVSQYFSPAKGAR-------PNVRRF 704

Query: 291 IVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVEN 350
           ++ +TDGE                 ++ G I+Y++G+      +       P   + VEN
Sbjct: 705 LILITDGE-----AQDIVKDPAVALRQEGIIIYSVGVFGSNVTQLEEISGRPEMVFYVEN 759

Query: 351 PHSMYDAFSHIGKDIV 366
               +D   HI  D+V
Sbjct: 760 ----FDILQHIEDDLV 771



 Score = 79.4 bits (194), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 35/223 (15%), Positives = 77/223 (34%), Gaps = 26/223 (11%)

Query: 153 HIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLI 212
            +    T ++K         D+ +++D S S      +  T        ++ ++    + 
Sbjct: 395 SVFSERTETLKSGCVDTEEADIYLLIDGSGS------TQATDFHEMKTFLSEVVGMFNIA 448

Query: 213 PDVNNVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQI 270
           P     V+ G V +++  +  F +        L + I+ + + G +TN+   L       
Sbjct: 449 P---QKVRVGAVQYADSWDLEFEINKYTNKHDLGKAIENIRQMGGNTNTGAALN------ 499

Query: 271 FDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI 330
           F +  +++            +V +T+G           L   N  ++    VYAIG++  
Sbjct: 500 FTLGLLQKAKKQRGNRVPCHLVVLTNG-----MSKDSILEPANRLREELIRVYAIGVKEA 554

Query: 331 RSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
              +           Y V +    +DA   I   +V +    +
Sbjct: 555 NQTQLREIAGEEKRVYYVHD----FDALKDIRNQVVQEICAEE 593



 Score = 78.3 bits (191), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 35/214 (16%), Positives = 82/214 (38%), Gaps = 22/214 (10%)

Query: 154  IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
            +   + +S KV+     ++D++ ++D S S+         K+   + S+      V+   
Sbjct: 961  VSASVCNSSKVD-CEIEKVDLVFLMDGSNSIH---PDDFRKMKEFLASV------VQDFD 1010

Query: 214  DVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIF 271
               N V+ G   FS+     F L    G   +  +I+ + +    T+    L+   +   
Sbjct: 1011 VSVNRVRIGAAQFSHTYRPEFPLGTFVGKKEISFQIENIQQIFGYTHIGAALRQVGHYFR 1070

Query: 272  DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR 331
               G R +  T      ++++ +TDG+        +      + + +G  +Y++GI  + 
Sbjct: 1071 PDMGSRINAGTP-----QVLLVLTDGQ-----SQDEVARAAEDLRHKGVDIYSVGIGDVD 1120

Query: 332  SHEFLRACASPNSFYLVENPHSMYDAFSHIGKDI 365
              + ++   +      V N   +      I ++I
Sbjct: 1121 DQQLIQITGTAGKKLTVHNFDELTKVKKRIVRNI 1154



 Score = 60.9 bits (146), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 35/204 (17%), Positives = 72/204 (35%), Gaps = 26/204 (12%)

Query: 162 VKVNSQTDARL-DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQ 220
           + V       + D++ +LDVS       + S    +   + +    E V  +    + ++
Sbjct: 196 ILVEVCQGPSVADVVFLLDVS------VNGSQENFEYLKEFLE---ESVSALDIKEHCMR 246

Query: 221 SGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQ 278
            GLVT+SN+ +    L  GV  S + + I+ LS +     +   ++    ++F     R 
Sbjct: 247 VGLVTYSNETKVINSLSRGVNKSEVLQNIQNLSPWSGKAYTGAAIRKIRKEVFS---ARN 303

Query: 279 HCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRA 338
                     +I V +T         +          ++ G  ++ +GI      +  + 
Sbjct: 304 GSRKN-QGVPQIAVLVT-----HRPSEDNVTKAAVNLRREGVTIFTMGIEGASDSQLEKI 357

Query: 339 CASPNSFYLVENPHSMYDAFSHIG 362
            + P      E   S    FS + 
Sbjct: 358 ASHP-----AEQHVSKLKTFSDLA 376



 Score = 54.0 bits (128), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 35/203 (17%), Positives = 74/203 (36%), Gaps = 23/203 (11%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D++ ++D S       D   TK    +K+   +   V  +P   +  +  +  +S+++  
Sbjct: 6   DVVFLVDSS-------DHLGTKSFPLVKAF--IHRMVSSLPIEAHKYRVAVAQYSDRLHS 56

Query: 233 FFLLEWGVSH---LQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
            F L    S    L    K L   G S  +   L+ A+   F      +        +  
Sbjct: 57  EFQLGTFKSRNPMLNHLKKNLGFLGGSLRTGHALREAHRTYFSAPAGGRDKK----QFPP 112

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVE 349
           I+V +      S + +          ++ G  + ++G++     E L+A A+    + + 
Sbjct: 113 ILVVL-----ASAQSEDDVEEASKALREDGVRIVSVGLQSASEEE-LKAMATAQFHFNLR 166

Query: 350 NPHSMYDAFSHIGKDIVTKRIWY 372
           +   +  AFS     I+ +   Y
Sbjct: 167 SARDL-GAFSQNMTQIIKEATQY 188


>gi|301784735|ref|XP_002927783.1| PREDICTED: collagen alpha-6(VI) chain-like [Ailuropoda melanoleuca]
          Length = 2267

 Score = 89.4 bits (220), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 54/337 (16%), Positives = 118/337 (35%), Gaps = 38/337 (11%)

Query: 41  SHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRD 100
            + +  +  + + IDR      T +     G+    +       +        F   + D
Sbjct: 675 LNRYMSQNEISNAIDRMTHIGETTL----TGSALTFVSQYFSPAKGARPNVRRFLILITD 730

Query: 101 NGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIP-------WYTNSRH 153
                +  DIV+  ++ +        YS+         L+  +  P        +   +H
Sbjct: 731 G----EAQDIVKDPAVALRQEG-IIIYSVGVFGSNVTQLEEISGRPEMVFYVENFDILQH 785

Query: 154 IVMPITSSVKVNSQTDAR---LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVK 210
           I   +   +    +   R   LD++ V+D S S++    S +            M++ VK
Sbjct: 786 IEDDLVFGICSPREECKRIEVLDVVFVIDSSGSIDHDEYSIMKDF---------MVDLVK 836

Query: 211 LIPDVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYN 268
                 N V+ G + +++  E  F L        +   ++     G +T +   L ++ +
Sbjct: 837 KADVGKNQVRFGALKYADDPEVLFYLGDLGSKWEVISVLQKDQPMGGNTYTAEALGFSDH 896

Query: 269 QIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR 328
              + +G R           ++++ +TDGE+    +  +        + +G +V A+GI 
Sbjct: 897 MFTEARGSRLQKG-----VPQVLIVITDGES---HDADKLNATAKALRDKGILVLAVGIA 948

Query: 329 VIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDI 365
                E L    S + ++ VE    +   FS +   +
Sbjct: 949 GANPVELLAMAGSSDKYFFVETFGGLKGIFSDVSASV 985



 Score = 88.7 bits (218), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 41/196 (20%), Positives = 77/196 (39%), Gaps = 27/196 (13%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D+M ++D S S+      +  K+   +K++      V       + VQ G+V FS+  +E
Sbjct: 621 DIMFLVDSSGSIGLE---NFIKMKTFMKNL------VSKSQIGADRVQIGVVQFSDVNKE 671

Query: 233 FFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKI 290
            F L      + +   I  ++  G +T +   L +        +G R        N ++ 
Sbjct: 672 EFQLNRYMSQNEISNAIDRMTHIGETTLTGSALTFVSQYFSPAKGAR-------PNVRRF 724

Query: 291 IVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVEN 350
           ++ +TDGE                 ++ G I+Y++G+      +       P   + VEN
Sbjct: 725 LILITDGE-----AQDIVKDPAVALRQEGIIIYSVGVFGSNVTQLEEISGRPEMVFYVEN 779

Query: 351 PHSMYDAFSHIGKDIV 366
               +D   HI  D+V
Sbjct: 780 ----FDILQHIEDDLV 791



 Score = 79.0 bits (193), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 35/223 (15%), Positives = 77/223 (34%), Gaps = 26/223 (11%)

Query: 153 HIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLI 212
            +    T ++K         D+ +++D S S      +  T        ++ ++    + 
Sbjct: 415 SVFSERTETLKSGCVDTEEADIYLLIDGSGS------TQATDFHEMKTFLSEVVGMFNIA 468

Query: 213 PDVNNVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQI 270
           P     V+ G V +++  +  F +        L + I+ + + G +TN+   L       
Sbjct: 469 P---QKVRVGAVQYADSWDLEFEINKYTNKHDLGKAIENIRQMGGNTNTGAALN------ 519

Query: 271 FDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI 330
           F +  +++            +V +T+G           L   N  ++    VYAIG++  
Sbjct: 520 FTLGLLQKAKKQRGNRVPCHLVVLTNG-----MSKDSILEPANRLREELIRVYAIGVKEA 574

Query: 331 RSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
              +           Y V +    +DA   I   +V +    +
Sbjct: 575 NQTQLREIAGEEKRVYYVHD----FDALKDIRNQVVQEICAEE 613



 Score = 77.9 bits (190), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 35/214 (16%), Positives = 82/214 (38%), Gaps = 22/214 (10%)

Query: 154  IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
            +   + +S KV+     ++D++ ++D S S+         K+   + S+      V+   
Sbjct: 981  VSASVCNSSKVD-CEIEKVDLVFLMDGSNSIH---PDDFRKMKEFLASV------VQDFD 1030

Query: 214  DVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIF 271
               N V+ G   FS+     F L    G   +  +I+ + +    T+    L+   +   
Sbjct: 1031 VSVNRVRIGAAQFSHTYRPEFPLGTFVGKKEISFQIENIQQIFGYTHIGAALRQVGHYFR 1090

Query: 272  DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR 331
               G R +  T      ++++ +TDG+        +      + + +G  +Y++GI  + 
Sbjct: 1091 PDMGSRINAGTP-----QVLLVLTDGQ-----SQDEVARAAEDLRHKGVDIYSVGIGDVD 1140

Query: 332  SHEFLRACASPNSFYLVENPHSMYDAFSHIGKDI 365
              + ++   +      V N   +      I ++I
Sbjct: 1141 DQQLIQITGTAGKKLTVHNFDELTKVKKRIVRNI 1174



 Score = 60.9 bits (146), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 35/204 (17%), Positives = 72/204 (35%), Gaps = 26/204 (12%)

Query: 162 VKVNSQTDARL-DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQ 220
           + V       + D++ +LDVS       + S    +   + +    E V  +    + ++
Sbjct: 216 ILVEVCQGPSVADVVFLLDVS------VNGSQENFEYLKEFLE---ESVSALDIKEHCMR 266

Query: 221 SGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQ 278
            GLVT+SN+ +    L  GV  S + + I+ LS +     +   ++    ++F     R 
Sbjct: 267 VGLVTYSNETKVINSLSRGVNKSEVLQNIQNLSPWSGKAYTGAAIRKIRKEVFS---ARN 323

Query: 279 HCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRA 338
                     +I V +T         +          ++ G  ++ +GI      +  + 
Sbjct: 324 GSRKN-QGVPQIAVLVT-----HRPSEDNVTKAAVNLRREGVTIFTMGIEGASDSQLEKI 377

Query: 339 CASPNSFYLVENPHSMYDAFSHIG 362
            + P      E   S    FS + 
Sbjct: 378 ASHP-----AEQHVSKLKTFSDLA 396



 Score = 54.0 bits (128), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 35/203 (17%), Positives = 74/203 (36%), Gaps = 23/203 (11%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D++ ++D S       D   TK    +K+   +   V  +P   +  +  +  +S+++  
Sbjct: 26  DVVFLVDSS-------DHLGTKSFPLVKAF--IHRMVSSLPIEAHKYRVAVAQYSDRLHS 76

Query: 233 FFLLEWGVSH---LQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
            F L    S    L    K L   G S  +   L+ A+   F      +        +  
Sbjct: 77  EFQLGTFKSRNPMLNHLKKNLGFLGGSLRTGHALREAHRTYFSAPAGGRDKK----QFPP 132

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVE 349
           I+V +      S + +          ++ G  + ++G++     E L+A A+    + + 
Sbjct: 133 ILVVL-----ASAQSEDDVEEASKALREDGVRIVSVGLQSASEEE-LKAMATAQFHFNLR 186

Query: 350 NPHSMYDAFSHIGKDIVTKRIWY 372
           +   +  AFS     I+ +   Y
Sbjct: 187 SARDL-GAFSQNMTQIIKEATQY 208


>gi|147901111|ref|NP_001079801.1| matrilin 1, cartilage matrix protein [Xenopus laevis]
 gi|32450626|gb|AAH54272.1| MGC64509 protein [Xenopus laevis]
          Length = 490

 Score = 89.4 bits (220), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 36/203 (17%), Positives = 84/203 (41%), Gaps = 20/203 (9%)

Query: 161 SVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQ 220
           + K  +      D++ ++D SRS+        ++ + A   ++ ++E + +     N  +
Sbjct: 26  AQKGPNCRTRPTDILFIIDSSRSVRP------SEFEQAKVFLSQVIESLDV---GANATR 76

Query: 221 SGLVTFSNKIEEFFLLEWGVSH--LQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQ 278
            GLV +++ ++  F L+   +   L + +K +      T +   ++YA N  F       
Sbjct: 77  VGLVNYASTVKNEFSLKTHKAKPALLQAVKKVQPLSTGTMTGLAIQYAMNNAFTESE--- 133

Query: 279 HCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRA 338
               +     K+ + +TDG    T +D  +      A++ G  +YAIG+  +  +   + 
Sbjct: 134 GARIKSPGINKVAIVVTDGRPQDTVKDISAR-----ARESGLEIYAIGVGRVDKNTLRQI 188

Query: 339 CASP-NSFYLVENPHSMYDAFSH 360
            + P +        +S+ +  S 
Sbjct: 189 ASEPLDEHVDYVESYSLIEKLSK 211



 Score = 87.1 bits (214), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 61/399 (15%), Positives = 132/399 (33%), Gaps = 58/399 (14%)

Query: 6   LNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLV-HAATQ 64
           + + N+    K   ++ T    P +   +  +  +S        +   ++ +       +
Sbjct: 77  VGLVNYASTVKNEFSLKTHKAKPALLQAVKKVQPLSTGTMTGLAIQYAMNNAFTESEGAR 136

Query: 65  IMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQN 124
           I + G       +  G     +K+    +  + L    +   +  + ++T   I   P +
Sbjct: 137 IKSPGINKVAIVVTDGRPQDTVKDISARARESGLE--IYAIGVGRVDKNTLRQIASEPLD 194

Query: 125 E------GYSISAISRYKIPLKFCTFIPWYTNSRH----IVMPITSSVKVNSQTDARL-- 172
           E       YS+      K    FC      +   H    I +    S     +    L  
Sbjct: 195 EHVDYVESYSLIEKLSKKFQEAFCVTADLCSTGDHDCEQICVSTPGSYTCACRDGFTLNE 254

Query: 173 -------------DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
                        D++ ++D S+S+           ++  + IN +++ + +        
Sbjct: 255 DGKTCNACGASAVDLVFLIDGSKSVRP------ENFELVKQFINQIVDSMDVGE---RRA 305

Query: 220 QSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
             GLV +S+ + + F L        ++  +K +S     T +   L+Y  +  F +    
Sbjct: 306 HVGLVQYSSSVRQEFPLGRYSSKKDIKSAVKKMSYMEKGTMTGQALQYLVDNSFAIS--- 362

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
              +       K+ +  TDG +     D  +      AK+ G  ++A+G+      E   
Sbjct: 363 ---SGGRPAVPKVGIVFTDGRSQDYINDAAAR-----AKELGYKMFAVGVGNAVEEELRM 414

Query: 338 ACASPN---SFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
             + P    SFY  +     + A   IGK +  K    +
Sbjct: 415 IASEPQAEHSFYTAD-----FKAMKEIGKKLQMKICVEE 448


>gi|118088945|ref|XP_419902.2| PREDICTED: similar to collagen XXI [Gallus gallus]
          Length = 964

 Score = 89.4 bits (220), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 39/223 (17%), Positives = 84/223 (37%), Gaps = 28/223 (12%)

Query: 154 IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
            +  +  S   +    A  D++ +LD S S+           ++    +  +     + P
Sbjct: 25  FISFLKMSKVADGCRTAPADLVFILDGSYSVGP------ENFEIIKSWLVNITRNFDIGP 78

Query: 214 DVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIF 271
                +Q G+V +S+       L       +L ++++ +   G +T +   +++AY+ +F
Sbjct: 79  ---KFIQVGVVQYSDYPVLEIPLGTHESTENLIKEMESIHYLGGNTKTGRAIQFAYDHLF 135

Query: 272 DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR 331
                            KI V +TDG     K   +      EA+K    ++AIG+    
Sbjct: 136 ---------AKSSRFLTKIAVVLTDG-----KSQDEVKDVAAEARKNKITLFAIGVGSEI 181

Query: 332 SHEFLRACA---SPNSFYLVENPHSMYDAFSHIGKDIVTKRIW 371
             + L+A A   S    + VE+  ++      I + +  + + 
Sbjct: 182 EEDELKAIANKPSSTYVFYVEDYIAISRIKEVIKQKLCEESVC 224


>gi|332817903|ref|XP_003310057.1| PREDICTED: collagen alpha-6(VI) chain [Pan troglodytes]
          Length = 2263

 Score = 89.1 bits (219), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 43/204 (21%), Positives = 81/204 (39%), Gaps = 27/204 (13%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
            +  D + D+M ++D S S+      + +K+   +K++      V       + VQ G+V
Sbjct: 614 EACKDMKADIMFLVDSSGSIGPE---NFSKMKTFMKNL------VSKSQIGPDRVQIGVV 664

Query: 225 TFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS+  +E F L   +S   +   I  ++  G +T +   L +        +G R     
Sbjct: 665 QFSDINKEEFQLNRFMSQSDISNAIDQMAHIGQTTLTGSALSFVSQYFSPTKGARP---- 720

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
              N +K ++ +TDGE                 ++ G I+Y++G+      +       P
Sbjct: 721 ---NIRKFLILITDGE-----AQDIVKEPAVVLRQEGVIIYSVGVFGSNVTQLEEISGRP 772

Query: 343 NSFYLVENPHSMYDAFSHIGKDIV 366
              + VEN    +D    I  D+V
Sbjct: 773 EMVFYVEN----FDILQRIEDDLV 792



 Score = 86.0 bits (211), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 56/356 (15%), Positives = 119/356 (33%), Gaps = 40/356 (11%)

Query: 34  LGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIK------ 87
           L M I  S +      L     ++   AA + + +   + R   +    + +I       
Sbjct: 283 LSMGINKSEVLQHIQNLSPRTGKAYTGAAIKKLRKEVFSARNGSRKNQGVPQIAVLVTHR 342

Query: 88  ---NTWNMSFRNELRDNGFVNDID-DIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCT 143
              +    +  N  R+   +  +  +    T L+ +     E Y     +   +     T
Sbjct: 343 DSEDNVTKAAVNLRREGVTIFTLGIEGASDTQLEKIASHPAEQYVSKLKTFADLAAHNQT 402

Query: 144 FIPWYTNSRHIVMPI----TSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAI 199
           F+    N     + +    T ++K         D+ +++D S S      +  T      
Sbjct: 403 FLKKLRNQITHTVSVFSERTETLKSGCVDTEEADIYLLIDGSGS------TQATDFHEMK 456

Query: 200 KSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVST 257
             ++ ++    + P     V+ G V +++  +  F +        L + I+ + + G +T
Sbjct: 457 TFLSEVVGMFNIAPHK---VRVGAVQYADSWDLEFEINKYSNKQDLGKAIENIRQMGGNT 513

Query: 258 NSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKK 317
           N+   L +  + +   +  +Q  N         +V +T+G           L   N  ++
Sbjct: 514 NTGAALNFTLSLL--QKAKKQRGNK----VPCHLVVLTNG-----MSKDSILEPANRLRE 562

Query: 318 RGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
               VYAIGI+     +           Y V N    +DA   I   +V +    +
Sbjct: 563 EHIRVYAIGIKEANQTQLREIAGEEKRVYYVHN----FDALKDIRNQVVQEICTEE 614



 Score = 84.1 bits (206), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 37/192 (19%), Positives = 76/192 (39%), Gaps = 19/192 (9%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ V+D S S+         + ++       M+  VK      N V+ G + +++  E
Sbjct: 808 LDVVFVIDSSGSI------DYDEYNIMKDF---MIGLVKKADVGKNQVRFGALKYADDPE 858

Query: 232 EFFLLEWGVSHLQ--RKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
             F L+   + L+    ++     G ST +   L   ++     +      N       +
Sbjct: 859 VLFYLDDFGTKLEVISVLQNDQAMGGSTYTAEAL--GFSDHMFTEARGSRLNKG---VPQ 913

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVE 349
           +++ +TDGE+    +  +        + +G +V A+GI      E L    S + ++ VE
Sbjct: 914 VLIVITDGES---HDADKLNATAKALRDKGILVLAVGIDGANPMELLAMAGSSDKYFFVE 970

Query: 350 NPHSMYDAFSHI 361
               +   FS +
Sbjct: 971 TFGGLKGIFSDV 982



 Score = 79.8 bits (195), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 36/214 (16%), Positives = 83/214 (38%), Gaps = 22/214 (10%)

Query: 154  IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
            +   + +S KV+ + D  +D++ ++D S S++        K+   + S+      V+   
Sbjct: 982  VTASVCNSSKVDCEIDK-VDLVFLMDGSTSIQPN---DFKKMKEFLASV------VQDFD 1031

Query: 214  DVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIF 271
               N V+ G   FS+     F L    G   +  +I+ + +   +T+    L+   +   
Sbjct: 1032 VSLNRVRIGAAQFSDTYHPEFPLGTFIGEKEISFQIENIKQIFGNTHIGAALREVEHYFR 1091

Query: 272  DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR 331
               G R      +    ++++ +TDG+        +        + RG  +Y++GI  + 
Sbjct: 1092 PDMGSRI-----NTGTPQVLLVLTDGQ-----SQDEVAQAAEALRHRGIDIYSVGIGDVD 1141

Query: 332  SHEFLRACASPNSFYLVENPHSMYDAFSHIGKDI 365
              + ++   +      V N   +      I ++I
Sbjct: 1142 DQQLIQITGTAEKKLTVHNFDELKKVNKRIVRNI 1175



 Score = 60.2 bits (144), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 39/249 (15%), Positives = 81/249 (32%), Gaps = 31/249 (12%)

Query: 111 VRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVK------- 163
                +  V V +    ++ A++  +      T       S+++   I    K       
Sbjct: 156 KDGVKIISVGVQKASEENLKAMATSQFHFNLRTVRDLSMFSQNMTHIIKDVTKYKEGAVD 215

Query: 164 ---VNSQTDARL-DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
              V +     + D++ +LD+S       + S    D     +    E V  +    N +
Sbjct: 216 DIFVEACQGPSMADVVFLLDMS------INGSEENFDYLKGFLE---ESVSALDIKENCM 266

Query: 220 QSGLVTFSNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + GLV +SN+ +    L  G   S + + I+ LS       +   +K    ++F     R
Sbjct: 267 RVGLVAYSNETKVINSLSMGINKSEVLQHIQNLSPRTGKAYTGAAIKKLRKEVFS---AR 323

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                      +I V +T         +          ++ G  ++ +GI      +  +
Sbjct: 324 NGSRKN-QGVPQIAVLVT-----HRDSEDNVTKAAVNLRREGVTIFTLGIEGASDTQLEK 377

Query: 338 ACASPNSFY 346
             + P   Y
Sbjct: 378 IASHPAEQY 386



 Score = 53.6 bits (127), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 37/217 (17%), Positives = 75/217 (34%), Gaps = 26/217 (11%)

Query: 158 ITSSVKVNSQTDARL-DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVN 216
           I S + VN  +     D++ ++D S  + S               I  M+  +   P   
Sbjct: 11  ICSHISVNQDSGPEYADVVFLVDSSDRLGS------KSFPFVKMFITKMISSL---PIEA 61

Query: 217 NVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKY-LSKFGVSTNSTPGLKYAYNQIFDM 273
           +  +  L  +S+K+   F L    G S +   ++      G S      L+ A+   F  
Sbjct: 62  DKYRVALAQYSDKLHSEFHLSTFKGRSPMLNHLRKNFGFIGGSLQIGKALQEAHRTYFSA 121

Query: 274 QGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSH 333
               +        +  I+V +      S++ +          +K G  + ++G++     
Sbjct: 122 PTNGRDKK----QFPPILVVL-----ASSESEDDVEEASKALRKDGVKIISVGVQKASEE 172

Query: 334 EFLRACASPNSFYL---VENPHSMYDAFSHIGKDIVT 367
             L+A A+    +    V +        +HI KD+  
Sbjct: 173 N-LKAMATSQFHFNLRTVRDLSMFSQNMTHIIKDVTK 208


>gi|154486447|ref|ZP_02027854.1| hypothetical protein BIFADO_00261 [Bifidobacterium adolescentis
           L2-32]
 gi|154084310|gb|EDN83355.1| hypothetical protein BIFADO_00261 [Bifidobacterium adolescentis
           L2-32]
          Length = 882

 Score = 89.1 bits (219), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 52/290 (17%), Positives = 96/290 (33%), Gaps = 65/290 (22%)

Query: 130 SAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNS-QTDARLDMMIVLDVSRSMESFF 188
              S+   P K          S  + + +  +V   +  T   +D  +VLDVS SM+   
Sbjct: 148 ETGSQLGAPEKHKRIKKNDNGSYTVNVDVKGAVNSTTVTTTQPIDFTLVLDVSGSMDDPM 207

Query: 189 DS--SITKIDMAIKSINAMLEEV----------------------KLIPDVNNVVQSGLV 224
                  ++D   +++ A L+E                       K     +++ +SG  
Sbjct: 208 SKTDRTRRLDALKEAVKAFLDEAANTNTEAGSELVHVGLVKFAGDKTDKIGDDMYRSGGY 267

Query: 225 TFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
           T++   +    L   ++ L+ K+  L   G  T +  G   A   +           +  
Sbjct: 268 TYN-YSQIVSNLTADMNGLKNKVSKLKAAGA-TRADNGFNRAVKVM--------GSASAR 317

Query: 285 ANYKKIIVFMTDGENLSTKE-----DQQSLYYCNEAKKRGAIVYAIGIRV--------IR 331
            + KK+++F  DG   S+         +++    E K  GA VY+IGI            
Sbjct: 318 TDAKKVVIFFADGSPTSSSGFEGKVANKAVEAAKELKDGGAAVYSIGIFASANPSSLSSN 377

Query: 332 SHEFLRACAS-----------------PNSFYLVENPHSMYDAFSHIGKD 364
            ++F+ A +S                    +    N   +   F  I K 
Sbjct: 378 ENQFMHAVSSNFPKATKYNQLGEGNIEAGYYKSATNASELNTIFDEIEKS 427


>gi|126153367|gb|AAI31711.1| MATN1 protein [Homo sapiens]
          Length = 480

 Score = 88.7 bits (218), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 35/210 (16%), Positives = 84/210 (40%), Gaps = 21/210 (10%)

Query: 163 KVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSG 222
             +       D++ V+D SRS+         + +     ++ ++E + + P+     + G
Sbjct: 15  SGHLCRTRPTDLVFVVDSSRSVRP------VEFEKVKVFLSQVIESLDVGPNA---TRVG 65

Query: 223 LVTFSNKIEEFFLLEWGVSHLQ--RKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHC 280
           +V +++ +++ F L   VS     + ++ +      T +   +++A  + F   G  +  
Sbjct: 66  MVNYASTVKQEFSLRAHVSKAALLQAVRRIQPLSTGTMTGLAIQFAITKAF---GDAEGG 122

Query: 281 NTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA 340
            +   +  K+++ +TDG    + +D  +      A+  G  ++AIG+  +     LR  A
Sbjct: 123 RSRSPDISKVVIVVTDGRPQDSVQDVSAR-----ARASGVELFAIGVGSVD-KATLRQIA 176

Query: 341 SPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           S      V+   S Y     + +       
Sbjct: 177 SEPQDEHVDYVES-YSVIEKLSRKFQEAFC 205



 Score = 82.5 bits (202), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 39/220 (17%), Positives = 83/220 (37%), Gaps = 30/220 (13%)

Query: 159 TSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNV 218
           T +V       +  D++ ++D S+S+           ++  K I+ +++ + +      +
Sbjct: 245 TCNVCSGGGGSSATDLVFLIDGSKSVRP------ENFELVKKFISQIVDTLDVSD---KL 295

Query: 219 VQSGLVTFSNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAY-NQIFDMQG 275
            Q GLV +S+ + + F L        ++  ++ +S     T +   LKY   N      G
Sbjct: 296 AQVGLVQYSSSVRQEFPLGRFHTKKDIKAAVRNMSYMEKGTMTGAALKYLIDNSFTVSSG 355

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF 335
            R          +K+ +  TDG +     D        +AK  G  ++A+G+      E 
Sbjct: 356 ARPGA-------QKVGIVFTDGRSQDYINDA-----AKKAKDLGFKMFAVGVGNAVEDEL 403

Query: 336 LRACASP--NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
               + P    ++   +    +   + IGK +  K    +
Sbjct: 404 REIASEPVAEHYFYTAD----FKTINQIGKKLQKKICVEE 439


>gi|332254526|ref|XP_003276380.1| PREDICTED: cartilage matrix protein [Nomascus leucogenys]
          Length = 496

 Score = 88.7 bits (218), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 33/210 (15%), Positives = 82/210 (39%), Gaps = 21/210 (10%)

Query: 163 KVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSG 222
             +       D++ V+D SRS+         + +     ++ +++ + + P+     + G
Sbjct: 31  TGHLCRTRPTDLVFVVDSSRSVRP------VEFEKVKVFLSQVIQSLDVGPNA---TRVG 81

Query: 223 LVTFSNKIEEFFLLEWGVSHLQ--RKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHC 280
           +V +++ +++ F L   VS     + ++ +      T +   +++A  + F      +  
Sbjct: 82  MVNYASTVKQEFSLRAHVSKAALLQAVRRIQPLSTGTMTGLAIQFAITKAFSDAEGGRSR 141

Query: 281 NTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA 340
                +  K+++ +TDG    + +D  +      A+  G  ++AIG+  +     LR  A
Sbjct: 142 ---SPDISKVVIVVTDGRPQDSVQDVSAR-----ARASGVELFAIGVGRVD-KATLRQIA 192

Query: 341 SPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           S      V+   S Y     + +       
Sbjct: 193 SEPQDEHVDYVES-YSVIEKLSRKFQEAFC 221



 Score = 82.9 bits (203), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 40/220 (18%), Positives = 83/220 (37%), Gaps = 30/220 (13%)

Query: 159 TSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNV 218
           T +V       +  D++ ++D S+S+           ++  K IN +++ + +      +
Sbjct: 261 TCNVCSGGGGSSATDLVFLIDGSKSVRP------ENFELVKKFINQIVDTLDVSD---KL 311

Query: 219 VQSGLVTFSNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAY-NQIFDMQG 275
            Q GLV +S+ + + F L        ++  ++ +S     T +   LKY   N      G
Sbjct: 312 AQVGLVQYSSSVRQEFPLGRFHTKKDIKAAVRNMSYMEKGTMTGAALKYLIDNSFTVSSG 371

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF 335
            R          +K+ +  TDG +     D        +AK  G  ++A+G+      E 
Sbjct: 372 ARPGA-------QKVGIVFTDGRSQDYINDA-----AKKAKDLGFKMFAVGVGNAVEDEL 419

Query: 336 LRACASP--NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
               + P    ++   +    +   + IGK +  K    +
Sbjct: 420 REIASEPVAEHYFYTAD----FKTINQIGKKLQKKICVEE 455


>gi|225028486|ref|ZP_03717678.1| hypothetical protein EUBHAL_02763 [Eubacterium hallii DSM 3353]
 gi|224954191|gb|EEG35400.1| hypothetical protein EUBHAL_02763 [Eubacterium hallii DSM 3353]
          Length = 538

 Score = 88.7 bits (218), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 50/276 (18%), Positives = 97/276 (35%), Gaps = 34/276 (12%)

Query: 105 NDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKV 164
           N+ D+        +      +  +    +       F            +       +KV
Sbjct: 163 NEPDNTFSDYGYYVRFNENAKDGTWKVDTFSGGETNFNNVFLCEWGDYSVTG--NDGLKV 220

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
            S+     D+++ LD+S SM+         +D   K+    ++ +     +N     GLV
Sbjct: 221 TSKKR---DIVLTLDISASMDGIP------LDETKKAAAKFVDSI-----LNKNSNIGLV 266

Query: 225 TFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
           ++S++      +      L+  I  LS    +TN   GL  AY+ +              
Sbjct: 267 SYSDEATSLSGICSNDVFLKNTITSLSS-AENTNIEDGLSRAYSML-----------QLG 314

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGI------RVIRSHEFLRA 338
            + KK+IV M+DG     K+ ++ + Y  + K +G ++Y +G               +  
Sbjct: 315 QSKKKLIVLMSDGLPTLGKDGEELIKYAEKIKDQGVLIYTLGFFQNTEEYKAEGQYLMEK 374

Query: 339 CASPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYDK 374
            AS    Y V +   +   F  +   I  ++  Y K
Sbjct: 375 IASEGCHYEVSSSEDLVFFFEDVAGQIGGQKYIYVK 410


>gi|953237|gb|AAA99719.1| collagen type XII alpha-1 precursor [Mus musculus]
          Length = 3067

 Score = 88.7 bits (218), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 56/267 (20%), Positives = 109/267 (40%), Gaps = 33/267 (12%)

Query: 111 VRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDA 170
            ++T+L++  +  +  Y IS  +   +     T +   T  +   M +   V+ +   D 
Sbjct: 384 PQTTTLNVRDLTADTEYQISVFAMKGLTSSEPTSVMEKTQPKTQPMKV--QVECSRGVDI 441

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
           + D++ ++D S S+ +   ++  K+   ++ +       K      N VQ  LV +S   
Sbjct: 442 KADIVFLVDGSYSIGT---ANFVKVRAFLEVL------AKSFEISPNRVQISLVQYSRDP 492

Query: 231 EEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
              F L+    V  + + I      G STN+   + Y   +IF             +N  
Sbjct: 493 HTEFTLKEFNRVEDIIKAINTFPYRGGSTNTGKAMTYVREKIFVPN------KGSRSNVP 546

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NSF 345
           K+++ +TDGE+     D        + +     ++A+G++     E L A ASP      
Sbjct: 547 KVMILITDGESSDAFRD-----PAIKLRNSDVEIFAVGVKDAVRSE-LEAIASPPAETHV 600

Query: 346 YLVENPHSMYDAFSHIGKDIVTKRIWY 372
           + VE+    +DAF  I   ++T+ I  
Sbjct: 601 FTVED----FDAFQRIS-FVLTQSICL 622



 Score = 86.4 bits (212), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 42/279 (15%), Positives = 97/279 (34%), Gaps = 34/279 (12%)

Query: 101 NGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIP--LKFCTFIPWYTNSRHIVMPI 158
           +G   +      +T   +  +     Y ++  S  ++   +     +   T         
Sbjct: 64  DGPTKEFTLAASTTETLLSDLIPETQYVVTITSYNEVEESVPVIGQLTIQTGGPTKPGEK 123

Query: 159 -TSSVKVNSQTDAR-LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVN 216
                ++   + +   D++ ++D S S+                 ++ ++  V       
Sbjct: 124 KPGKTEIQKCSVSAWTDLVFLVDGSWSVGRNN---------FKYILDFIVALVSAFDIGE 174

Query: 217 NVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKY-AYNQIFDM 273
              + G+V +S+     F L   +    L   +K +   G +T +   + Y   N   + 
Sbjct: 175 EKTRVGVVQYSSDTRTEFNLNQYYRREDLLAAVKKIPYKGGNTMTGDAIDYLVKNTFTES 234

Query: 274 QGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSH 333
            G R         + K+ + +TDG     K   +      E +  G  V+++GI+   + 
Sbjct: 235 AGSRAG-------FPKVGIIITDG-----KSQDEVEIPARELRNIGVEVFSLGIKAADAK 282

Query: 334 EFLRACASP--NSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           E  +  ++P  N  + V N    +DA   I  +I+++  
Sbjct: 283 ELKQIASTPSLNHVFNVAN----FDAIVDIQNEIISQVC 317



 Score = 60.6 bits (145), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 43/251 (17%), Positives = 83/251 (33%), Gaps = 28/251 (11%)

Query: 124  NEGYSISAISRYK--IPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVS 181
               Y ++    +     L          +   +   ++S +   ++ +A  D+++++D S
Sbjct: 1154 GTTYRVNVFGMFDGGESLPLVGQEMTTLSDTTVTPFLSSGMDCLTRAEA--DIVLLVDGS 1211

Query: 182  RSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLE--WG 239
             S+                 I+ ++E  ++ P     VQ  L  +S      + L     
Sbjct: 1212 WSIG------RANFRTVRSFISRIVEVFEIGP---KRVQIALAQYSGDPRTEWQLNAHRD 1262

Query: 240  VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGEN 299
               L + +  L   G +T +   L +   Q F  Q             +KI V +TDG  
Sbjct: 1263 KKSLLQAVANLPNKGGNTLTGMALNFIRQQSFKTQ------AGMRPRARKIGVLITDG-- 1314

Query: 300  LSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFS 359
               K          + K  G  ++AIGI+     E       P+      N    +++ S
Sbjct: 1315 ---KSQDDVEAPSKKLKDEGVELFAIGIKNADEVELKMIATDPDDT-HAYNVAD-FESLS 1369

Query: 360  HIGKDIVTKRI 370
             I  D+     
Sbjct: 1370 KIVDDLTINLC 1380


>gi|149694147|ref|XP_001503972.1| PREDICTED: similar to Cartilage matrix protein precursor
           (Matrilin-1) [Equus caballus]
          Length = 495

 Score = 88.7 bits (218), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 34/210 (16%), Positives = 80/210 (38%), Gaps = 21/210 (10%)

Query: 163 KVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSG 222
           + +       D++ V+D SRS+         + +     ++ ++E + + P+     + G
Sbjct: 30  RGHLCRTRPTDLVFVVDSSRSVRP------VEFEKVKVFLSQVIESLDVGPNA---TRVG 80

Query: 223 LVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHC 280
           LV +++ +++ F L      + L + ++ +      T +   +++A  + F         
Sbjct: 81  LVNYASAVKQEFPLRAHGSKAALLQAVRRIQPLSTGTMTGLAIQFAITRAFSEGE---GG 137

Query: 281 NTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA 340
                +  K+++ +TDG    +  D  +       +  G  ++AIG+  +     LR  A
Sbjct: 138 RARSPDISKVVIVVTDGRPQDSVRDVSARS-----RASGIELFAIGVGRVD-KATLREIA 191

Query: 341 SPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           S      V+   S Y     + K       
Sbjct: 192 SEPQDEHVDYVES-YSVIEKLSKKFQEAFC 220



 Score = 83.7 bits (205), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 40/220 (18%), Positives = 83/220 (37%), Gaps = 30/220 (13%)

Query: 159 TSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNV 218
           T +V       +  D++ ++D S+S+           ++  K IN +++ + +      +
Sbjct: 260 TCNVCSGGGGSSATDLVFLIDGSKSVRP------ENFELVKKFINQIVDTLDVSD---KL 310

Query: 219 VQSGLVTFSNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAY-NQIFDMQG 275
            Q GLV +S+ + + F L        ++  ++ +S     T +   LKY   N      G
Sbjct: 311 AQVGLVQYSSSVRQEFPLGRFHTKKDIKAAVRNMSYMEKGTMTGAALKYLIDNSFTVSSG 370

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF 335
            R          +K+ +  TDG +     D        +AK  G  ++A+G+      E 
Sbjct: 371 ARPGA-------QKVGIVFTDGRSQDYINDA-----AKKAKDLGFKMFAVGVGNAVEDEL 418

Query: 336 LRACASP--NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
               + P    ++   +    +   + IGK +  K    +
Sbjct: 419 REIASEPVAEHYFYTAD----FKTINQIGKKLQKKICVEE 454


>gi|327286711|ref|XP_003228073.1| PREDICTED: cartilage matrix protein-like [Anolis carolinensis]
          Length = 565

 Score = 88.7 bits (218), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 34/202 (16%), Positives = 78/202 (38%), Gaps = 26/202 (12%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
                 D++ ++D SRS+         + +     ++ ++E + + P+     + G+V +
Sbjct: 106 CRTRPTDLVFLIDSSRSVRPN------EFEQVKVFLSQVIESLDVGPNA---TRVGVVNY 156

Query: 227 SNKIEEFFLLEWGVSHLQ--RKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
           ++ ++  F L+   +     + ++ +      T +   +++A N+ F             
Sbjct: 157 ASAVKSEFSLKTHRTKASLLQAVRRIEPLSTGTMTGLAIQFAINRAFSEGE---GARVRV 213

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP-- 342
               K+ + +TDG      +D  +      A+  G  ++AIG+  +  H  LR  ASP  
Sbjct: 214 PEINKVAIIVTDGRPQDAVKDVAAR-----ARALGIEIFAIGVGRVDMHT-LRLIASPPL 267

Query: 343 -NSFYLVEN---PHSMYDAFSH 360
                 VE+      +   F  
Sbjct: 268 EEHVDYVESYSVIEKLTKKFQE 289



 Score = 84.4 bits (207), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 36/209 (17%), Positives = 81/209 (38%), Gaps = 28/209 (13%)

Query: 169 DARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
            A  D++ ++D S+S+           ++  K IN +++ + +     +V   GLV +S+
Sbjct: 339 GAPTDLVFLIDGSKSVRP------ENFELVKKFINQIVDSLDVSDRNAHV---GLVQYSS 389

Query: 229 KIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
            + + F L        ++  ++ +S     T +   L+Y  +  F +       +     
Sbjct: 390 SVRQEFPLGQYKDKKDIKAAVRRMSYMEKGTMTGQALQYLVDSSFAIS------SGARPG 443

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP--NS 344
             K+ +  TDG +     D        +AK+ G  ++A+G+      E     + P    
Sbjct: 444 VPKVAIVFTDGRSQDYINDS-----AKKAKELGYKMFAVGVGNAVEDELKEIASEPVAEH 498

Query: 345 FYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
           ++   +  ++      IGK +  K    +
Sbjct: 499 YFYTADFRTINQ----IGKKLQNKICVEE 523


>gi|306824220|ref|ZP_07457590.1| conserved hypothetical protein [Bifidobacterium dentium ATCC 27679]
 gi|309801684|ref|ZP_07695804.1| von Willebrand factor type A domain protein [Bifidobacterium
           dentium JCVIHMP022]
 gi|304552423|gb|EFM40340.1| conserved hypothetical protein [Bifidobacterium dentium ATCC 27679]
 gi|308221626|gb|EFO77918.1| von Willebrand factor type A domain protein [Bifidobacterium
           dentium JCVIHMP022]
          Length = 967

 Score = 88.7 bits (218), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 63/298 (21%), Positives = 102/298 (34%), Gaps = 63/298 (21%)

Query: 130 SAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDA-RLDMMIVLDVSRSMESFF 188
           SA +    P    +       +  + + +T      S TD   +D+ +VLDVS SM   F
Sbjct: 201 SASAGLSTPEHTKSIEYQGNGAYTLKLDVTGKDASTSTTDTTPIDIALVLDVSGSMNDDF 260

Query: 189 D--SSITKIDMAIKSINAMLEEV----KLIPDVNNVVQSGLVTFSNKIEEFF-------- 234
               S +KI     ++N+ L+E       I D NN V+  LV ++N+I            
Sbjct: 261 GGRGSPSKISALKTAVNSFLDETAKTNDTIEDDNNKVKVALVKYANQIGTATGADGCRIS 320

Query: 235 -LLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQI---------FDMQGMRQHCNTED 284
              +    +  + ++ L      T     LK + N +           M+  +Q      
Sbjct: 321 NSRQSDTGNCTQIVQEL------TTDAGLLKTSVNGLQAAGATYADAAMEVAQQALAGGR 374

Query: 285 ANYKKIIVFMTDGENLSTKE-----DQQSLYYCNEAKKRGAIVYAIGI------------ 327
           A  KK ++F TDGE              ++    E K  G  VY+IGI            
Sbjct: 375 AGAKKYVIFFTDGEPNHWSGFDDDVANAAIKKSQELKNAGTTVYSIGIFDGANPSASVSS 434

Query: 328 ---------------RVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
                               +  L   AS + +Y   +   +   F+ I K I  K +
Sbjct: 435 ASNANKFMHGISSNYPNATGYRSLGDRASGDYYYSASSATQLAQIFNDIQKTITEKHV 492


>gi|109071570|ref|XP_001110086.1| PREDICTED: collagen alpha-1(XXI) chain-like isoform 2 [Macaca
           mulatta]
          Length = 959

 Score = 88.7 bits (218), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 39/212 (18%), Positives = 77/212 (36%), Gaps = 28/212 (13%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           +S   A  D++ +LD S S+           ++  K +  + +   + P     +Q G+V
Sbjct: 29  SSCRTAPTDLVFILDGSYSVGP------ENFEIVKKWLVNITKNFDIGP---KFIQVGVV 79

Query: 225 TFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S+       L       HL   ++ +   G +T +   +++A + +F           
Sbjct: 80  QYSDYPVLEIPLGSYDSGEHLTAAVESILYLGGNTRTGKAIQFALDYLF---------AK 130

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA-- 340
                 KI V +TDG     K           A+     ++AIG+        LRA A  
Sbjct: 131 SSRFLTKIAVVLTDG-----KSQDDVKDAAEAARDSKITLFAIGVGSETEDAELRAIANK 185

Query: 341 -SPNSFYLVENPHSMYDAFSHIGKDIVTKRIW 371
            S    + VE+  ++      I + +  + + 
Sbjct: 186 PSSTYVFYVEDYIAISKIREVIKQKLCEESVC 217


>gi|153792263|ref|NP_001093210.1| matrilin 1 [Danio rerio]
 gi|148726249|emb|CAN88321.1| matrilin 1 [Danio rerio]
 gi|148726497|emb|CAN88267.1| matrilin 1 [Danio rerio]
          Length = 489

 Score = 88.7 bits (218), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 31/216 (14%), Positives = 82/216 (37%), Gaps = 27/216 (12%)

Query: 153 HIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLI 212
            + +   +++          D++ ++D SRS+        ++ +     +  +++ + + 
Sbjct: 18  TVDLRQAAAMAAGLCNTKPTDVVFIVDSSRSVRP------SEFEQVKVFLAKVIDGLSVG 71

Query: 213 PDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQ--RKIKYLSKFGVSTNSTPGLKYAYNQI 270
           PD     + G+V ++++++    L+   +     + +  +      T +   +++A N  
Sbjct: 72  PDA---TRVGVVNYASRVKNEVSLKSHKTKAALVKAVSKIEPLSTGTMTGLAIQFAMNVA 128

Query: 271 FDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI 330
           F      +    +  +  K+ + +TDG       D         A++ G  ++AIG+  +
Sbjct: 129 FSEAEGGR----KSPDISKVAIIVTDGRPQDNIRD-----IAARAREAGIEIFAIGVGRV 179

Query: 331 RSHEFLRACAS---PNSFYLVEN---PHSMYDAFSH 360
                LR  AS    +    VE+      +   F  
Sbjct: 180 D-MTTLRQMASEPLEDHVDYVESYSLIEKLTKKFQE 214



 Score = 76.7 bits (187), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 36/213 (16%), Positives = 81/213 (38%), Gaps = 28/213 (13%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           ++ ++A  D++ ++D S+S+           ++  K IN +++++ +     +V   GLV
Sbjct: 260 SACSNAATDVVFLIDGSKSVRP------ENFELVKKWINLIIDKLDVSETNTHV---GLV 310

Query: 225 TFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S+ +++ F L        L+  +K +      T +   L +  +  F           
Sbjct: 311 QYSSTVKQEFPLGRHNSKRSLKEAVKRMDYMERGTMTGHALSFLVDNSFGPNQ------G 364

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                 K+ +  TDG +     D        +AK  G  +YA+G+      E     + P
Sbjct: 365 ARPGVPKVGIVFTDGRSQDYIGDA-----AKKAKALGFKMYAVGVGNAVEDELREIASEP 419

Query: 343 --NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
             + ++   +  +M      I K +       +
Sbjct: 420 IADHYFYTADFKTMNQ----IAKKLQINVCQEE 448


>gi|119628047|gb|EAX07642.1| matrilin 1, cartilage matrix protein, isoform CRA_a [Homo sapiens]
          Length = 496

 Score = 88.3 bits (217), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 35/210 (16%), Positives = 85/210 (40%), Gaps = 21/210 (10%)

Query: 163 KVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSG 222
           + +       D++ V+D SRS+         + +     ++ ++E + + P+     + G
Sbjct: 31  RGHLCRTRPTDLVFVVDSSRSVRP------VEFEKVKVFLSQVIESLDVGPNA---TRVG 81

Query: 223 LVTFSNKIEEFFLLEWGVSHLQ--RKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHC 280
           +V +++ +++ F L   VS     + ++ +      T +   +++A  + F   G  +  
Sbjct: 82  MVNYASTVKQEFSLRAHVSKAALLQAVRRIQPLSTGTMTGLAIQFAITKAF---GDAEGG 138

Query: 281 NTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA 340
            +   +  K+++ +TDG    + +D  +      A+  G  ++AIG+  +     LR  A
Sbjct: 139 RSRSPDISKVVIVVTDGRPQDSVQDVSAR-----ARASGVELFAIGVGSVD-KATLRQIA 192

Query: 341 SPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           S      V+   S Y     + +       
Sbjct: 193 SEPQDEHVDYVES-YSVIEKLSRKFQEAFC 221



 Score = 81.7 bits (200), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 39/220 (17%), Positives = 83/220 (37%), Gaps = 30/220 (13%)

Query: 159 TSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNV 218
           T +V       +  D++ ++D S+S+           ++  K I+ +++ + +      +
Sbjct: 261 TCNVCSGGGGSSATDLVFLIDGSKSVRP------ENFELVKKFISQIVDTLDVSD---KL 311

Query: 219 VQSGLVTFSNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAY-NQIFDMQG 275
            Q GLV +S+ + + F L        ++  ++ +S     T +   LKY   N      G
Sbjct: 312 AQVGLVQYSSSVRQEFPLGRFHTKKDIKAAVRNMSYMEKGTMTGAALKYLIDNSFTVSSG 371

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF 335
            R          +K+ +  TDG +     D        +AK  G  ++A+G+      E 
Sbjct: 372 ARPGA-------QKVGIVFTDGRSQDYINDA-----AKKAKDLGFKMFAVGVGNAVEDEL 419

Query: 336 LRACASP--NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
               + P    ++   +    +   + IGK +  K    +
Sbjct: 420 REIASEPVAEHYFYTAD----FKTINQIGKKLQKKICVEE 455


>gi|4505111|ref|NP_002370.1| cartilage matrix protein precursor [Homo sapiens]
 gi|115556|sp|P21941|MATN1_HUMAN RecName: Full=Cartilage matrix protein; AltName: Full=Matrilin-1;
           Flags: Precursor
 gi|1732121|gb|AAB38702.1| cartilage matrix protein [Homo sapiens]
 gi|56205026|emb|CAI19322.1| matrilin 1, cartilage matrix protein [Homo sapiens]
 gi|182887817|gb|AAI60064.1| Matrilin 1, cartilage matrix protein [synthetic construct]
 gi|189066540|dbj|BAG35790.1| unnamed protein product [Homo sapiens]
          Length = 496

 Score = 88.3 bits (217), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 35/210 (16%), Positives = 85/210 (40%), Gaps = 21/210 (10%)

Query: 163 KVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSG 222
           + +       D++ V+D SRS+         + +     ++ ++E + + P+     + G
Sbjct: 31  RGHLCRTRPTDLVFVVDSSRSVRP------VEFEKVKVFLSQVIESLDVGPNA---TRVG 81

Query: 223 LVTFSNKIEEFFLLEWGVSHLQ--RKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHC 280
           +V +++ +++ F L   VS     + ++ +      T +   +++A  + F   G  +  
Sbjct: 82  MVNYASTVKQEFSLRAHVSKAALLQAVRRIQPLSTGTMTGLAIQFAITKAF---GDAEGG 138

Query: 281 NTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA 340
            +   +  K+++ +TDG    + +D  +      A+  G  ++AIG+  +     LR  A
Sbjct: 139 RSRSPDISKVVIVVTDGRPQDSVQDVSAR-----ARASGVELFAIGVGSVD-KATLRQIA 192

Query: 341 SPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           S      V+   S Y     + +       
Sbjct: 193 SEPQDEHVDYVES-YSVIEKLSRKFQEAFC 221



 Score = 81.7 bits (200), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 39/220 (17%), Positives = 83/220 (37%), Gaps = 30/220 (13%)

Query: 159 TSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNV 218
           T +V       +  D++ ++D S+S+           ++  K I+ +++ + +      +
Sbjct: 261 TCNVCSGGGGSSATDLVFLIDGSKSVRP------ENFELVKKFISQIVDTLDVSD---KL 311

Query: 219 VQSGLVTFSNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAY-NQIFDMQG 275
            Q GLV +S+ + + F L        ++  ++ +S     T +   LKY   N      G
Sbjct: 312 AQVGLVQYSSSVRQEFPLGRFHTKKDIKAAVRNMSYMEKGTMTGAALKYLIDNSFTVSSG 371

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF 335
            R          +K+ +  TDG +     D        +AK  G  ++A+G+      E 
Sbjct: 372 ARPGA-------QKVGIVFTDGRSQDYINDA-----AKKAKDLGFKMFAVGVGNAVEDEL 419

Query: 336 LRACASP--NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
               + P    ++   +    +   + IGK +  K    +
Sbjct: 420 REIASEPVAEHYFYTAD----FKTINQIGKKLQKKICVEE 455


>gi|115555|sp|P05099|MATN1_CHICK RecName: Full=Cartilage matrix protein; AltName: Full=Matrilin-1;
           Flags: Precursor
 gi|833607|emb|CAA30915.1| cartilage matrix protein [Gallus gallus]
          Length = 493

 Score = 88.3 bits (217), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 40/230 (17%), Positives = 86/230 (37%), Gaps = 28/230 (12%)

Query: 148 YTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLE 207
                 +     +    +  + + LD++ ++D S+S+           ++  K IN ++E
Sbjct: 247 CKEGFTLNNDGKTCSACSGGSGSALDLVFLIDGSKSVRP------ENFELVKKFINQIVE 300

Query: 208 EVKLIPDVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKY 265
            +++        Q GLV +S+ + + F L        ++  +K ++     T +   LKY
Sbjct: 301 SLEV---SEKQAQVGLVQYSSSVRQEFPLGQFKNKKDIKAAVKKMAYMEKGTMTGQALKY 357

Query: 266 AYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAI 325
             +  F +       N       K+ +  TDG +     D        +AK  G  ++A+
Sbjct: 358 LVDSSFSI------ANGARPGVPKVGIVFTDGRSQDYITDA-----AKKAKDLGFRMFAV 406

Query: 326 GIRVIRSHEFLRACASP--NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
           G+      E     + P    ++   +    +   S+IGK +  K    +
Sbjct: 407 GVGNAVEDELREIASEPVAEHYFYTAD----FRTISNIGKKLQMKICVEE 452



 Score = 86.0 bits (211), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 29/205 (14%), Positives = 82/205 (40%), Gaps = 24/205 (11%)

Query: 163 KVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSG 222
           +         D++ ++D SRS+         + +     ++ ++E + + P+     + G
Sbjct: 29  RGTLCRTKPTDLVFIIDSSRSVRP------QEFEKVKVFLSRVIEGLDVGPNS---TRVG 79

Query: 223 LVTFSNKIEEFFLLEWGVSHLQ--RKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHC 280
           ++ +++ ++  F L+   +  +  + ++ +      T +   +++A ++ F      +  
Sbjct: 80  VINYASAVKNEFSLKTHQTKAELLQAVQRIEPLSTGTMTGLAIQFAISRAFS---DTEGA 136

Query: 281 NTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA 340
                N  K+ + +TDG      +D  +      A++ G  ++AIG+  +  H   +  +
Sbjct: 137 RLRSPNINKVAIVVTDGRPQDGVQDVSAR-----ARQAGIEIFAIGVGRVDMHTLRQIAS 191

Query: 341 SP--NSFYLVEN---PHSMYDAFSH 360
            P  +    VE+      +   F  
Sbjct: 192 EPLDDHVDYVESYSVIEKLTHKFQE 216


>gi|146325834|sp|Q60847|COCA1_MOUSE RecName: Full=Collagen alpha-1(XII) chain; Flags: Precursor
          Length = 3120

 Score = 88.3 bits (217), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 42/279 (15%), Positives = 97/279 (34%), Gaps = 34/279 (12%)

Query: 101 NGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIP--LKFCTFIPWYTNSRHIVMPI 158
           +G   +      +T   +  +     Y ++  S  ++   +     +   T         
Sbjct: 64  DGPTKEFTLAASTTETLLSDLIPETQYVVTITSYNEVEESVPVIGQLTIQTGGPTKPGEK 123

Query: 159 -TSSVKVNSQTDAR-LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVN 216
                ++   + +   D++ ++D S S+                 ++ ++  V       
Sbjct: 124 KPGKTEIQKCSVSAWTDLVFLVDGSWSVGRNN---------FKYILDFIVALVSAFDIGE 174

Query: 217 NVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKY-AYNQIFDM 273
              + G+V +S+     F L   +    L   +K +   G +T +   + Y   N   + 
Sbjct: 175 EKTRVGVVQYSSDTRTEFNLNQYYRREDLLAAVKKIPYKGGNTMTGDAIDYLVKNTFTES 234

Query: 274 QGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSH 333
            G R         + K+ + +TDG     K   +      E +  G  V+++GI+   + 
Sbjct: 235 AGSRAG-------FPKVAIIITDG-----KSQDEVEIPARELRNIGVEVFSLGIKAADAK 282

Query: 334 EFLRACASP--NSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           E  +  ++P  N  + V N    +DA   I  +I+++  
Sbjct: 283 ELKQIASTPSLNHVFNVAN----FDAIVDIQNEIISQVC 317



 Score = 86.4 bits (212), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 53/267 (19%), Positives = 106/267 (39%), Gaps = 37/267 (13%)

Query: 111 VRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDA 170
            ++T+L++  +  +  Y IS  +   +     T +   T    + +  +  V + +    
Sbjct: 384 PQTTTLNVRDLTADTEYQISVFAMKGLTSSEPTSVMEKTQPMKVQVECSRGVDIKA---- 439

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
             D++ ++D S S+     ++  K+   ++ +       K      N VQ  LV +S   
Sbjct: 440 --DIVFLVDGSYSIG---IANFVKVRAFLEVL------AKSFEISPNRVQISLVQYSRDP 488

Query: 231 EEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
              F L+    V  + + I      G STN+   + Y   +IF             +N  
Sbjct: 489 HTEFTLKEFNRVEDIIKAINTFPYRGGSTNTGKAMTYVREKIFVPN------KGSRSNVP 542

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NSF 345
           K+++ +TDG++     D        + +     ++A+G++     E L A ASP      
Sbjct: 543 KVMILITDGKSSDAFRD-----PAIKLRNSDVEIFAVGVKDAVRSE-LEAIASPPAETHV 596

Query: 346 YLVENPHSMYDAFSHIGKDIVTKRIWY 372
           + VE+    +DAF  I  ++ T+ I  
Sbjct: 597 FTVED----FDAFQRISFEL-TQSICL 618



 Score = 61.3 bits (147), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 43/251 (17%), Positives = 83/251 (33%), Gaps = 28/251 (11%)

Query: 124  NEGYSISAISRYK--IPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVS 181
               Y ++    +     L          +   +   ++S +   ++ +A  D+++++D S
Sbjct: 1150 GTTYRVNVFGMFDGGESLPLVGQEMTTLSDTTVTPFLSSGMDCLTRAEA--DIVLLVDGS 1207

Query: 182  RSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLE--WG 239
             S+                 I+ ++E  ++ P     VQ  L  +S      + L     
Sbjct: 1208 WSIG------RANFRTVRSFISRIVEVFEIGP---KRVQIALAQYSGDPRTEWQLNAHRD 1258

Query: 240  VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGEN 299
               L + +  L   G +T +   L +   Q F  Q             +KI V +TDG  
Sbjct: 1259 KKSLLQAVANLPYKGGNTLTGMALNFIRQQSFKTQ------AGMRPRARKIGVLITDG-- 1310

Query: 300  LSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFS 359
               K          + K  G  ++AIGI+     E       P+      N    +++ S
Sbjct: 1311 ---KSQDDVEAPSKKLKDEGVELFAIGIKNADEVELKMIATDPDDT-HAYNVAD-FESLS 1365

Query: 360  HIGKDIVTKRI 370
             I  D+     
Sbjct: 1366 KIVDDLTINLC 1376


>gi|47214246|emb|CAG12465.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 467

 Score = 88.3 bits (217), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 33/213 (15%), Positives = 73/213 (34%), Gaps = 46/213 (21%)

Query: 155 VMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPD 214
                S    +S  +  +D++ ++D SRS+        T+ + A + +  +++ +++  D
Sbjct: 36  PSSTVSPASGSSCRNGPIDLVFIVDSSRSVRP------TEFEKAKEFLQDLVDSLEVGLD 89

Query: 215 VNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQ 274
                + GLV +++                      +     T +   ++ A  + F  +
Sbjct: 90  S---TRVGLVNYAS----------------------TPLASGTMTGLAIRTAVEKAFAAE 124

Query: 275 GMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHE 334
                         ++ V +TDG      E   +      A++ G  +YA+G+       
Sbjct: 125 ---AGARLNSTKVARVAVVVTDGRPQDEVERVSAA-----ARESGIEIYAVGVDRADRTS 176

Query: 335 FLRACAS---PNSFYLVEN---PHSMYDAFSHI 361
            LR  AS    +  + VE       +   F   
Sbjct: 177 -LRLMASQPHEDHVFYVETYGVIEKLTSRFRET 208


>gi|109000862|ref|XP_001094970.1| PREDICTED: cartilage matrix protein [Macaca mulatta]
          Length = 495

 Score = 88.3 bits (217), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 33/210 (15%), Positives = 82/210 (39%), Gaps = 21/210 (10%)

Query: 163 KVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSG 222
           + +       D++ V+D SRS+         + +     ++ ++E + + P+     + G
Sbjct: 30  RGHLCRTRPTDLVFVVDSSRSVRP------VEFEKVKVFLSQVIESLDVGPNA---TRVG 80

Query: 223 LVTFSNKIEEFFLLEWGVSHLQ--RKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHC 280
           +V +++ +++ F L   VS     + ++ +      T +   +++A  +        +  
Sbjct: 81  MVNYASTVKQEFSLRAHVSKAALLQAVRRIQPLSTGTMTGLAIQFAITKALSDAEGGRSR 140

Query: 281 NTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA 340
                +  K+++ +TDG    + +D  +      A+  G  ++AIG+  +     LR  A
Sbjct: 141 ---SPDISKVVIVVTDGRPQDSVQDVSAR-----ARASGVELFAIGVGRVD-KATLRQIA 191

Query: 341 SPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           S      V+   S Y     + +       
Sbjct: 192 SEPQDEHVDYVES-YSVIEKLSRKFQEAFC 220



 Score = 82.9 bits (203), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 40/220 (18%), Positives = 83/220 (37%), Gaps = 30/220 (13%)

Query: 159 TSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNV 218
           T +V       +  D++ ++D S+S+           ++  K IN +++ + +      +
Sbjct: 260 TCNVCSGGGGSSATDLVFLIDGSKSVRP------ENFELVKKFINQIVDTLDVSD---KL 310

Query: 219 VQSGLVTFSNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAY-NQIFDMQG 275
            Q GLV +S+ + + F L        ++  ++ +S     T +   LKY   N      G
Sbjct: 311 AQVGLVQYSSSVRQEFPLGRFHTKKDIKAAVRNMSYMEKGTMTGAALKYLIDNSFTVSSG 370

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF 335
            R          +K+ +  TDG +     D        +AK  G  ++A+G+      E 
Sbjct: 371 ARPGA-------QKVGIVFTDGRSQDYINDA-----AKKAKDLGFKMFAVGVGNAVEDEL 418

Query: 336 LRACASP--NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
               + P    ++   +    +   + IGK +  K    +
Sbjct: 419 REIASEPVAEHYFYTAD----FKTINQIGKKLQKKICVEE 454


>gi|296228122|ref|XP_002759734.1| PREDICTED: collagen alpha-4(VI) chain-like [Callithrix jacchus]
          Length = 2348

 Score = 88.3 bits (217), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 42/276 (15%), Positives = 98/276 (35%), Gaps = 24/276 (8%)

Query: 96  NELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIV 155
             LR  G +     +  +   ++  +  +   + ++       L              + 
Sbjct: 156 EALRRAGILVYAVGVKDAVWAELREIASSPQENFTSFVPSLSGLSSLAQKLRQELCDTLA 215

Query: 156 --MPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
                   +    +  A  D++ ++D S S+      +  K+   + S+      V  + 
Sbjct: 216 KAASRVDHISPACREGAVADVVFLVDSSTSIG---PQNFQKVKNFLYSV------VSGLD 266

Query: 214 DVNNVVQSGLVTFSNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIF 271
             ++ V+ GL  +++ I   F L      S +  +I+ L      TN+   L++      
Sbjct: 267 VSSDRVRVGLAQYNDDIYPAFQLNQHPLKSMVLEQIQNLPYRTGGTNTGNALEFIRTSYL 326

Query: 272 DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR 331
                 +  +       +I++ +TDGE      + +     ++ K+ G +VY +GI V  
Sbjct: 327 TEGSGSRAKD----RVPQIVILVTDGE-----SNDEVQEAADQLKEDGIVVYVVGINVQD 377

Query: 332 SHEFLRACASP--NSFYLVENPHSMYDAFSHIGKDI 365
             E  +  + P     + +EN + + D    I + +
Sbjct: 378 VQELQKIASEPFEKFLFNIENFNILQDFSGSILQTL 413



 Score = 77.9 bits (190), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 50/330 (15%), Positives = 110/330 (33%), Gaps = 42/330 (12%)

Query: 61   AATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNG-----------FVNDIDD 109
            AA   +        K  +    + +I      +F  +                +     D
Sbjct: 716  AALDFLRNEVFIQEKGSRSSHGVQQIAVVITENFSQDSVSGPASRLRRAGVTIYAVGTQD 775

Query: 110  IVRSTSLDIVVVPQNEGYSISAISRYK---IPLKFCTFIPWYTNSRHIVMPITSSVKVNS 166
            +  S  L+ +       +S+   S  +   I  K    +        + +  TS      
Sbjct: 776  VSESKDLEKMASYPPWKHSVPLESFLQLSIIGSKLTNQLCPEIVDSQVSVRGTSYPVQEG 835

Query: 167  QTDAR-LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVT 225
                +  D+  ++D S S+   +  +   + + +  +      +K+     + VQ G++ 
Sbjct: 836  CVHIQKADIYFLIDGSGSI---YPEAFLDMKVFMNEV------IKMFQIGPDRVQFGVIQ 886

Query: 226  FSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
            +S++I+  F+L     V+ L+  I  + + G  T +   L             +   +T 
Sbjct: 887  YSDEIKSKFVLSQYPTVAELKVAIDNIQQGGGGTTTGEALN---------NMTQVFADTA 937

Query: 284  DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPN 343
              N  + ++ +TDG++     D          +  G I+YAIG+R     E        +
Sbjct: 938  RINVARYLIVITDGKSSDPVADA-----AEGLRASGVIIYAIGVREANIDELKEIAK--D 990

Query: 344  SFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
              + V     + D    + +DI +     +
Sbjct: 991  KIFFVYEFDLLKDIQKEVVRDICSSEACKN 1020



 Score = 75.6 bits (184), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 31/210 (14%), Positives = 80/210 (38%), Gaps = 27/210 (12%)

Query: 163  KVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSG 222
               +  +++ D++ ++D S S+           +   + + +M+ +  +  D    +Q G
Sbjct: 1014 SSEACKNSKADIVFLIDGSESISP------EDFERMKRFVESMVNQSNIGTDS---IQIG 1064

Query: 223  LVTFSNKIEEFFLLEWGVSHLQ--RKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHC 280
            L+ FS+  +E F L    S +     I  + +    T +   L +        +G     
Sbjct: 1065 LLQFSSIPKEEFRLNRYSSKVDIYNAIFAVQQMRDGTRTGKALNFTLPFFESSKG----- 1119

Query: 281  NTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA 340
                 + ++ ++ +TDG           +      + +  I++AIG+   +  + L    
Sbjct: 1120 --GRPSVQQYLIVITDG-----VAQDNVILPAKALRDKNIIIFAIGVGEAKKSQLLEITN 1172

Query: 341  SPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
              +  Y   +    ++   ++ K+I++K  
Sbjct: 1173 DEDRVYYDVD----FEVLQNLEKEILSKVC 1198



 Score = 62.9 bits (151), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 38/237 (16%), Positives = 85/237 (35%), Gaps = 24/237 (10%)

Query: 129 ISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQT--DARLDMMIVLDVSRSMES 186
           I++    K       F      S  I+  + S+V+   +    A  D++++ D S     
Sbjct: 384 IASEPFEKFLFNIENFNILQDFSGSILQTLCSAVEGKIKEFIKAYADVVLLADTS----- 438

Query: 187 FFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLL-EWGV-SHLQ 244
             D+S T        ++ ++  +++     +  Q GL  + ++    FLL  +   + + 
Sbjct: 439 -QDTSRTSFQWMQNFLSRVVGMLEV---GRDKYQIGLAQYGDQSHIEFLLNTYKTQNEMI 494

Query: 245 RKI-KYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTK 303
             I +     G S  +   L+Y     F  +   +          +  V +T G++    
Sbjct: 495 AHIHERFVPLGGSRRTGKALQYLLQTFFQEEAGSRFL----QGIPQYAVVITSGKSKDEV 550

Query: 304 EDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSH 360
           +D          +++G  V ++G++     E L    SP+  Y ++    +      
Sbjct: 551 QDA-----AQRLREKGVKVMSVGVQDFDRRE-LEWMGSPDLVYDIQREDRVRHVVED 601



 Score = 49.4 bits (116), Expect = 0.001,   Method: Composition-based stats.
 Identities = 28/176 (15%), Positives = 60/176 (34%), Gaps = 22/176 (12%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D++ ++D S       +S  T+       +  ++    +    +  ++ GL  +S+    
Sbjct: 34  DVVFLVDTS------INSQHTR--SVRNFLYILVNSFNV---SSKTIRVGLAQYSDVPHS 82

Query: 233 FFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKI 290
            FLL      + + R I+              L++    I D        +       +I
Sbjct: 83  EFLLSTYHRKNDVLRHIRQFQFKPGGKKMGLALQF----ILDHHFQEAAGSRASQGVPQI 138

Query: 291 IVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFY 346
            V M+ G       +          ++ G +VYA+G++     E     +SP   +
Sbjct: 139 AVVMSSG-----PAEDHVHGPGEALRRAGILVYAVGVKDAVWAELREIASSPQENF 189



 Score = 46.7 bits (109), Expect = 0.007,   Method: Composition-based stats.
 Identities = 34/193 (17%), Positives = 68/193 (35%), Gaps = 23/193 (11%)

Query: 185 ESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEW--GVSH 242
           E F           I  +  ++  + + PD    V+ GLV +S +    F L+     + 
Sbjct: 639 EEFSRVRQPNFQQVISFLKTIVSLLSIRPDA---VRFGLVFYSEEPRLEFSLDTFQNPAE 695

Query: 243 LQRKIKYLSKFG--VSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENL 300
           +   +  L+       T +   L +  N++F  +   +         ++I V +T  EN 
Sbjct: 696 ILEHLDKLTYRERRGRTKTGAALDFLRNEVFIQEKGSRS----SHGVQQIAVVIT--ENF 749

Query: 301 STKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSH 360
           S           +  ++ G  +YA+G + +   + L   AS    Y         ++F  
Sbjct: 750 S---QDSVSGPASRLRRAGVTIYAVGTQDVSESKDLEKMAS----YPPWKHSVPLESFLQ 802

Query: 361 ---IGKDIVTKRI 370
              IG  +  +  
Sbjct: 803 LSIIGSKLTNQLC 815


>gi|56797849|emb|CAF33009.1| matrilin-1 [Danio rerio]
          Length = 320

 Score = 88.3 bits (217), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 31/216 (14%), Positives = 82/216 (37%), Gaps = 27/216 (12%)

Query: 153 HIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLI 212
            + +   +++          D++ ++D SRS+        ++ +     +  +++ + + 
Sbjct: 18  TVDLRQAAAMAAGLCNTKPTDVVFIVDSSRSVRP------SEFEQVKVFLAKVIDGLSVG 71

Query: 213 PDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQ--RKIKYLSKFGVSTNSTPGLKYAYNQI 270
           PD     + G+V ++++++    L+   +     + +  +      T +   +++A N  
Sbjct: 72  PDA---TRVGVVNYASRVKNEVSLKSHKTKAALVKAVSKIEPLSTGTMTGLAIQFAMNVA 128

Query: 271 FDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI 330
           F      +    +  +  K+ + +TDG       D         A++ G  ++AIG+  +
Sbjct: 129 FSEAEGGR----KSPDISKVAIIVTDGRPQDNIRD-----IAARAREAGIEIFAIGVGRV 179

Query: 331 RSHEFLRACAS---PNSFYLVEN---PHSMYDAFSH 360
                LR  AS    +    VE+      +   F  
Sbjct: 180 D-MTTLRQMASEPLEDHVDYVESYSLIEKLTKKFQE 214


>gi|224048603|ref|XP_002193071.1| PREDICTED: collagen, type XXI, alpha 1 [Taeniopygia guttata]
          Length = 945

 Score = 88.3 bits (217), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 39/214 (18%), Positives = 81/214 (37%), Gaps = 28/214 (13%)

Query: 163 KVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSG 222
              S   A  D++ +LD S S+           ++    +  +     + P     +Q G
Sbjct: 27  TRASCRTAPADLVFILDGSYSVGP------ENFEIIKSWLVNITRNFDIGP---KFIQVG 77

Query: 223 LVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHC 280
           +V +S+       L       +L R+++ +   G +T +   +++A++ +F         
Sbjct: 78  VVQYSDYPVLEIPLGTHESTENLIREMESIHYLGGNTRTGRAIQFAFDHLF--------- 128

Query: 281 NTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA 340
                   KI V +TDG     K   +      EA+K    ++AIG+      + L+A A
Sbjct: 129 AKSSRFLTKIAVVLTDG-----KSQDEVKDVAAEARKNKITLFAIGVGSEIEEDELKAIA 183

Query: 341 ---SPNSFYLVENPHSMYDAFSHIGKDIVTKRIW 371
              S    + VE+  ++      I + +  + + 
Sbjct: 184 NKPSSTYVFYVEDYIAISRIKEVIKQKLCEESVC 217


>gi|326932831|ref|XP_003212516.1| PREDICTED: cartilage matrix protein-like [Meleagris gallopavo]
          Length = 493

 Score = 88.3 bits (217), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 40/230 (17%), Positives = 86/230 (37%), Gaps = 28/230 (12%)

Query: 148 YTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLE 207
                 +     +    +  + + LD++ ++D S+S+           ++  K IN ++E
Sbjct: 247 CKEGFTLNSDGKTCSACSGGSGSALDLVFLIDGSKSVRP------ENFELVKKFINQIVE 300

Query: 208 EVKLIPDVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKY 265
            +++        Q GLV +S+ + + F L        ++  +K ++     T +   LKY
Sbjct: 301 SLEV---SEKQAQVGLVQYSSSVRQEFPLGQFKNKKDIKAAVKKMAYMEKGTMTGQALKY 357

Query: 266 AYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAI 325
             +  F +       N       K+ +  TDG +     D        +AK  G  ++A+
Sbjct: 358 LVDNSFSI------ANGARPGVPKVGIVFTDGRSQDYITDA-----AKKAKDLGFRMFAV 406

Query: 326 GIRVIRSHEFLRACASP--NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
           G+      E     + P    ++   +    +   S+IGK +  K    +
Sbjct: 407 GVGNAVEDELREIASEPVAEHYFYTAD----FRTISNIGKKLQMKICVEE 452



 Score = 83.7 bits (205), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 30/205 (14%), Positives = 82/205 (40%), Gaps = 24/205 (11%)

Query: 163 KVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSG 222
           +         D++ ++D SRS+         + +     ++ ++E + + P+     + G
Sbjct: 29  RGTLCRTKPTDLVFIIDSSRSVRP------QEFEKVKVFLSRVIEGLDVGPNS---TRVG 79

Query: 223 LVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHC 280
           ++ +++ ++  F L+     + L + ++ +      T +   +++A ++ F         
Sbjct: 80  VINYASAVKNEFSLKTHQTKAGLLQAVRRIEPLSTGTMTGLAIQFAISRAFSDAE---GA 136

Query: 281 NTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA 340
               +N  K+ + +TDG      +D  +      A++ G  ++AIG+  +  H   +  +
Sbjct: 137 RLRSSNINKVAIVVTDGRPQDGVQDVSAR-----ARQAGIEIFAIGVGRVDMHTLRQIAS 191

Query: 341 SP--NSFYLVEN---PHSMYDAFSH 360
            P  +    VE+      +   F  
Sbjct: 192 EPLDDHVDYVESYSVIEKLTHKFQE 216


>gi|327541799|gb|EGF28311.1| von Willebrand factor type A [Rhodopirellula baltica WH47]
          Length = 363

 Score = 88.3 bits (217), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 45/352 (12%), Positives = 100/352 (28%), Gaps = 34/352 (9%)

Query: 15  YKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNR 74
             G M +L AI + +  +V+   I+++ +   +T L S              N       
Sbjct: 33  RHGAMLVLIAIMMFLFLIVVAFSIDIAQMHLARTELRSST--------DAAANAAATTLA 84

Query: 75  KKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISR 134
             L     + R +     +  N         D         ++            + +  
Sbjct: 85  DTLDRNLAIQRGQQIAQANLVNGQPLLLADGDFQFGRSDRQVNGKYAFNAGEAPFNGVRV 144

Query: 135 YKIPL--KFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSI 192
                       +P +  +              + T    D+ +V+D S SM        
Sbjct: 145 NGQRTAGSLSGPVPLFFGNVTGTSIFEPEA-FATATYVERDITLVVDRSGSMAG------ 197

Query: 193 TKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSK 252
           ++ +    +I    + +   P      Q GL +++++  E   L    + +   +  L  
Sbjct: 198 SRFNDLQAAIRIFTDLLATTPVDE---QIGLASYNDRASEDVQLTENFAEVNNAMDRLRT 254

Query: 253 FGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYC 312
            G  T+ + G++                       ++ ++ MTDG +    E        
Sbjct: 255 -GGFTSISRGMQAGQEIAL--------RGRPPEFVERTMIVMTDGRHNRGPE---PRVVA 302

Query: 313 NEAKKRGAIVYAIGIRVIRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIG 362
            +    G  ++ I          ++  A       +   N   + D +  I 
Sbjct: 303 TDLAADGVTIHTITFGAGADFGRMQDVARIGGGRHFHATNGDQLRDIYREIA 354


>gi|254501086|ref|ZP_05113237.1| hypothetical protein SADFL11_1122 [Labrenzia alexandrii DFL-11]
 gi|222437157|gb|EEE43836.1| hypothetical protein SADFL11_1122 [Labrenzia alexandrii DFL-11]
          Length = 465

 Score = 88.3 bits (217), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 63/461 (13%), Positives = 136/461 (29%), Gaps = 109/461 (23%)

Query: 8   IRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMN 67
           I  F  N  G +  + A  + ++ ++ G  I++S     +  L   ID + +  AT +  
Sbjct: 6   ISKFNRNQDGSILPIFAGMVLVLVVIGGAAIDISRAVNAREKLAYAIDAAALSVATDLST 65

Query: 68  EGNGNNRKKLKGGDILCRIKNTWNMSFRN----ELRDNGFVNDIDDIVRSTSLDIVVVPQ 123
                    L+   I  RI+N++  +  +    +   +    D+D    + ++       
Sbjct: 66  -------TVLRDNQIKTRIENSFRANLSDAEFLDQAIDNLDFDVDSNAGTVTVSSSAGLN 118

Query: 124 NEGYSISAISRYKIPLKFCTFIPWYTNSRH-------IVMPITSSVKVNSQTDAR----- 171
           N   +I    +  +      F      +         +V+ +T S+  +           
Sbjct: 119 NYFLNIPGFGKDGLGPDVFNFGTSAEVNYSRFDVELALVVDVTGSMAGDMGALRDAAEEV 178

Query: 172 LDMMIVLDVSRSMES------------FFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           +D++I  D S S                  S  + +     S    + E +      + V
Sbjct: 179 VDILIEDDASNSASKVRISLVPYSQGVNLGSYASTVTNGSTSWRNCVNEREGQQKYTDAV 238

Query: 220 QS--GL-VTFSNKIEEFFLLEWG--------------------VSHLQRKIKYLSKFGVS 256
            +  G    + + ++ +F+ ++G                     S     I  +      
Sbjct: 239 YNYDGTNSEYFHGLQSYFIWDYGSSENWSSARDDCPSSSLQPLTSDKNTLISDIRNLSSG 298

Query: 257 TNSTPGLKYAY---------NQIF--DMQGMRQHCNTEDANYKKIIVFMTDGENL----- 300
             +      A+           ++  D         T D + KK  + MTDG+       
Sbjct: 299 GGTGGQTGVAWGWYTLSPNWTSLWPTDSDPEPYGNGTPDDDVKKFALIMTDGDFNAQYGK 358

Query: 301 -------------------------------STKEDQQSLYYCNEAKKRGAIVYAIGI-- 327
                                          +     ++   C+  K     ++ +    
Sbjct: 359 EERTTCTGRGRNRVCTTNEYWVERYHRYSDYNDPPATRARTLCDAMKAENIEIFTVFFDT 418

Query: 328 -RVIRSHEFLRACAS-PNSFYLVENPHSMYDAFSHIGKDIV 366
                  + +  CAS  + +Y  +N   +  AFS+I K I 
Sbjct: 419 GGSAFGDDLMSYCASGSDYYYEADNKDELITAFSNIAKRIQ 459


>gi|156616290|ref|NP_001096078.1| collagen alpha-6(VI) chain precursor [Homo sapiens]
 gi|189082902|sp|A6NMZ7|CO6A6_HUMAN RecName: Full=Collagen alpha-6(VI) chain; Flags: Precursor
          Length = 2263

 Score = 88.3 bits (217), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 42/196 (21%), Positives = 78/196 (39%), Gaps = 27/196 (13%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D+M ++D S S+      + +K+   +K++      V       + VQ G+V FS+  +E
Sbjct: 622 DIMFLVDSSGSIGPE---NFSKMKTFMKNL------VSKSQIGPDRVQIGVVQFSDINKE 672

Query: 233 FFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKI 290
            F L   +S   +   I  ++  G +T +   L +        +G R        N +K 
Sbjct: 673 EFQLNRFMSQSDISNAIDQMAHIGQTTLTGSALSFVSQYFSPTKGARP-------NIRKF 725

Query: 291 IVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVEN 350
           ++ +TDGE                 ++ G I+Y++G+      +       P   + VEN
Sbjct: 726 LILITDGE-----AQDIVKEPAVVLRQEGVIIYSVGVFGSNVTQLEEISGRPEMVFYVEN 780

Query: 351 PHSMYDAFSHIGKDIV 366
               +D    I  D+V
Sbjct: 781 ----FDILQRIEDDLV 792



 Score = 85.6 bits (210), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 55/356 (15%), Positives = 119/356 (33%), Gaps = 40/356 (11%)

Query: 34  LGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIK------ 87
           L M I  S +      L     ++   AA + + +   + R   +    + +I       
Sbjct: 283 LSMGINKSEVLQHIQNLSPRTGKAYTGAAIKKLRKEVFSARNGSRKNQGVPQIAVLVTHR 342

Query: 88  ---NTWNMSFRNELRDNGFVNDID-DIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCT 143
              +    +  N  R+   +  +  +    T L+ +     E Y     +   +     T
Sbjct: 343 DSEDNVTKAAVNLRREGVTIFTLGIEGASDTQLEKIASHPAEQYVSKLKTFADLAAHNQT 402

Query: 144 FIPWYTNSRHIVMPI----TSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAI 199
           F+    N     + +    T ++K         D+ +++D S S      +  T      
Sbjct: 403 FLKKLRNQITHTVSVFSERTETLKSGCVDTEEADIYLLIDGSGS------TQATDFHEMK 456

Query: 200 KSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVST 257
             ++ ++    + P     V+ G V +++  +  F +        L + I+ + + G +T
Sbjct: 457 TFLSEVVGMFNIAPHK---VRVGAVQYADSWDLEFEINKYSNKQDLGKAIENIRQMGGNT 513

Query: 258 NSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKK 317
           N+   L +  + +   +  +Q  N         +V +T+G           L   N  ++
Sbjct: 514 NTGAALNFTLSLL--QKAKKQRGNK----VPCHLVVLTNG-----MSKDSILEPANRLRE 562

Query: 318 RGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
               VYAIGI+     +           Y V +    +DA   I   +V +    +
Sbjct: 563 EHIRVYAIGIKEANQTQLREIAGEEKRVYYVHD----FDALKDIRNQVVQEICTEE 614



 Score = 83.7 bits (205), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 37/192 (19%), Positives = 76/192 (39%), Gaps = 19/192 (9%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ V+D S S+         + ++       M+  VK      N V+ G + +++  E
Sbjct: 808 LDVVFVIDSSGSI------DYDEYNIMKDF---MIGLVKKADVGKNQVRFGALKYADDPE 858

Query: 232 EFFLLEWGVSHLQ--RKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
             F L+   + L+    ++     G ST +   L   ++     +      N       +
Sbjct: 859 VLFYLDDFGTKLEVISVLQNDQAMGGSTYTAEAL--GFSDHMFTEARGSRLNKG---VPQ 913

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVE 349
           +++ +TDGE+    +  +        + +G +V A+GI      E L    S + ++ VE
Sbjct: 914 VLIVITDGES---HDADKLNATAKALRDKGILVLAVGIDGANPVELLAMAGSSDKYFFVE 970

Query: 350 NPHSMYDAFSHI 361
               +   FS +
Sbjct: 971 TFGGLKGIFSDV 982



 Score = 79.8 bits (195), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 36/214 (16%), Positives = 83/214 (38%), Gaps = 22/214 (10%)

Query: 154  IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
            +   + +S KV+ + D  +D++ ++D S S++        K+   + S+      V+   
Sbjct: 982  VTASVCNSSKVDCEIDK-VDLVFLMDGSTSIQPN---DFKKMKEFLASV------VQDFD 1031

Query: 214  DVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIF 271
               N V+ G   FS+     F L    G   +  +I+ + +   +T+    L+   +   
Sbjct: 1032 VSLNRVRIGAAQFSDTYHPEFPLGTFIGEKEISFQIENIKQIFGNTHIGAALREVEHYFR 1091

Query: 272  DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR 331
               G R      +    ++++ +TDG+        +        + RG  +Y++GI  + 
Sbjct: 1092 PDMGSRI-----NTGTPQVLLVLTDGQ-----SQDEVAQAAEALRHRGIDIYSVGIGDVD 1141

Query: 332  SHEFLRACASPNSFYLVENPHSMYDAFSHIGKDI 365
              + ++   +      V N   +      I ++I
Sbjct: 1142 DQQLIQITGTAEKKLTVHNFDELKKVNKRIVRNI 1175



 Score = 61.3 bits (147), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 44/296 (14%), Positives = 93/296 (31%), Gaps = 31/296 (10%)

Query: 64  QIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQ 123
           + + E +         G    +      +   +E  DN              +  V V +
Sbjct: 109 KALQEAHRTYFSAPANGRDKKQFPPILVVLASSESEDNVEEASKALRKDGVKIISVGVQK 168

Query: 124 NEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVK----------VNSQTDARL- 172
               ++ A++  +      T       S+++   I   +K          V +     + 
Sbjct: 169 ASEENLKAMATSQFHFNLRTVRDLSMFSQNMTHIIKDVIKYKEGAVDDIFVEACQGPSMA 228

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D++ +LD+S       + S    D     +    E V  +    N ++ GLV +SN+ + 
Sbjct: 229 DVVFLLDMS------INGSEENFDYLKGFLE---ESVSALDIKENCMRVGLVAYSNETKV 279

Query: 233 FFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKI 290
              L  G   S + + I+ LS       +   +K    ++F     R           +I
Sbjct: 280 INSLSMGINKSEVLQHIQNLSPRTGKAYTGAAIKKLRKEVFS---ARNGSRKN-QGVPQI 335

Query: 291 IVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFY 346
            V +T         +          ++ G  ++ +GI      +  +  + P   Y
Sbjct: 336 AVLVT-----HRDSEDNVTKAAVNLRREGVTIFTLGIEGASDTQLEKIASHPAEQY 386


>gi|86749514|ref|YP_486010.1| hypothetical protein RPB_2394 [Rhodopseudomonas palustris HaA2]
 gi|86572542|gb|ABD07099.1| conserved hypothetical protein [Rhodopseudomonas palustris HaA2]
          Length = 456

 Score = 88.3 bits (217), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 61/442 (13%), Positives = 126/442 (28%), Gaps = 84/442 (19%)

Query: 10  NFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEG 69
            F     G + I+ AI L  +   +G  I+ S     +T + + +D + +  +  + +  
Sbjct: 16  RFVKTDGGNVAIIFAIALLPMIGFIGAAIDYSRANKARTSMQAALDSAALMVSKDLASGV 75

Query: 70  NGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSI 129
               +   K       + N  N    N      +         +  L        E  ++
Sbjct: 76  ITAGQVSAKAQSYFASLYN--NTEAPNITVTATYTAKDSTGSSTVLLKGTGDISTEFMNM 133

Query: 130 SAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNS------------------QTDAR 171
                  I                I + +T S+                           
Sbjct: 134 FGFPTLGIGSAATATWGGTRLRVAIALDVTGSMASAGKMPAMQSAAKTLVDNLRANAQTA 193

Query: 172 LDMMIVL-------------------------DVSRSMESFFDSSITKIDMAIKS----- 201
            D+ I +                         D + S   ++ ++ +  + A ++     
Sbjct: 194 DDLYISIIPFAQMVNVGKSNKNASWIKWDYWEDTTGSCNWWWLTTKSSCESAGRTWSSTN 253

Query: 202 ----INAMLEEVKLIPDVNNV-----VQSGLVTFSNKIEEFFLLEW-----GVSHLQRKI 247
                  + +  +      +       +     +S   E+   +         + ++ KI
Sbjct: 254 QSQWGGCVTDRDQPADTTKDAPTTAATRFPAANYSACPEQILPMTSAYSSSNATTIKDKI 313

Query: 248 KYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGEN-------- 299
             LS  G  TN   G+ +A+  + D   +       D  Y   I+ ++DG N        
Sbjct: 314 DALSPNG-GTNQPIGMHWAWMSLQDGAPLNTPAKDADYKYTDAIILLSDGMNTIDRWYGN 372

Query: 300 ---LSTKEDQQSLYYCNEAKKRGA------IVYAIGIRVIR--SHEFLRACASPNSFYLV 348
               S   D +    C+  +   A      ++Y I +        E L+ CA   +F+  
Sbjct: 373 GSSWSKDVDARQKLLCDNIRAASAASTTKTVIYTIQVNTDGDPESEVLKYCADSGNFFAT 432

Query: 349 ENPHSMYDAFSHIGKDIVTKRI 370
                +  AF+ IG  +   RI
Sbjct: 433 TTASGISTAFAQIGASLSKLRI 454


>gi|297671963|ref|XP_002814093.1| PREDICTED: collagen alpha-6(VI) chain-like [Pongo abelii]
          Length = 2291

 Score = 87.9 bits (216), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 41/196 (20%), Positives = 77/196 (39%), Gaps = 27/196 (13%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D+M ++D S S+      + +K+   +K++      V       + VQ G V FS+  +E
Sbjct: 650 DIMFLVDSSGSIGPE---NFSKMKTFMKNL------VSKSQIGPDRVQIGAVQFSDINKE 700

Query: 233 FFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKI 290
            F L   +S   +   I  ++  G +T +   L +        +G R        N +K 
Sbjct: 701 EFQLNRFMSQSDISNAIDQMAHIGQTTLTGSALSFVSQYFSPTKGAR-------PNVRKF 753

Query: 291 IVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVEN 350
           ++ +TDGE                 ++ G I+Y++G+      +       P   + VEN
Sbjct: 754 LILITDGE-----AQDIVKEPAIALRQEGVIIYSVGVFGSNVTQLEEISGRPEMVFYVEN 808

Query: 351 PHSMYDAFSHIGKDIV 366
               +D    +  D+V
Sbjct: 809 ----FDILQRVEDDLV 820



 Score = 86.0 bits (211), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 54/356 (15%), Positives = 119/356 (33%), Gaps = 40/356 (11%)

Query: 34  LGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIK------ 87
           L M I  S +      L     ++   AA + + +   + R   +    + +I       
Sbjct: 311 LSMGINKSEVLQHIQNLSPRTGKAYTGAAIKKLRKEVFSARNGSRKNQGVPQIAVLVTHR 370

Query: 88  ---NTWNMSFRNELRDNGFVNDID-DIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCT 143
              +    +  N  R+   +  +  +    T L+ +     E Y     +   +     T
Sbjct: 371 DSEDNVTKAAVNLRREGVTIFTLGIEGASDTQLEKIASHPAEQYVSKLKTFADLAAHNQT 430

Query: 144 FIPWYTNSRHIVMPI----TSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAI 199
           F+    N     + +    T ++K         D+ +++D S S      +  T      
Sbjct: 431 FLKKLRNQITHTVSVFSERTETLKSGCVDTEEADIYLLIDGSGS------TQATDFHEMK 484

Query: 200 KSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVST 257
             ++ ++    + P     V+ G V +++  +  F +        L + I+ + + G +T
Sbjct: 485 TFLSEVVGMFNIAPHK---VRVGAVQYADSWDLEFEINKYSNKQDLGKAIENIRQMGGNT 541

Query: 258 NSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKK 317
           N+   L +  + +   +  +Q  N         +V +T+G           L   N  ++
Sbjct: 542 NTGAALNFTLSLL--QKAKKQRGNK----VPCHLVVLTNG-----MSKDSILEPANRLRE 590

Query: 318 RGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
               VYAIG++     +           Y V +    +DA   I   +V +    +
Sbjct: 591 EHIRVYAIGVKEANQTQLREIAGEEKRVYYVHD----FDALKDIRNQVVQEICTEE 642



 Score = 85.6 bits (210), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 36/192 (18%), Positives = 76/192 (39%), Gaps = 19/192 (9%)

Query: 172  LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
            LD++ V+D S S+         + ++       M+  VK      N V+ G + +++  E
Sbjct: 836  LDVVFVIDSSGSI------DYDEYNIMKDF---MIGLVKKADVGKNQVRFGALKYADDPE 886

Query: 232  EFFLLEWGVSHLQ--RKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
              F L+   + L+    ++     G +T +   L   ++     +      N       +
Sbjct: 887  VLFYLDDFGTKLEVISVLQNDQAMGGNTYTAEAL--GFSDHMFTEARGSRLNKG---VPQ 941

Query: 290  IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVE 349
            +++ +TDGE+    +  +        + +G +V A+GI      E L    S + ++ VE
Sbjct: 942  VLIVITDGES---HDADKLNATAKALRDKGILVLAVGIAGANPVELLAMAGSSDKYFFVE 998

Query: 350  NPHSMYDAFSHI 361
                +   FS +
Sbjct: 999  TFGGLKGIFSDV 1010



 Score = 79.4 bits (194), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 36/214 (16%), Positives = 83/214 (38%), Gaps = 22/214 (10%)

Query: 154  IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
            +   + +S KV+ + D  +D++ ++D S S++        K+   + S+      V+   
Sbjct: 1010 VTASVCNSSKVDCEIDK-VDLVFLMDGSTSIQQN---DFKKMKEFLASV------VQDFD 1059

Query: 214  DVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIF 271
               N V+ G   FS+     F L    G   +  +I+ + +   +T+    L+   +   
Sbjct: 1060 VSLNRVRIGAAQFSDTYHPEFPLGAFIGEKEISFQIENIKQIFGNTHIGAALRKVEHYFR 1119

Query: 272  DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR 331
               G R      +    ++++ +TDG+        +        + RG  +Y++GI  + 
Sbjct: 1120 PDMGSRI-----NTGTPQVLLVLTDGQ-----SQDEVAQAAEALRHRGIDIYSVGIGDVD 1169

Query: 332  SHEFLRACASPNSFYLVENPHSMYDAFSHIGKDI 365
              + ++   +      V N   +      I ++I
Sbjct: 1170 DQQLIQITGTAEKKLTVHNFDELKKVNKRIVRNI 1203



 Score = 60.6 bits (145), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 39/249 (15%), Positives = 81/249 (32%), Gaps = 31/249 (12%)

Query: 111 VRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVK------- 163
                +  V V +    ++ A++  +      T       S+++   I    K       
Sbjct: 184 KDGVKIISVGVQKASEENLKAMATSQFHFNLRTVRDLSMFSQNMTHIIKDVTKYKEGAVD 243

Query: 164 ---VNSQTDARL-DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
              V +     + D++ +LD+S       + S    D     +    E V  +    N +
Sbjct: 244 DIFVEACQGPSMADVVFLLDMS------INGSEENFDYLKGFLE---ESVSALDIKENCM 294

Query: 220 QSGLVTFSNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + GLV +SN+ +    L  G   S + + I+ LS       +   +K    ++F     R
Sbjct: 295 RVGLVAYSNETKVINSLSMGINKSEVLQHIQNLSPRTGKAYTGAAIKKLRKEVFS---AR 351

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                      +I V +T         +          ++ G  ++ +GI      +  +
Sbjct: 352 NGSRKN-QGVPQIAVLVT-----HRDSEDNVTKAAVNLRREGVTIFTLGIEGASDTQLEK 405

Query: 338 ACASPNSFY 346
             + P   Y
Sbjct: 406 IASHPAEQY 414



 Score = 51.3 bits (121), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 33/201 (16%), Positives = 69/201 (34%), Gaps = 25/201 (12%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D++ ++D S  + S               I  M+  +   P   +  +  L  +S+K+  
Sbjct: 55  DVVFLVDSSDRLGS------KSFPFVKMFITKMISSL---PIEADKYRVALAQYSDKLHS 105

Query: 233 FFLLEW--GVSHLQRKIKY-LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
            F L    G S +   ++      G S      L+ A+   F      +        +  
Sbjct: 106 EFHLSTFKGRSPMLNHLRKNFGFIGGSLQIGKALQEAHRTYFSAPANGRDKK----QFPP 161

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYL-- 347
           I+V +      S++ +          +K G  + ++G++       L+A A+    +   
Sbjct: 162 ILVVL-----ASSESEDDVEEASKALQKDGVKIISVGVQKASEEN-LKAMATSQFHFNLR 215

Query: 348 -VENPHSMYDAFSHIGKDIVT 367
            V +        +HI KD+  
Sbjct: 216 TVRDLSMFSQNMTHIIKDVTK 236


>gi|148698183|gb|EDL30130.1| matrilin 1, cartilage matrix protein 1 [Mus musculus]
          Length = 456

 Score = 87.9 bits (216), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 35/200 (17%), Positives = 76/200 (38%), Gaps = 21/200 (10%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D++ V+D SRS+         + +     ++ ++E + + P+     + GLV +++ ++ 
Sbjct: 1   DLVFVVDSSRSVRP------VEFEKVKVFLSQVIESLDVGPNA---TRVGLVNYASTVKP 51

Query: 233 FFLLEWGVSHLQ--RKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKI 290
            F L    S     + ++ +      T +   L++A  +                +  K+
Sbjct: 52  EFPLRAHGSKASLLQAVRRIQPLSTGTMTGLALQFAITKALSDAE---GGRARSPDISKV 108

Query: 291 IVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVEN 350
           ++ +TDG    +  D         A+  G  ++AIG+  +     LR  AS      V+ 
Sbjct: 109 VIVVTDGRPQDSVRDVS-----ERARASGIELFAIGVGRVD-KATLRQIASEPQDEHVDY 162

Query: 351 PHSMYDAFSHIGKDIVTKRI 370
             S Y+    + K       
Sbjct: 163 VES-YNVIEKLAKKFQEAFC 181



 Score = 86.0 bits (211), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 40/220 (18%), Positives = 85/220 (38%), Gaps = 30/220 (13%)

Query: 159 TSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNV 218
           T +V     + +  D++ ++D S+S+           ++  K IN +++ + +      +
Sbjct: 221 TCNVCRGGGSGSATDLVFLIDGSKSVRP------ENFELVKKFINQIVDTLDVSD---RL 271

Query: 219 VQSGLVTFSNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAY-NQIFDMQG 275
            Q GLV +S+ I + F L        ++  ++ +S     T +   LKY   N      G
Sbjct: 272 AQVGLVQYSSSIRQEFPLGRFHTKKDIKAAVRNMSYMEKGTMTGAALKYLIDNSFTVSSG 331

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF 335
            R          +K+ +  TDG +     D        +AK  G  ++A+G+      E 
Sbjct: 332 ARPGA-------QKVGIVFTDGRSQDYINDA-----ARKAKDLGFKMFAVGVGNAVEEEL 379

Query: 336 LRACASP--NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
               + P  + ++   +    +   + IGK +  +    +
Sbjct: 380 REIASEPVADHYFYTAD----FKTINQIGKKLQKQICVEE 415


>gi|326672754|ref|XP_002664126.2| PREDICTED: collagen alpha-1(XXI) chain-like [Danio rerio]
          Length = 572

 Score = 87.9 bits (216), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 44/214 (20%), Positives = 86/214 (40%), Gaps = 25/214 (11%)

Query: 166 SQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVT 225
           S   A  D++ +LD S S++          ++  K +  +     +        Q G+V 
Sbjct: 34  SCRTAPSDLVFILDGSWSVDDI------NFEIVKKWLVNITMSFNIGQ---KFTQVGVVQ 84

Query: 226 FSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           +S+       L   +  S L + ++ +   G +TN+   +K+A +++F +          
Sbjct: 85  YSDDPFLHIPLGKHFSSSDLIKAMESIEYMGGNTNTGRAIKFANDKLFALSE------RG 138

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA--- 340
                KI V +TDG     K   + L     A+K+G I++AIG+        LRA A   
Sbjct: 139 PNGIAKIAVVLTDG-----KSQDEVLAAAEAARKKGIILFAIGVGSETEEAQLRAIANKP 193

Query: 341 SPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYDK 374
           S    + V++  ++      I + +  + +   K
Sbjct: 194 SSTYVFSVKDYKAIAKIREVIRQKLCEETVCPAK 227


>gi|111074529|ref|NP_031756.2| collagen alpha-1(XII) chain [Mus musculus]
          Length = 3061

 Score = 87.9 bits (216), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 42/279 (15%), Positives = 97/279 (34%), Gaps = 34/279 (12%)

Query: 101 NGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIP--LKFCTFIPWYTNSRHIVMPI 158
           +G   +      +T   +  +     Y ++  S  ++   +     +   T         
Sbjct: 64  DGPTKEFTLAASTTETLLSDLIPETQYVVTITSYNEVEESVPVIGQLTIQTGGPTKPGEK 123

Query: 159 -TSSVKVNSQTDAR-LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVN 216
                ++   + +   D++ ++D S S+                 ++ ++  V       
Sbjct: 124 KPGKTEIQKCSVSAWTDLVFLVDGSWSVGRNN---------FKYILDFIVALVSAFDIGE 174

Query: 217 NVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKY-AYNQIFDM 273
              + G+V +S+     F L   +    L   +K +   G +T +   + Y   N   + 
Sbjct: 175 EKTRVGVVQYSSDTRTEFNLNQYYRREDLLAAVKKIPYKGGNTMTGDAIDYLVKNTFTES 234

Query: 274 QGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSH 333
            G R         + K+ + +TDG     K   +      E +  G  V+++GI+   + 
Sbjct: 235 AGSRAG-------FPKVAIIITDG-----KSQDEVEIPARELRNIGVEVFSLGIKAADAK 282

Query: 334 EFLRACASP--NSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           E  +  ++P  N  + V N    +DA   I  +I+++  
Sbjct: 283 ELKQIASTPSLNHVFNVAN----FDAIVDIQNEIISQVC 317



 Score = 86.0 bits (211), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 53/267 (19%), Positives = 106/267 (39%), Gaps = 37/267 (13%)

Query: 111 VRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDA 170
            ++T+L++  +  +  Y IS  +   +     T +   T    + +  +  V + +    
Sbjct: 384 PQTTTLNVRDLTADTEYQISVFAMKGLTSSEPTSVMEKTQPMKVQVECSRGVDIKA---- 439

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
             D++ ++D S S+     ++  K+   ++ +       K      N VQ  LV +S   
Sbjct: 440 --DIVFLVDGSYSIG---IANFVKVRAFLEVL------AKSFEISPNRVQISLVQYSRDP 488

Query: 231 EEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
              F L+    V  + + I      G STN+   + Y   +IF             +N  
Sbjct: 489 HTEFTLKEFNRVEDIIKAINTFPYRGGSTNTGKAMTYVREKIFVPN------KGSRSNVP 542

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NSF 345
           K+++ +TDG++     D        + +     ++A+G++     E L A ASP      
Sbjct: 543 KVMILITDGKSSDAFRD-----PAIKLRNSDVEIFAVGVKDAVRSE-LEAIASPPAETHV 596

Query: 346 YLVENPHSMYDAFSHIGKDIVTKRIWY 372
           + VE+    +DAF  I  ++ T+ I  
Sbjct: 597 FTVED----FDAFQRISFEL-TQSICL 618



 Score = 61.3 bits (147), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 43/251 (17%), Positives = 83/251 (33%), Gaps = 28/251 (11%)

Query: 124  NEGYSISAISRYK--IPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVS 181
               Y ++    +     L          +   +   ++S +   ++ +A  D+++++D S
Sbjct: 1150 GTTYRVNVFGMFDGGESLPLVGQEMTTLSDTTVTPFLSSGMDCLTRAEA--DIVLLVDGS 1207

Query: 182  RSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLE--WG 239
             S+                 I+ ++E  ++ P     VQ  L  +S      + L     
Sbjct: 1208 WSIG------RANFRTVRSFISRIVEVFEIGP---KRVQIALAQYSGDPRTEWQLNAHRD 1258

Query: 240  VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGEN 299
               L + +  L   G +T +   L +   Q F  Q             +KI V +TDG  
Sbjct: 1259 KKSLLQAVANLPYKGGNTLTGMALNFIRQQSFKTQ------AGMRPRARKIGVLITDG-- 1310

Query: 300  LSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFS 359
               K          + K  G  ++AIGI+     E       P+      N    +++ S
Sbjct: 1311 ---KSQDDVEAPSKKLKDEGVELFAIGIKNADEVELKMIATDPDDT-HAYNVAD-FESLS 1365

Query: 360  HIGKDIVTKRI 370
             I  D+     
Sbjct: 1366 KIVDDLTINLC 1376


>gi|171741586|ref|ZP_02917393.1| hypothetical protein BIFDEN_00672 [Bifidobacterium dentium ATCC
           27678]
 gi|171277200|gb|EDT44861.1| hypothetical protein BIFDEN_00672 [Bifidobacterium dentium ATCC
           27678]
          Length = 1256

 Score = 87.9 bits (216), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 61/296 (20%), Positives = 103/296 (34%), Gaps = 45/296 (15%)

Query: 65  IMNEGNGNNRKKLKGGDILCRIKN---TWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVV 121
            +N+ N  N           +      T  ++      +  F N           + V  
Sbjct: 481 AVNDPNITNVSCGTDTLAANQQTTCSGTLTLTEDMVDSEGHFTNTATASGTDDEGNAVNS 540

Query: 122 PQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDAR-LDMMIVLDV 180
           PQ    +I AI     P K         N+  + + +T +   ++ T  + +D  +VLDV
Sbjct: 541 PQ-ASVTIKAIKPLGAPEKHKRIKKNSDNTYTVNVDVTGAANSSTITTTQSVDFTLVLDV 599

Query: 181 SRSMESFFD---SSITKIDMAIKSINAMLEEVKLI--PDVNNVVQSGLVTFSNKIEE--- 232
           S SM    D    SI K+     ++N  L E   I     + +++ GLV F+ K      
Sbjct: 600 SSSMSDEMDSDQGSIKKMTALKSAVNNFLGEAAEINEQSGSELIRVGLVKFAGKESSKVG 659

Query: 233 ----------------FFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGM 276
                              L   +S L+ K+  L   G  T +  G K+A   +      
Sbjct: 660 NETYTEGRFVYNYSQIVSPLTADMSDLKNKVSALRHNGA-TRADLGFKHASTVMSGA--- 715

Query: 277 RQHCNTEDANYKKIIVFMTDGENLSTKE-----DQQSLYYCNEAKKRGAIVYAIGI 327
                    + K++++F TDG      +        ++ Y    K  GA VY+IG+
Sbjct: 716 -------RTDAKRVVIFFTDGTPTKVSDFDKDVANSAVTYAKSLKDSGATVYSIGV 764


>gi|332244061|ref|XP_003271190.1| PREDICTED: collagen alpha-1(XII) chain [Nomascus leucogenys]
          Length = 3100

 Score = 87.9 bits (216), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 53/267 (19%), Positives = 103/267 (38%), Gaps = 37/267 (13%)

Query: 111 VRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDA 170
            ++T+L +  +  +  Y IS  +   +       I   T    + +  +  V + +    
Sbjct: 384 PQTTTLSVRDLSADTEYQISVSAMKGMTSSEPISIMEKTQPMKVQVECSRGVDIKA---- 439

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
             D++ ++D S S+     ++  K+   ++ +      VK      N VQ  LV +S   
Sbjct: 440 --DIVFLVDGSYSIG---IANFVKVRAFLEVL------VKSFEISPNRVQISLVQYSRDP 488

Query: 231 EEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
              F L+       +   I      G STN+   + Y   +IF             +N  
Sbjct: 489 HTEFTLKKFTKVEDIIEAINTFPYRGGSTNTGKAMTYVREKIFVPN------KGSRSNVP 542

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NSF 345
           K+++ +TDG++     D        + +     ++A+G++     E L A ASP      
Sbjct: 543 KVMILITDGKSSDAFRD-----PAIKLRNSDVEIFAVGVKDAVRSE-LEAIASPPAETHV 596

Query: 346 YLVENPHSMYDAFSHIGKDIVTKRIWY 372
           + VE+    +DAF  I  ++ T+ I  
Sbjct: 597 FTVED----FDAFQRISFEL-TQSICL 618



 Score = 87.1 bits (214), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 46/279 (16%), Positives = 100/279 (35%), Gaps = 34/279 (12%)

Query: 101 NGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIP--LKFCTFIPWYTNSRHIVMPI 158
           +G   +      +T   +  +     Y ++  S  ++   +     +   T S    +  
Sbjct: 64  DGPTKEFTLAASTTETLLSELVPETEYVVTITSYDEVEESVPVIGQLTIQTGSSTKPVEK 123

Query: 159 -TSSVKVNSQTDAR-LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVN 216
                ++   + +   D++ ++D S S+      +   I   I ++      V       
Sbjct: 124 KPGKTEIQKCSVSAWTDLVFLVDGSWSVGRN---NFKYILDFIAAL------VSAFDIGE 174

Query: 217 NVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKY-AYNQIFDM 273
              + G+V +S+     F L   +    L   IK +   G +T +   + Y   N   + 
Sbjct: 175 EKTRVGVVQYSSDTRTEFNLNQYYQRDELLAAIKKIPYKGGNTMTGDAIDYLVKNTFTES 234

Query: 274 QGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSH 333
            G R         + K+ + +TDG     K   +      E +  G  V+++GI+   + 
Sbjct: 235 AGARVG-------FPKVAIIITDG-----KSQDEVEIPARELRNVGVEVFSLGIKAADAK 282

Query: 334 EFLRACASP--NSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           E  +  ++P  N  + V N    +DA   I  +I+++  
Sbjct: 283 ELKQIASTPSLNHVFNVAN----FDAIVDIQNEIISQVC 317



 Score = 62.9 bits (151), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 49/250 (19%), Positives = 82/250 (32%), Gaps = 26/250 (10%)

Query: 124  NEGYSISAISRYKI-PLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSR 182
               Y ++    +              T S   VMP+ SS  +   T A  D+++++D S 
Sbjct: 1150 GTTYKVNVFGMFDGGESSPLVGQEMTTLSDTTVMPVLSS-GMECLTRAEADIVLLVDGSW 1208

Query: 183  SMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLE--WGV 240
            S+                 I+ ++E   + P     VQ  L  +S      + L      
Sbjct: 1209 SIG------RANFRTVRSFISRIVEVFDIGP---KRVQIALAQYSGDPRTEWQLNAHRDK 1259

Query: 241  SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENL 300
              L + +  L   G +T +   L +   Q F  Q             +KI V +TDG   
Sbjct: 1260 KSLLQAVANLPYKGGNTLTGMALNFIRQQNFRTQ------AGMRPRARKIGVLITDG--- 1310

Query: 301  STKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSH 360
              K          + K  G  ++AIGI+     E       P+      N    +++ S 
Sbjct: 1311 --KSQDDVEAPSKKLKDEGVELFAIGIKNADEVELKMIATDPDDT-HAYNVAD-FESLSR 1366

Query: 361  IGKDIVTKRI 370
            I  D+     
Sbjct: 1367 IVDDLTVNLC 1376


>gi|283455087|ref|YP_003359651.1| fimbriae protein with LPXTG motif and von Willebrand factor typeA
           domain [Bifidobacterium dentium Bd1]
 gi|283101721|gb|ADB08827.1| Fimbriae protein with LPXTG motif and von Willebrand factor typeA
           domain [Bifidobacterium dentium Bd1]
          Length = 1256

 Score = 87.5 bits (215), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 61/296 (20%), Positives = 103/296 (34%), Gaps = 45/296 (15%)

Query: 65  IMNEGNGNNRKKLKGGDILCRIKN---TWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVV 121
            +N+ N  N           +      T  ++      +  F N           + V  
Sbjct: 481 AVNDPNITNVSCGTDTLAANQQTTCSGTLTLTEDMVDSEGHFTNTATASGTDDEGNAVNS 540

Query: 122 PQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDAR-LDMMIVLDV 180
           PQ    +I AI     P K         N+  + + +T +   ++ T  + +D  +VLDV
Sbjct: 541 PQ-ASVTIKAIKPLGAPEKHKRIKKNSDNTYTVNVDVTGAANSSTITTTQSVDFTLVLDV 599

Query: 181 SRSMESFFD---SSITKIDMAIKSINAMLEEVKLI--PDVNNVVQSGLVTFSNKIEE--- 232
           S SM    D    SI K+     ++N  L E   I     + +++ GLV F+ K      
Sbjct: 600 SSSMSDEMDSDQGSIKKMTALKSAVNNFLGEAAEINEQSGSELIRVGLVKFAGKESSKVG 659

Query: 233 ----------------FFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGM 276
                              L   +S L+ K+  L   G  T +  G K+A   +      
Sbjct: 660 NETYTEGRFVYNYSQIVSPLTADMSDLKNKVSALRHNGA-TRADLGFKHASTVMSGA--- 715

Query: 277 RQHCNTEDANYKKIIVFMTDGENLSTKE-----DQQSLYYCNEAKKRGAIVYAIGI 327
                    + K++++F TDG      +        ++ Y    K  GA VY+IG+
Sbjct: 716 -------RTDAKRVVIFFTDGTPTKVSDFDKDVANSAVTYAKSLKDSGATVYSIGV 764


>gi|306821351|ref|ZP_07454960.1| von Willebrand factor [Eubacterium yurii subsp. margaretiae ATCC
           43715]
 gi|304550638|gb|EFM38620.1| von Willebrand factor [Eubacterium yurii subsp. margaretiae ATCC
           43715]
          Length = 467

 Score = 87.5 bits (215), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 36/209 (17%), Positives = 75/209 (35%), Gaps = 26/209 (12%)

Query: 158 ITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNN 217
            T  ++        +++  V+D S SM  + D +  + ++  K           I  + +
Sbjct: 13  FTFLIEDEKDKYDGINIAFVIDSSGSM-FYNDPNGLRREVTHKF----------IDRLTD 61

Query: 218 VVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
              + ++ F  K             L   +  +   G  TN    +  AY+   ++   R
Sbjct: 62  NDMAAVIGFDYKATVLEQFTSNKEKLHDAVDKIRSDG-GTNIGRAVSIAYDLFNNLDNNR 120

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
           +        Y K ++ +TDG+   ++E          AKK G  +Y IG+    S + L+
Sbjct: 121 K------EKYPKFLILLTDGDGDYSEEYTIL------AKKAGIKIYTIGLGNGVSEKLLK 168

Query: 338 ACA--SPNSFYLVENPHSMYDAFSHIGKD 364
             A  +   ++  ++   +   F  I   
Sbjct: 169 DIAKGTDGEYFHAKDASKLNKIFEKIADK 197


>gi|149638912|ref|XP_001511941.1| PREDICTED: similar to Collagen alpha-1(XII) chain [Ornithorhynchus
           anatinus]
          Length = 3176

 Score = 87.5 bits (215), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 53/267 (19%), Positives = 99/267 (37%), Gaps = 37/267 (13%)

Query: 111 VRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDA 170
            R++SL++  +  +  Y IS  +   +       I   T    + +  +  V + +    
Sbjct: 436 PRTSSLNVRDLSSDTEYQISVYAMKGLTSSEAVSIMEKTQPMKVQVECSRGVDIKA---- 491

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
             D++ ++D S S+      +  K+   ++ +       K      N VQ  LV +S   
Sbjct: 492 --DIVFLVDGSYSIG---IGNFIKVRAFLEVL------AKSFEISPNRVQISLVQYSRDP 540

Query: 231 EEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
              F L+       +   I      G STN+   + Y   +IF             +N  
Sbjct: 541 HTEFTLKKFTKVEDIIEAINTFPYRGGSTNTGKAMTYVREKIFVAS------KGSRSNVP 594

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NSF 345
           K+++ +TDG     K          + +     ++A+G++     E L   ASP      
Sbjct: 595 KVMILITDG-----KSSDAFKEPAIKLRNSDVEIFAVGVKDAVRSE-LETIASPPAETHV 648

Query: 346 YLVENPHSMYDAFSHIGKDIVTKRIWY 372
           Y VE+    +DAF  I  ++ T+ I  
Sbjct: 649 YTVED----FDAFQRISFEL-TQSICL 670



 Score = 85.2 bits (209), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 41/203 (20%), Positives = 80/203 (39%), Gaps = 30/203 (14%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D++ ++D S S+      +   I   I ++      V          + G+V +S+    
Sbjct: 192 DLIFLVDGSWSVGRN---NFKYILDFIAAL------VSAFDVGEEKTRVGVVQYSSDTRT 242

Query: 233 FFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKY-AYNQIFDMQGMRQHCNTEDANYKK 289
            F L   +  + L   IK +   G +T +   + Y   N   D  G R         + K
Sbjct: 243 EFNLNQYYQRNELLSAIKKIPYKGGNTMTGDAIDYLIKNTFTDAAGARIG-------FPK 295

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPN--SFYL 347
           + + +TDG     K   +      E + RG  V+++GI+   + E  +  ++P+    + 
Sbjct: 296 VAIVITDG-----KSQDEVEIPARELRNRGVEVFSLGIKAADAKELKQIASTPSLQHVFN 350

Query: 348 VENPHSMYDAFSHIGKDIVTKRI 370
           V N    +DA   I  +I+++  
Sbjct: 351 VAN----FDAIVDIQNEIISQVC 369



 Score = 66.3 bits (160), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 45/249 (18%), Positives = 82/249 (32%), Gaps = 24/249 (9%)

Query: 124  NEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRS 183
               Y ++    +             T      +P  SS+ +   T A  D+++++D S S
Sbjct: 1202 GTTYKVNVFGMFDGGESLPLIGQEMTTLSDSTVPPISSMGLECLTRAEADIVLLVDGSWS 1261

Query: 184  MESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEW--GVS 241
            +                 I+ ++E   + P     VQ  L  +S      + L       
Sbjct: 1262 IG------RPNFKTVRSFISRIVEVFDIGP---KRVQIALAQYSGDPRTEWQLNAYKDKK 1312

Query: 242  HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLS 301
            +L   +  L   G +T +   L       F  Q   +         +KI V +TDG    
Sbjct: 1313 NLLEAVANLPYKGGNTLTGMALN------FIRQNNFRPQAGMRPRARKIGVLITDG---- 1362

Query: 302  TKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHI 361
             K          + +  G  ++A+GI+    +E L+A A+        N    +   S I
Sbjct: 1363 -KSQDDVEAPSKKLRDEGVELFAVGIKNADENE-LKAVATDPDDTHAYNVAD-FSFLSSI 1419

Query: 362  GKDIVTKRI 370
             +D+     
Sbjct: 1420 VEDLTANLC 1428


>gi|311268548|ref|XP_003132103.1| PREDICTED: collagen alpha-5(VI) chain-like [Sus scrofa]
          Length = 2519

 Score = 87.5 bits (215), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 37/207 (17%), Positives = 75/207 (36%), Gaps = 26/207 (12%)

Query: 168 TDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFS 227
               +D+  ++D S S+ S     I K          MLE ++      + V+ G V +S
Sbjct: 435 DTKEVDIYFLIDGSGSIRSDHFEQIKKF---------MLEVIENFDIGPDKVRVGAVQYS 485

Query: 228 NKIEEFFLLEWGVSH--LQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDA 285
           +  E+ F +    +   L++ I  + + G  T +   L +    I   +G  Q  N    
Sbjct: 486 DTREKEFDITDYTTDETLRKAISNIRQLGGGTYTGEALDFILQII--KKGREQRINK--- 540

Query: 286 NYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSF 345
                ++ +TDG ++        L    + +     V+AIGI      +  +        
Sbjct: 541 -VPCYLIVLTDGMSMD-----DVLEPAEKLRAENIAVHAIGIGEANRTQLQQIAGKEERV 594

Query: 346 YLVENPHSMYDAFSHIGKDIVTKRIWY 372
              +N    +D+  +I  +++      
Sbjct: 595 SFGQN----FDSLKNIKNEVLHSICTE 617



 Score = 86.4 bits (212), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 48/228 (21%), Positives = 94/228 (41%), Gaps = 21/228 (9%)

Query: 139 LKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMA 198
            +  +F         ++  + +        +  LD++ VLD S S++     S+      
Sbjct: 780 FQVESFSDLQEIENKLIFRVCALHDCKRIKE--LDVVFVLDHSSSIQPRDQESM------ 831

Query: 199 IKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTN 258
              IN  +  VK      N VQ G + +SN+ +  F L    S +   ++ LS  G  T 
Sbjct: 832 ---INLTMHLVKKSDVGPNRVQFGALRYSNEPDIIFYLNSNRSAIMEYLRSLSAKGGDTY 888

Query: 259 STPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKR 318
           +   L+ A N +F      +H +    N K++++ +TDG++    +        ++ + +
Sbjct: 889 TAKALERA-NILFT----EEHGSRIKQNVKQMLIIITDGKS---HDHIHLSDKASKLRAK 940

Query: 319 GAIVYAIGIRVIRSHEFLRACASPNSF-YLVENPHSMYDAFSHIGKDI 365
           G I+YA+G+      E L   A    +   V N  S+ D +  + + +
Sbjct: 941 GIIIYAVGVGEAN-QEELETMAGNKHYTIHVSNFDSLKDVYQPLQESM 987



 Score = 84.8 bits (208), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 35/234 (14%), Positives = 84/234 (35%), Gaps = 28/234 (11%)

Query: 142 CTFIPWYTNSRHIVMPITSSV-KVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIK 200
            +F   + + ++I   +  S+       D + D+M ++D S S+                
Sbjct: 594 VSFGQNFDSLKNIKNEVLHSICTEKGCEDMKADIMFLVDSSGSIGP------ENFRTMKS 647

Query: 201 SINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLL-EWGV-SHLQRKIKYLSKFGVSTN 258
            +  +L ++++  D     + G+V FS+  +E F L  +     +   I+ +S    +T 
Sbjct: 648 FMKNLLAKIQIGLDK---TRIGVVQFSDVTKEEFKLDTYFTQKEISDAIERMSPIEQNTL 704

Query: 259 STPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKR 318
           +   L        + +G R          +K ++ +TDGE                 + +
Sbjct: 705 TGKALTSIEPYFTESKGARSM-------VRKFLILITDGE-----AQDDVRNPAKVLRDK 752

Query: 319 GAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIWY 372
           G +++A+G+      +        +  + VE+   +      I   ++ +    
Sbjct: 753 GVVIFAVGVFRANRTQLEEISGDSSLVFQVESFSDL----QEIENKLIFRVCAL 802



 Score = 49.8 bits (117), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 38/205 (18%), Positives = 71/205 (34%), Gaps = 26/205 (12%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D++ ++D S  +                 IN M+  +   P   +    GL  +S+K+  
Sbjct: 30  DVVFLVDSSDHLG------TKSFPYMKTFINKMINSL---PIETDKYHVGLAQYSDKLHT 80

Query: 233 FFLLEWGVSH---LQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
            F L    S    L    K     G S      L+  +   F     R+        +  
Sbjct: 81  EFQLNTFKSKGPMLNHLKKNFGFLGGSLRIGSALREVHRTYFSNGRDRKQ-------FPP 133

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVE 349
           I+V +      S   +          +K G  + ++G++ + S E L+A A+    Y + 
Sbjct: 134 ILVVL-----ASADSEDAVEEAAEALRKDGVRIISVGMQRV-SEETLKAMATGQFRYNLR 187

Query: 350 NPHSMYDAFSHIGKDIVTKRIWYDK 374
               +  AFS     ++ + I Y +
Sbjct: 188 TVRDL-SAFSQNMTQVLKEAIQYKE 211



 Score = 42.1 bits (97), Expect = 0.13,   Method: Composition-based stats.
 Identities = 28/199 (14%), Positives = 71/199 (35%), Gaps = 26/199 (13%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
           + D+  D++ ++D S         +   +      +  +   + +  +    ++ GL+++
Sbjct: 228 EKDSLADVIFLVDES-------VGTSQNLRNLQNFLKNITSYMDVKDNC---LRLGLMSY 277

Query: 227 SNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
           S++ E   +L+   S    Q++I+ LS     +N       A  ++          +   
Sbjct: 278 SDRAETLSVLKSSTSQAEFQKQIQKLSLRAGKSNVG----AAVEKMRREGFSASSGSRRA 333

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNS 344
               +I V +T     +   D +        +     V+A+GI      +     +    
Sbjct: 334 LGVPQIAVLVT-----NRPSDDEVREATLNLRLDDVTVFAMGIHGANKTQLEEIVS---- 384

Query: 345 FYLVENPHSMYDAFSHIGK 363
            Y      SM ++++ +G 
Sbjct: 385 -YPPRQTISMLESYADLGN 402


>gi|332232509|ref|XP_003265447.1| PREDICTED: collagen alpha-6(VI) chain [Nomascus leucogenys]
          Length = 2264

 Score = 87.5 bits (215), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 42/196 (21%), Positives = 78/196 (39%), Gaps = 27/196 (13%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D+M ++D S S+      + +K+   +K++      V       + VQ G+V FS+  +E
Sbjct: 623 DIMFLVDSSGSIGPE---NFSKMKTFMKNL------VSKSQIGPDQVQIGVVQFSDINKE 673

Query: 233 FFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKI 290
            F L   +S   +   I  ++  G +T +   L +        +G R        N +K 
Sbjct: 674 EFQLNRFMSQSDISNAIDQMAHIGQTTLTGSALSFVSQYFSPTKGARP-------NIRKF 726

Query: 291 IVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVEN 350
           ++ +TDGE                 ++ G I+Y++G+      +       P   + VEN
Sbjct: 727 LILITDGE-----AQDIVKEPAVVLRQEGVIIYSVGVFGSNVTQLEEISGRPEMVFYVEN 781

Query: 351 PHSMYDAFSHIGKDIV 366
               +D    I  D+V
Sbjct: 782 ----FDILQRIEDDLV 793



 Score = 85.6 bits (210), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 37/192 (19%), Positives = 76/192 (39%), Gaps = 19/192 (9%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ V+D S S+         + ++       M+  VK      N V+ G + +++  E
Sbjct: 809 LDVVFVIDSSGSI------DYDEYNIMKDF---MIGLVKKADVGKNQVRFGALKYADDPE 859

Query: 232 EFFLLEWGVSHLQ--RKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
             F LE   + L+    ++     G +T +   L   ++     +      N       +
Sbjct: 860 VLFYLEDFGTKLEVISVLQNDQAMGGNTYTAEAL--GFSDHMFTEARGSRLNKG---VPQ 914

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVE 349
           +++ +TDGE+    +  +        + +G +V A+GI      E L    S + ++ VE
Sbjct: 915 VLIVITDGES---HDADKLNATAKALRDKGILVLAVGIAGANPAELLAMAGSSDKYFFVE 971

Query: 350 NPHSMYDAFSHI 361
               +   FS +
Sbjct: 972 TFGGLKGIFSDV 983



 Score = 85.2 bits (209), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 55/356 (15%), Positives = 120/356 (33%), Gaps = 40/356 (11%)

Query: 34  LGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIK------ 87
           L M I  S +      L     ++   AA + + +   + R   +    + +I       
Sbjct: 284 LSMGINKSEVLQHIQNLSPRTGKAYTGAAIKKLRKEVFSARNGSRKNQGVPQIAVLVTHR 343

Query: 88  ---NTWNMSFRNELRDNGFVNDID-DIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCT 143
              +    +  N  R+   +  +  +    T L+ +     E Y     +   +     T
Sbjct: 344 DSEDNVTKAAVNLRREGVTIFTLGIEGASDTQLEKIASHPAEQYVSKLKTFADLAAHNQT 403

Query: 144 FIPWYTNSRHIVMPI----TSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAI 199
           F+    N     + +    T ++K         D+ +++D S S      +  T      
Sbjct: 404 FLKKLRNQITHTVSVFSERTETLKSGCVDTEEADIYLLIDGSGS------TQATDFHEMK 457

Query: 200 KSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVST 257
             ++A++    + P     V+ G V +++  +  F +        L + I+ + + G +T
Sbjct: 458 TFLSAVVGMFDIAPHK---VRVGAVQYADSWDLEFEINKYSNRQDLGKAIENIRQMGGNT 514

Query: 258 NSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKK 317
           N+   L +  + +   +  +Q  N         +V +T+G           L   N  ++
Sbjct: 515 NTGAALNFTLSLL--QKAKKQRGNK----VPCHLVVLTNG-----MSKDSILEPANRLRE 563

Query: 318 RGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
               VYAIG++     +           Y V +    +DA   I   +V +    +
Sbjct: 564 EHIRVYAIGVKEANQTQLREIAGEEKRVYYVHD----FDALKDIRNQVVQEICAEE 615



 Score = 80.2 bits (196), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 36/214 (16%), Positives = 83/214 (38%), Gaps = 22/214 (10%)

Query: 154  IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
            +   + +S KV+ + D  +D++ ++D S S++        K+   + S+      V+   
Sbjct: 983  VTASVCNSSKVDCEIDK-VDLVFLMDGSTSIQPN---DFKKMKEFLASV------VQDFD 1032

Query: 214  DVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIF 271
               N V+ G   FS+     F L    G   +  +I+ + +   +T+    L+   +   
Sbjct: 1033 VSLNRVRIGAAQFSDTYHPEFPLGTFIGEKEISFQIENIKQIFGNTHIGAALRKVEHYFR 1092

Query: 272  DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR 331
               G R      +    ++++ +TDG+        +        + RG  +Y++GI  + 
Sbjct: 1093 PDMGSRI-----NTGTPQVLLVLTDGQ-----SQDEVAQAAEALRHRGIDIYSVGIGDVD 1142

Query: 332  SHEFLRACASPNSFYLVENPHSMYDAFSHIGKDI 365
              + ++   +      V N   +      I ++I
Sbjct: 1143 DQQLIQITGTAEKKLTVHNFDELKKVNKRIVRNI 1176



 Score = 60.2 bits (144), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 38/249 (15%), Positives = 81/249 (32%), Gaps = 31/249 (12%)

Query: 111 VRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVK------- 163
                +  + V +    ++ A++  +      T       S+++   I    K       
Sbjct: 157 KDGVKIISIGVQKASEENLKAMATSQFHFNLRTVRDLSMFSQNMTHIIKDVTKYKEGAVD 216

Query: 164 ---VNSQTDARL-DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
              V +     + D++ +LD+S       + S    D     +    E V  +    N +
Sbjct: 217 DIFVEACQGPSVADVVFLLDMS------INGSEENFDYLKGFLE---ESVSALDIKENCM 267

Query: 220 QSGLVTFSNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + GLV +SN+ +    L  G   S + + I+ LS       +   +K    ++F     R
Sbjct: 268 RVGLVAYSNETKVINSLSMGINKSEVLQHIQNLSPRTGKAYTGAAIKKLRKEVFS---AR 324

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                      +I V +T         +          ++ G  ++ +GI      +  +
Sbjct: 325 NGSRKN-QGVPQIAVLVT-----HRDSEDNVTKAAVNLRREGVTIFTLGIEGASDTQLEK 378

Query: 338 ACASPNSFY 346
             + P   Y
Sbjct: 379 IASHPAEQY 387



 Score = 54.0 bits (128), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 37/217 (17%), Positives = 76/217 (35%), Gaps = 26/217 (11%)

Query: 158 ITSSVKVNSQTDARL-DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVN 216
           I S + VN  +     D++ ++D S  + S               I  M+  +   P   
Sbjct: 12  ICSHISVNQDSGPEYADVVFLVDSSDRLGS------RSFPFVKMFITKMINSL---PIEA 62

Query: 217 NVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKY-LSKFGVSTNSTPGLKYAYNQIFDM 273
           +  +  L  +S+K+   F L    G S +   ++  +   G S      L+ A+   F  
Sbjct: 63  DKYRVALAQYSDKLHSEFHLSTFKGRSPMLNHLRKNVGFIGGSLQIGKALQEAHRTYFSA 122

Query: 274 QGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSH 333
                  + +      ++V        S++ +   +      +K G  + +IG++     
Sbjct: 123 PAD--GRDKKQFPPILVVV-------ASSESEDDVVEASKALQKDGVKIISIGVQKASEE 173

Query: 334 EFLRACASPNSFYL---VENPHSMYDAFSHIGKDIVT 367
             L+A A+    +    V +        +HI KD+  
Sbjct: 174 N-LKAMATSQFHFNLRTVRDLSMFSQNMTHIIKDVTK 209


>gi|126341668|ref|XP_001379927.1| PREDICTED: hypothetical protein [Monodelphis domestica]
          Length = 2568

 Score = 87.5 bits (215), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 41/269 (15%), Positives = 100/269 (37%), Gaps = 33/269 (12%)

Query: 109 DIVRSTSLDIVVV-PQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQ 167
                  +       + E Y+++ + + +  +++ T + +    R+    I +       
Sbjct: 327 SYPPDHYISEQNSYAELEKYTVTLLKKLQYEVQYRTSVQYGQTERYRTGCIETEKA---- 382

Query: 168 TDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFS 227
                D+  ++D S S+  +F             +  +++   + P     V+ G V +S
Sbjct: 383 -----DIYFLIDGSGSVRPYF-------HEIKNFMIEVIQMFNVAP---EKVRFGAVQYS 427

Query: 228 NKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDA 285
           +  ++ F +     V  L + I  + + G +TN+   L+      F ++ ++     +  
Sbjct: 428 STHQQEFGISTYSNVVDLSKAILNIRQLGHTTNTGAALR------FMLEEIKSSKKKQHD 481

Query: 286 NYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSF 345
           +    ++ +TDG       + +        ++   I++AIG++     E      S +  
Sbjct: 482 SVPCHLLVVTDG-----MSNDEVSEPAKRLREEDVIIHAIGVKGANIIELKDIAGSEDRV 536

Query: 346 YLVENPHSMYDAFSHIGKDIVTKRIWYDK 374
             V N  S+    + I + I  +R   DK
Sbjct: 537 KFVYNFESLKGIKNEIVQTICRERDCKDK 565



 Score = 81.0 bits (198), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 37/195 (18%), Positives = 81/195 (41%), Gaps = 20/195 (10%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ VLD S S+         + +  I     ++E+  +     + VQ G + +S+  E
Sbjct: 753 LDIVFVLDDSSSISEH------QYESLINFTKHLVEKADV---GRDRVQFGALKYSDTPE 803

Query: 232 EFFLLEWGVSHLQRKIKYLS--KFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
             F L    +  +  I  L   + G +T +   L  ++          QH +      K+
Sbjct: 804 ILFYLNDYQNK-KSIIDKLKFQRKGGNTYTAKALNRSHELFT-----EQHGSRIKRGVKQ 857

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVE 349
           +++ +TDG++    +  +        + +  I+Y +G+      E L    S +++++V+
Sbjct: 858 MLIVITDGKS---HDYLELETVGKALRAKNIIIYGVGVAEASDKELLDITGSKDNYFMVD 914

Query: 350 NPHSMYDAFSHIGKD 364
           N   + + +  I K 
Sbjct: 915 NFEKLKEIYLPIEKK 929



 Score = 59.8 bits (143), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 34/189 (17%), Positives = 66/189 (34%), Gaps = 23/189 (12%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D R D+M ++D S+S+ +    +  KI + +K        V       + V  G+  +
Sbjct: 562 CKDKRADVMFLVDSSKSIGA---PAFNKIKIFMK------NMVNKSHVGLDQVHIGVGQY 612

Query: 227 SNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
           SN  +E F L   ++   +   I  ++  G  T +   L++  +         +      
Sbjct: 613 SNVFKEEFGLTEYMTQRDIFDAIDRMNFIGDKTYTGKALEFVSSYF-------EPLKGGR 665

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNS 344
              KK ++ +TDG                  +    ++  + I   +S +       PN 
Sbjct: 666 KGVKKFLILITDG-----FSQDSITEPALHLRNNEVVILLVAIFRSKSPQLEDITGDPNL 720

Query: 345 FYLVENPHS 353
            Y VE    
Sbjct: 721 VYYVEKFDD 729



 Score = 49.8 bits (117), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 44/288 (15%), Positives = 98/288 (34%), Gaps = 42/288 (14%)

Query: 72   NNRKKLKGGDILCRIKNTWNMSFRNELRD---NGFVNDIDDIVRSTSLDIVVVPQNEGYS 128
            N  K+   G  + R+   ++ S   ++             +I+ +      +    E + 
Sbjct: 1785 NAFKRTLPGPNVRRLTVFFSDSQSPDISSIITATMEFSGLNIIPAVFAFNDMFALEEAFQ 1844

Query: 129  ISAISRYK-IPLKFCTF------IPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVS 181
                  Y+ IP++   F      +   T       P   + +   Q  + +D + +LD S
Sbjct: 1845 FDDTGTYQVIPVRPSQFSHPIERLRRCTLCYDKCFPNVCAEEQIDQVHSYVDAIFLLDSS 1904

Query: 182  RSMESFFDSSITKIDMAIKSINAMLEEVK-LIPDVNNVV--QSGLVTFS----------N 228
            R +         + +     ++++L+          + V  +  L+++S           
Sbjct: 1905 RHVRG------DEFEQMKAFLSSVLDNFDISADPEQSDVGDRLALLSYSPRDFSIRRTST 1958

Query: 229  KIEEFFLLEWGVSH--LQRKI-KYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDA 285
             +++ F      S   ++R I   L +          L++  N +F       H      
Sbjct: 1959 PVKKEFDFTTYSSKALMRRHIHNSLKQLHGEAYVGHALQWTTNMVFSNTF---HSRKN-- 2013

Query: 286  NYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSH 333
               K+I  +T GEN   K+  + +     AK +G +++ I +   R  
Sbjct: 2014 ---KVIFVITAGENNENKDVLRKISL--RAKCQGYVIFVISLGSTREE 2056



 Score = 48.2 bits (113), Expect = 0.002,   Method: Composition-based stats.
 Identities = 38/295 (12%), Positives = 97/295 (32%), Gaps = 41/295 (13%)

Query: 58  LVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLD 117
           ++       +E +     +    D +  I      +   +L+         ++  + ++ 
Sbjct: 82  ILVVLASAKSEDDVEGPAEALRRDGVKIISLGIQDASEEDLKAMATSQYHYNLRTARNVG 141

Query: 118 IVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIV 177
           I    +N    I    ++K  ++                       +  + D+  D++ +
Sbjct: 142 I--FSENMTRIIKETIKHKEIIQ--------------DDDEVGEFSILCERDSLADIVFL 185

Query: 178 LDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLE 237
           LD S  +          ++   K +  +   + +        + G+++FS++ E    LE
Sbjct: 186 LDESLKVRRN-------LENLQKFLENITASMDI---KAGCTRIGILSFSDETEVVASLE 235

Query: 238 WGVSH--LQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMT 295
             ++H  + + I+ LS           +K A       + +  H        ++I V +T
Sbjct: 236 RDMTHDEIIQAIRSLSLRDGKAYIGAAMKKA-------RELFSHSRK-AQGVRQIAVLVT 287

Query: 296 DGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVEN 350
                    +        +   +G  ++ IGI+     +F +  + P   Y+ E 
Sbjct: 288 -----HRSSEDDMHEAAEDLLLQGVSIFGIGIKGYNITQFKQMVSYPPDHYISEQ 337


>gi|291399431|ref|XP_002716111.1| PREDICTED: matrilin 1, cartilage matrix protein [Oryctolagus
           cuniculus]
          Length = 497

 Score = 87.5 bits (215), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 31/209 (14%), Positives = 76/209 (36%), Gaps = 22/209 (10%)

Query: 162 VKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQS 221
            +         D++ V+D SRS+         + +     ++ ++E + + P+     + 
Sbjct: 30  ARGQLCRTRPTDLVFVVDSSRSVRP------VEFEKVKVFLSQVIESLDVGPNA---TRV 80

Query: 222 GLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQH 279
           G+V +++ + + F L      + L + ++ +      T +   +++A  +        + 
Sbjct: 81  GVVNYASAVRQEFPLRAHGSKAALLQAVRRIRPLATGTMTGLAIQFAITKALSDAEGGRV 140

Query: 280 CNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRAC 339
            +       K+++ +TDG    +  D         A+  G  ++AIG+        LR  
Sbjct: 141 TSPG---ISKVVIVVTDGRPQDSVRDVS-----ERARASGVELFAIGVGGRVDKATLRQI 192

Query: 340 AS---PNSFYLVENPHSMYDAFSHIGKDI 365
           AS         VE+   +        +  
Sbjct: 193 ASEPQDEHVDYVESYSVIEKLSKKFREAF 221



 Score = 84.4 bits (207), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 39/220 (17%), Positives = 83/220 (37%), Gaps = 30/220 (13%)

Query: 159 TSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNV 218
           T +V       +  D++ ++D S+S+           ++  K IN +++ + +      +
Sbjct: 262 TCNVCSGGGGSSATDLVFLIDGSKSVRP------ENFELVKKFINQIVDTLDVSD---RL 312

Query: 219 VQSGLVTFSNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAY-NQIFDMQG 275
            Q GLV +S+ + + F L        ++  ++ +S     T +   LKY   N      G
Sbjct: 313 AQVGLVQYSSSVRQEFPLGRFHTKKDIKAAVRNMSYMEKGTMTGAALKYLIDNSFTVSSG 372

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF 335
            R          +K+ +  TDG +     D        +AK  G  ++A+G+      E 
Sbjct: 373 ARPGA-------QKVGIVFTDGRSQDYINDA-----AKKAKDLGFKMFAVGVGNAVEDEL 420

Query: 336 LRACASP--NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
               + P    ++   +    +   + IGK +  +    +
Sbjct: 421 REIASEPVAEHYFYTAD----FKTITQIGKKLQKRICVEE 456


>gi|148694466|gb|EDL26413.1| procollagen, type XII, alpha 1, isoform CRA_b [Mus musculus]
 gi|148694467|gb|EDL26414.1| procollagen, type XII, alpha 1, isoform CRA_b [Mus musculus]
          Length = 2886

 Score = 87.5 bits (215), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 42/279 (15%), Positives = 97/279 (34%), Gaps = 34/279 (12%)

Query: 101 NGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIP--LKFCTFIPWYTNSRHIVMPI 158
           +G   +      +T   +  +     Y ++  S  ++   +     +   T         
Sbjct: 64  DGPTKEFTLAASTTETLLSDLIPETQYVVTITSYNEVEESVPVIGQLTIQTGGPTKPGEK 123

Query: 159 -TSSVKVNSQTDAR-LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVN 216
                ++   + +   D++ ++D S S+                 ++ ++  V       
Sbjct: 124 KPGKTEIQKCSVSAWTDLVFLVDGSWSVGRNN---------FKYILDFIVALVSAFDIGE 174

Query: 217 NVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKY-AYNQIFDM 273
              + G+V +S+     F L   +    L   +K +   G +T +   + Y   N   + 
Sbjct: 175 EKTRVGVVQYSSDTRTEFNLNQYYRREDLLAAVKKIPYKGGNTMTGDAIDYLVKNTFTES 234

Query: 274 QGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSH 333
            G R         + K+ + +TDG     K   +      E +  G  V+++GI+   + 
Sbjct: 235 AGSRAG-------FPKVAIIITDG-----KSQDEVEIPARELRNIGVEVFSLGIKAADAK 282

Query: 334 EFLRACASP--NSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           E  +  ++P  N  + V N    +DA   I  +I+++  
Sbjct: 283 ELKQIASTPSLNHVFNVAN----FDAIVDIQNEIISQVC 317



 Score = 85.6 bits (210), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 53/267 (19%), Positives = 106/267 (39%), Gaps = 37/267 (13%)

Query: 111 VRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDA 170
            ++T+L++  +  +  Y IS  +   +     T +   T    + +  +  V + +    
Sbjct: 384 PQTTTLNVRDLTADTEYQISVFAMKGLTSSEPTSVMEKTQPMKVQVECSRGVDIKA---- 439

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
             D++ ++D S S+     ++  K+   ++ +       K      N VQ  LV +S   
Sbjct: 440 --DIVFLVDGSYSIG---IANFVKVRAFLEVL------AKSFEISPNRVQISLVQYSRDP 488

Query: 231 EEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
              F L+    V  + + I      G STN+   + Y   +IF             +N  
Sbjct: 489 HTEFTLKEFNRVEDIIKAINTFPYRGGSTNTGKAMTYVREKIFVPN------KGSRSNVP 542

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NSF 345
           K+++ +TDG++     D        + +     ++A+G++     E L A ASP      
Sbjct: 543 KVMILITDGKSSDAFRD-----PAIKLRNSDVEIFAVGVKDAVRSE-LEAIASPPAETHV 596

Query: 346 YLVENPHSMYDAFSHIGKDIVTKRIWY 372
           + VE+    +DAF  I  ++ T+ I  
Sbjct: 597 FTVED----FDAFQRISFEL-TQSICL 618



 Score = 60.9 bits (146), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 43/251 (17%), Positives = 83/251 (33%), Gaps = 28/251 (11%)

Query: 124  NEGYSISAISRYK--IPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVS 181
               Y ++    +     L          +   +   ++S +   ++ +A  D+++++D S
Sbjct: 1150 GTTYRVNVFGMFDGGESLPLVGQEMTTLSDTTVTPFLSSGMDCLTRAEA--DIVLLVDGS 1207

Query: 182  RSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLE--WG 239
             S+                 I+ ++E  ++ P     VQ  L  +S      + L     
Sbjct: 1208 WSIG------RANFRTVRSFISRIVEVFEIGP---KRVQIALAQYSGDPRTEWQLNAHRD 1258

Query: 240  VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGEN 299
               L + +  L   G +T +   L +   Q F  Q             +KI V +TDG  
Sbjct: 1259 KKSLLQAVANLPYKGGNTLTGMALNFIRQQSFKTQ------AGMRPRARKIGVLITDG-- 1310

Query: 300  LSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFS 359
               K          + K  G  ++AIGI+     E       P+      N    +++ S
Sbjct: 1311 ---KSQDDVEAPSKKLKDEGVELFAIGIKNADEVELKMIATDPDDT-HAYNVAD-FESLS 1365

Query: 360  HIGKDIVTKRI 370
             I  D+     
Sbjct: 1366 KIVDDLTINLC 1376


>gi|183583553|ref|NP_694996.5| collagen alpha-5(VI) chain [Homo sapiens]
          Length = 2526

 Score = 87.5 bits (215), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 63/349 (18%), Positives = 127/349 (36%), Gaps = 53/349 (15%)

Query: 41  SHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRD 100
            + +F +  +   IDR  +      +NEG          G  L  +   +  S    L  
Sbjct: 682 LNRYFTQQEISDAIDRMSL------INEGTLT-------GKALNFVGQYFTHSKGARLGA 728

Query: 101 NGFVNDIDDIVRSTSL-DIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNS-------- 151
             F+  I D V    + D   + + +  +I ++  Y         I   ++         
Sbjct: 729 KKFLILITDGVAQDDVRDPARILRGKDVTIFSVGVYNANRSQLEEISGDSSLVFHVENFD 788

Query: 152 ------RHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAM 205
                 R ++  + +       T   LD++ VLD S S++  +   +         IN  
Sbjct: 789 HLKALERKLIFRVCALHDCKRITL--LDVVFVLDHSGSIKKQYQDHM---------INLT 837

Query: 206 LEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGL 263
           +  VK      + VQ G + +S++    F L      S +   ++     G +T +   L
Sbjct: 838 IHLVKKADVGRDRVQFGALKYSDQPNILFYLNTYSNRSAIIENLRKRRDTGGNTYTAKAL 897

Query: 264 KYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVY 323
           K+A N +F      +H +    N K++++ +TDGE+    +   +     E + +G  ++
Sbjct: 898 KHA-NALFT----EEHGSRIKQNVKQMLIVITDGESHDHDQLNDTAL---ELRNKGITIF 949

Query: 324 AIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIWY 372
           A+G+      E      + N+   V+N   + D F+     +  +    
Sbjct: 950 AVGVGKANQKELEGMAGNKNNTIYVDNFDKLKDVFT----LVQERMCTE 994



 Score = 79.0 bits (193), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 33/192 (17%), Positives = 70/192 (36%), Gaps = 23/192 (11%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
               D + D+M ++D S S+    + +  K+ + +K++      +  I    +  Q G+V
Sbjct: 620 KGCEDMKADIMFLVDSSWSIG---NENFRKMKIFMKNL------LTKIQIGADKTQIGVV 670

Query: 225 TFSNKIEEFFLL-EWGV-SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS+K +E F L  +     +   I  +S     T +   L +        +G R     
Sbjct: 671 QFSDKTKEEFQLNRYFTQQEISDAIDRMSLINEGTLTGKALNFVGQYFTHSKGARLGA-- 728

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                KK ++ +TDG                  + +   ++++G+      +        
Sbjct: 729 -----KKFLILITDG-----VAQDDVRDPARILRGKDVTIFSVGVYNANRSQLEEISGDS 778

Query: 343 NSFYLVENPHSM 354
           +  + VEN   +
Sbjct: 779 SLVFHVENFDHL 790



 Score = 72.9 bits (177), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 35/204 (17%), Positives = 72/204 (35%), Gaps = 27/204 (13%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D+  ++D S S++      I +          MLE  ++     + V+ G+V +S+  E 
Sbjct: 442 DIHFLIDGSSSIQEKQFEQIKRF---------MLEVTEMFSIGPDKVRVGVVQYSDDTEV 492

Query: 233 FFLLEWGVSHL--QRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKI 290
            F +    + +  ++ I  + +    T +   L Y    I +    R             
Sbjct: 493 EFYITDYSNDIDLRKAIFNIKQLTGGTYTGKALDYILQIIKNGMKDRMSK------VPCY 546

Query: 291 IVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVEN 350
           ++ +TDG +       + +      +     V+A+GI      E              +N
Sbjct: 547 LIVLTDGMSTD-----RVVEPAKRLRAEQITVHAVGIGAANKIELQEIAGKEERVSFGQN 601

Query: 351 PHSMYDAFSHIGKDIVTKRIWYDK 374
               +DA   I  ++V + I  +K
Sbjct: 602 ----FDALKSIKNEVV-REICAEK 620



 Score = 51.3 bits (121), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 29/185 (15%), Positives = 64/185 (34%), Gaps = 22/185 (11%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D++ ++D S  +                 IN M+  +   P   N  +  L  +S++   
Sbjct: 30  DVVFLVDSSDHLGP------KSFPFVKTFINKMINSL---PIEANKYRVALAQYSDEFHS 80

Query: 233 FFLLEW--GVSHLQRKIKY-LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
            F L    G S +   +K      G S      L+ A+   F      +    +   +  
Sbjct: 81  EFHLSTFKGRSPMLNHLKKNFQFIGGSLQIGKALQEAHRTYFSAPINGR----DRKQFPP 136

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVE 349
           I+V +      S + + +        +K G  + ++G++       L+A A+ +  + + 
Sbjct: 137 ILVVL-----ASAESEDEVEEASKALQKDGVKIISVGVQKASEEN-LKAMATSHFHFNLR 190

Query: 350 NPHSM 354
               +
Sbjct: 191 TIRDL 195


>gi|297678514|ref|XP_002817115.1| PREDICTED: collagen alpha-1(XII) chain-like isoform 1 [Pongo
           abelii]
          Length = 3115

 Score = 87.1 bits (214), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 46/279 (16%), Positives = 100/279 (35%), Gaps = 34/279 (12%)

Query: 101 NGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIP--LKFCTFIPWYTNSRHIVMPI 158
           +G   +      +T   +  +     Y ++  S  ++   +     +   T S    +  
Sbjct: 64  DGPTKEFTLAASTTETLLSELVPETEYVVTITSYDEVEESVPVIGQLTIQTGSSTKPVEK 123

Query: 159 -TSSVKVNSQTDAR-LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVN 216
                ++   + +   D++ ++D S S+      +   I   I ++      V       
Sbjct: 124 KPGKTEIQKCSVSAWTDLVFLVDGSWSVGRN---NFKYILDFIAAL------VSAFDIGE 174

Query: 217 NVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKY-AYNQIFDM 273
              + G+V +S+     F L   +    L   IK +   G +T +   + Y   N   + 
Sbjct: 175 EKTRVGVVQYSSDTRTEFNLNQYYQRDELLAAIKKIPYKGGNTMTGDAIDYLVKNTFTES 234

Query: 274 QGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSH 333
            G R         + K+ + +TDG     K   +      E +  G  V+++GI+   + 
Sbjct: 235 AGARVG-------FPKVAIIITDG-----KSQDEVEIPARELRNVGVEVFSLGIKAADAK 282

Query: 334 EFLRACASP--NSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           E  +  ++P  N  + V N    +DA   I  +I+++  
Sbjct: 283 ELKQIASTPSLNHVFNVAN----FDAIVDIQNEIISQVC 317



 Score = 87.1 bits (214), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 53/267 (19%), Positives = 103/267 (38%), Gaps = 37/267 (13%)

Query: 111 VRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDA 170
            ++T+L +  +  +  Y IS  +   +       I   T    + +  +  V + +    
Sbjct: 384 PQTTTLSVRDLSADTEYQISVSAMKGMTSSEPISIMEKTQPMKVQVECSRGVDIKA---- 439

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
             D++ ++D S S+     ++  K+   ++ +      VK      N VQ  LV +S   
Sbjct: 440 --DIVFLVDGSYSIG---IANFVKVRAFLEVL------VKSFEISPNRVQISLVQYSRDP 488

Query: 231 EEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
              F L+       +   I      G STN+   + Y   +IF             +N  
Sbjct: 489 HTEFTLKKFTKVEDIIEAINTFPYRGGSTNTGKAMTYVREKIF------VPSKGSRSNVP 542

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NSF 345
           K+++ +TDG++     D        + +     ++A+G++     E L A ASP      
Sbjct: 543 KVMILITDGKSSDAFRD-----PAIKLRNSDVEIFAVGVKDAVRSE-LEAIASPPAETHV 596

Query: 346 YLVENPHSMYDAFSHIGKDIVTKRIWY 372
           + VE+    +DAF  I  ++ T+ I  
Sbjct: 597 FTVED----FDAFQRISFEL-TQSICL 618



 Score = 59.8 bits (143), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 41/205 (20%), Positives = 69/205 (33%), Gaps = 24/205 (11%)

Query: 168  TDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFS 227
            T A  D+++++D S S+                 I+ ++E   + P     VQ  L  +S
Sbjct: 1191 TRAEADIVLLVDGSWSIG------RANFRTVRSFISRIVEVFDIGP---KRVQVALAQYS 1241

Query: 228  NKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDA 285
                  + L        L + +  L   G +T +   L +   Q F  Q           
Sbjct: 1242 GDPRTEWQLNAHRDKKSLLQAVANLPYKGGNTLTGMALNFIRQQNFRTQ------AGMRP 1295

Query: 286  NYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSF 345
              +KI V +TDG     K          + K  G  ++AIGI+     E       P+  
Sbjct: 1296 RARKIGVLITDG-----KSQDDVEAPSKKLKDEGVELFAIGIKNADEVELKMIATDPDDT 1350

Query: 346  YLVENPHSMYDAFSHIGKDIVTKRI 370
                N    +++ S I  D+     
Sbjct: 1351 -HAYNVAD-FESLSRIVDDLTINLC 1373


>gi|297286914|ref|XP_001113364.2| PREDICTED: collagen alpha-6(VI) chain-like [Macaca mulatta]
          Length = 2262

 Score = 87.1 bits (214), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 41/196 (20%), Positives = 78/196 (39%), Gaps = 27/196 (13%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D+M ++D S S+      + +K+   +K++      V       + VQ G+V FS+  +E
Sbjct: 623 DIMFLVDSSGSIGPE---NFSKMKTFMKNL------VSKSQIGPDRVQIGVVQFSDINKE 673

Query: 233 FFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKI 290
            F L   +S   +   I  ++  G +T +   L +        +G R        + +K 
Sbjct: 674 EFQLNRFMSQSDISNAIDQMAHIGQTTLTGSALSFVSQYFSPTKGSRP-------SVRKF 726

Query: 291 IVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVEN 350
           ++ +TDGE                 ++ G I+Y++G+      +       P   + VEN
Sbjct: 727 LILITDGE-----AQDIVKEPAVALRQEGVIIYSVGVFGSNVTQLEEISGRPEMVFYVEN 781

Query: 351 PHSMYDAFSHIGKDIV 366
               +D    I  D+V
Sbjct: 782 ----FDILQRIEDDLV 793



 Score = 82.5 bits (202), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 38/227 (16%), Positives = 91/227 (40%), Gaps = 24/227 (10%)

Query: 144  FIPWYTNSRHIVMPITSSVKVNS---QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIK 200
            F+  +   + I+  +T+SV  +S       ++D++ ++D S S++    +   K+   + 
Sbjct: 969  FVETFGGLKGIISDVTASVCNSSKVDCEIDKVDLVFLMDGSTSIQ---QTDFKKMKEFMV 1025

Query: 201  SINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTN 258
            S+      V+     N  V+ G   FS+     F L    G   +  +I+ +++   +T+
Sbjct: 1026 SV------VQDFDVSNKRVRIGAAQFSDAYRPEFPLGTFIGAKEISIQIENITQIFGNTH 1079

Query: 259  STPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKR 318
                L+   +      G R      +    ++++ +TDG+        +        ++R
Sbjct: 1080 IGAALRKVEHYFRPDMGSRI-----NTGTPQVLLVLTDGQ-----SQDEVAQAAEALRRR 1129

Query: 319  GAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDI 365
            G  +Y++GI  +   + ++   +      V N   +      I ++I
Sbjct: 1130 GIDIYSVGIGDVDDQQLMQITGTAEKKLTVHNFDELKKVNKRIVRNI 1176



 Score = 82.1 bits (201), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 35/205 (17%), Positives = 77/205 (37%), Gaps = 23/205 (11%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++ V+D S S+         + ++       M++ V+      N V+ G + +++  E
Sbjct: 809 LDVVFVIDSSGSI------DYDEYNIMKDF---MIDIVRKADVGMNRVRFGALKYADDPE 859

Query: 232 EFFLLEW-GVS-HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
             F L+  G    +   ++     G +T +   L   ++     +      N       +
Sbjct: 860 VLFYLDNFGTKPEVISVLQTDQAMGGNTYTAEAL--GFSDHMFTEARGSRLNKG---VPQ 914

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVE 349
           +++ +TDG++    +  +        + +G +V A+GI      E L    S + ++ VE
Sbjct: 915 VLIVITDGDS---HDADKLNATAKALRDKGILVLAVGIADANPVELLAMAGSSDKYFFVE 971

Query: 350 NPHSMYDAFSHIGKDIVTKRIWYDK 374
               +      I  D+        K
Sbjct: 972 TFGGL----KGIISDVTASVCNSSK 992



 Score = 81.7 bits (200), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 55/356 (15%), Positives = 118/356 (33%), Gaps = 40/356 (11%)

Query: 34  LGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIK------ 87
           L M I  S +      L     ++   AA + + +   + R   +    + +I       
Sbjct: 284 LSMGINKSEVLQHIQNLSPRTGKAYTGAAIKKLRKEVFSARNGSRKNQGVPQIAVLVTHR 343

Query: 88  ---NTWNMSFRNELRDNGFVNDID-DIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCT 143
              +    +  N  R+   +  +       T L+ +     E Y     +   +     T
Sbjct: 344 DSEDNVTKAAVNLRREGVTIFTLGIKGASDTQLEKIASHPAEQYVSKLKTFADLAAHNQT 403

Query: 144 FIPWYTNSRHIVMPI----TSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAI 199
           F+    N     + +    T ++K         D+ +++D S S      +  T      
Sbjct: 404 FLKKLRNQITHTVSVFSERTETLKSGCVDTEEADIYLLIDGSGS------TQATDFHEMK 457

Query: 200 KSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVST 257
             ++ ++    + P     V+ G V +++  +  F +        L + I+ + + G +T
Sbjct: 458 IFLSEVVGMFNIAPHK---VRVGAVQYADSWDLEFEINKYSNKQDLGKAIENIRQLGGNT 514

Query: 258 NSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKK 317
           N+   L +  + +   +  +Q  N         +V +T+G           L   N  ++
Sbjct: 515 NTGAALNFTLSLL--QKAKKQRGNK----VPCHLVVLTNG-----MSKDSILEPANRLRE 563

Query: 318 RGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
               VYAIGI+     +           Y V +    +DA   I   +V +    +
Sbjct: 564 EHIRVYAIGIKEANQTQLREIAGEEKRVYYVHD----FDALKDIRNQVVQEICAEE 615



 Score = 61.7 bits (148), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 39/249 (15%), Positives = 83/249 (33%), Gaps = 31/249 (12%)

Query: 111 VRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVK------- 163
                +  V V +    ++ A++  +      T       S+++   I    K       
Sbjct: 157 KDGVKIISVGVQKASEENLKAMATSQFHFNLRTVRDLSMFSQNMTQIIKDVAKYKEGAVD 216

Query: 164 ---VNSQTDARL-DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
              V +     + D++ +LD+S       + S   +D     +    E V  +    N +
Sbjct: 217 DIFVEACQGPSMADVVFLLDMS------INGSDENLDYLKGFLE---ESVSALDIKENCM 267

Query: 220 QSGLVTFSNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + GLV +SN+ +    L  G   S + + I+ LS       +   +K    ++F     R
Sbjct: 268 RIGLVAYSNETKVINSLSMGINKSEVLQHIQNLSPRTGKAYTGAAIKKLRKEVFS---AR 324

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                      +I V +T         +          ++ G  ++ +GI+     +  +
Sbjct: 325 NGSRKN-QGVPQIAVLVT-----HRDSEDNVTKAAVNLRREGVTIFTLGIKGASDTQLEK 378

Query: 338 ACASPNSFY 346
             + P   Y
Sbjct: 379 IASHPAEQY 387



 Score = 50.5 bits (119), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 34/206 (16%), Positives = 70/206 (33%), Gaps = 24/206 (11%)

Query: 154 IVMPITSSVKVNSQTDAR--LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKL 211
           + + IT S    SQ       D++ ++D S  + S               I  M+  +  
Sbjct: 7   LFLMITCSHISVSQDSGPKYADVVFLVDSSDRLGS------RSFPFVKMFITKMINSL-- 58

Query: 212 IPDVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKY-LSKFGVSTNSTPGLKYAYN 268
            P   +  +  L  +S+K+   F L    G S +   +K      G S      L+ A+ 
Sbjct: 59  -PIEADKYRVALAQYSDKLHSEFHLSTFKGRSPMLNHLKKNFGFIGGSLQIGKALQEAHR 117

Query: 269 QIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR 328
             F      +        +  I+V +      S++ +          +K G  + ++G++
Sbjct: 118 TYFSATTNGRDKK----QFPPILVVL-----ASSESEDDVEKASKALQKDGVKIISVGVQ 168

Query: 329 VIRSHEFLRACASPNSFYLVENPHSM 354
                  L+A A+    + +     +
Sbjct: 169 KASEEN-LKAMATSQFHFNLRTVRDL 193


>gi|189082691|sp|A8TX70|CO6A5_HUMAN RecName: Full=Collagen alpha-5(VI) chain; AltName: Full=Collagen
           alpha-1(XXIX) chain; AltName: Full=von Willebrand factor
           A domain-containing protein 4; Flags: Precursor
 gi|158828630|gb|ABW81241.1| collagen XXIX alpha 1 [Homo sapiens]
          Length = 2615

 Score = 87.1 bits (214), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 63/349 (18%), Positives = 127/349 (36%), Gaps = 53/349 (15%)

Query: 41  SHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRD 100
            + +F +  +   IDR  +      +NEG          G  L  +   +  S    L  
Sbjct: 682 LNRYFTQQEISDAIDRMSL------INEGTLT-------GKALNFVGQYFTHSKGARLGA 728

Query: 101 NGFVNDIDDIVRSTSL-DIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNS-------- 151
             F+  I D V    + D   + + +  +I ++  Y         I   ++         
Sbjct: 729 KKFLILITDGVAQDDVRDPARILRGKDVTIFSVGVYNANRSQLEEISGDSSLVFHVENFD 788

Query: 152 ------RHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAM 205
                 R ++  + +       T   LD++ VLD S S++  +   +         IN  
Sbjct: 789 HLKALERKLIFRVCALHDCKRITL--LDVVFVLDHSGSIKKQYQDHM---------INLT 837

Query: 206 LEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGL 263
           +  VK      + VQ G + +S++    F L      S +   ++     G +T +   L
Sbjct: 838 IHLVKKADVGRDRVQFGALKYSDQPNILFYLNTYSNRSAIIENLRKRRDTGGNTYTAKAL 897

Query: 264 KYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVY 323
           K+A N +F      +H +    N K++++ +TDGE+    +   +     E + +G  ++
Sbjct: 898 KHA-NALFT----EEHGSRIKQNVKQMLIVITDGESHDHDQLNDTAL---ELRNKGITIF 949

Query: 324 AIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIWY 372
           A+G+      E      + N+   V+N   + D F+     +  +    
Sbjct: 950 AVGVGKANQKELEGMAGNKNNTIYVDNFDKLKDVFT----LVQERMCTE 994



 Score = 78.7 bits (192), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 33/192 (17%), Positives = 70/192 (36%), Gaps = 23/192 (11%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
               D + D+M ++D S S+    + +  K+ + +K++      +  I    +  Q G+V
Sbjct: 620 KGCEDMKADIMFLVDSSWSIG---NENFRKMKIFMKNL------LTKIQIGADKTQIGVV 670

Query: 225 TFSNKIEEFFLL-EWGV-SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS+K +E F L  +     +   I  +S     T +   L +        +G R     
Sbjct: 671 QFSDKTKEEFQLNRYFTQQEISDAIDRMSLINEGTLTGKALNFVGQYFTHSKGARLGA-- 728

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                KK ++ +TDG                  + +   ++++G+      +        
Sbjct: 729 -----KKFLILITDG-----VAQDDVRDPARILRGKDVTIFSVGVYNANRSQLEEISGDS 778

Query: 343 NSFYLVENPHSM 354
           +  + VEN   +
Sbjct: 779 SLVFHVENFDHL 790



 Score = 72.9 bits (177), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 35/204 (17%), Positives = 72/204 (35%), Gaps = 27/204 (13%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D+  ++D S S++      I +          MLE  ++     + V+ G+V +S+  E 
Sbjct: 442 DIHFLIDGSSSIQEKQFEQIKRF---------MLEVTEMFSIGPDKVRVGVVQYSDDTEV 492

Query: 233 FFLLEWGVSHL--QRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKI 290
            F +    + +  ++ I  + +    T +   L Y    I +    R             
Sbjct: 493 EFYITDYSNDIDLRKAIFNIKQLTGGTYTGKALDYILQIIKNGMKDRMSK------VPCY 546

Query: 291 IVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVEN 350
           ++ +TDG +       + +      +     V+A+GI      E              +N
Sbjct: 547 LIVLTDGMSTD-----RVVEPAKRLRAEQITVHAVGIGAANKIELQEIAGKEERVSFGQN 601

Query: 351 PHSMYDAFSHIGKDIVTKRIWYDK 374
               +DA   I  ++V + I  +K
Sbjct: 602 ----FDALKSIKNEVV-REICAEK 620



 Score = 51.3 bits (121), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 29/185 (15%), Positives = 64/185 (34%), Gaps = 22/185 (11%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D++ ++D S  +                 IN M+  +   P   N  +  L  +S++   
Sbjct: 30  DVVFLVDSSDHLGP------KSFPFVKTFINKMINSL---PIEANKYRVALAQYSDEFHS 80

Query: 233 FFLLEW--GVSHLQRKIKY-LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
            F L    G S +   +K      G S      L+ A+   F      +    +   +  
Sbjct: 81  EFHLSTFKGRSPMLNHLKKNFQFIGGSLQIGKALQEAHRTYFSAPINGR----DRKQFPP 136

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVE 349
           I+V +      S + + +        +K G  + ++G++       L+A A+ +  + + 
Sbjct: 137 ILVVL-----ASAESEDEVEEASKALQKDGVKIISVGVQKASEEN-LKAMATSHFHFNLR 190

Query: 350 NPHSM 354
               +
Sbjct: 191 TIRDL 195


>gi|260782980|ref|XP_002586557.1| hypothetical protein BRAFLDRAFT_106340 [Branchiostoma floridae]
 gi|229271674|gb|EEN42568.1| hypothetical protein BRAFLDRAFT_106340 [Branchiostoma floridae]
          Length = 534

 Score = 87.1 bits (214), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 41/224 (18%), Positives = 83/224 (37%), Gaps = 31/224 (13%)

Query: 150 NSRHIVMPITSSVKVNSQTDAR----LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAM 205
           ++R I      S+ + S         LD++ V+D S S+ S    S+ K           
Sbjct: 120 SARTIERSDCKSLIIESGPGTPAKTELDLVFVIDGSGSISSVSFGSVMKFAA-------- 171

Query: 206 LEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSH--LQRKIKYLSKFGVSTNSTPGL 263
            +    +       + G+V +S  +   F+L+   +   +++ I  + + G  TN+   L
Sbjct: 172 -DMSLRLDISATTTRVGMVQYSTNVTPEFMLKEHTTKKSVEKAIGDVKRLGGGTNTGKAL 230

Query: 264 KYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVY 323
           K+           R   +  D   K++ + +TDG     K            ++ G ++Y
Sbjct: 231 KFV----------RTEMDWRDPPTKRVAIVVTDG-----KSQDDVGTPATALRQAGVVLY 275

Query: 324 AIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVT 367
           A+G+ +  + E       P   Y + +   + D    I   +V 
Sbjct: 276 AVGVGLP-TDELKEITGDPTKVYALNSYDELQDIIQDISNSVVE 318


>gi|119599630|gb|EAW79224.1| hypothetical protein FLJ35880 [Homo sapiens]
          Length = 2531

 Score = 87.1 bits (214), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 63/349 (18%), Positives = 127/349 (36%), Gaps = 53/349 (15%)

Query: 41  SHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRD 100
            + +F +  +   IDR  +      +NEG          G  L  +   +  S    L  
Sbjct: 627 LNRYFTQQEISDAIDRMSL------INEGTLT-------GKALNFVGQYFTHSKGARLGA 673

Query: 101 NGFVNDIDDIVRSTSL-DIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNS-------- 151
             F+  I D V    + D   + + +  +I ++  Y         I   ++         
Sbjct: 674 KKFLILITDGVAQDDVRDPARILRGKDVTIFSVGVYNANRSQLEEISGDSSLVFHVENFD 733

Query: 152 ------RHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAM 205
                 R ++  + +       T   LD++ VLD S S++  +   +         IN  
Sbjct: 734 HLKALERKLIFRVCALHDCKRITL--LDVVFVLDHSGSIKKQYQDHM---------INLT 782

Query: 206 LEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGL 263
           +  VK      + VQ G + +S++    F L      S +   ++     G +T +   L
Sbjct: 783 IHLVKKADVGRDRVQFGALKYSDQPNILFYLNTYSNRSAIIENLRKRRDTGGNTYTAKAL 842

Query: 264 KYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVY 323
           K+A N +F      +H +    N K++++ +TDGE+    +   +     E + +G  ++
Sbjct: 843 KHA-NALFT----EEHGSRIKQNVKQMLIVITDGESHDHDQLNDTAL---ELRNKGITIF 894

Query: 324 AIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIWY 372
           A+G+      E      + N+   V+N   + D F+     +  +    
Sbjct: 895 AVGVGKANQKELEGMAGNKNNTIYVDNFDKLKDVFT----LVQERMCTE 939



 Score = 78.7 bits (192), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 33/192 (17%), Positives = 70/192 (36%), Gaps = 23/192 (11%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
               D + D+M ++D S S+    + +  K+ + +K++      +  I    +  Q G+V
Sbjct: 565 KGCEDMKADIMFLVDSSWSIG---NENFRKMKIFMKNL------LTKIQIGADKTQIGVV 615

Query: 225 TFSNKIEEFFLL-EWGV-SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS+K +E F L  +     +   I  +S     T +   L +        +G R     
Sbjct: 616 QFSDKTKEEFQLNRYFTQQEISDAIDRMSLINEGTLTGKALNFVGQYFTHSKGARLGA-- 673

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                KK ++ +TDG                  + +   ++++G+      +        
Sbjct: 674 -----KKFLILITDG-----VAQDDVRDPARILRGKDVTIFSVGVYNANRSQLEEISGDS 723

Query: 343 NSFYLVENPHSM 354
           +  + VEN   +
Sbjct: 724 SLVFHVENFDHL 735



 Score = 72.5 bits (176), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 35/204 (17%), Positives = 72/204 (35%), Gaps = 27/204 (13%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D+  ++D S S++      I +          MLE  ++     + V+ G+V +S+  E 
Sbjct: 387 DIHFLIDGSSSIQEKQFEQIKRF---------MLEVTEMFSIGPDKVRVGVVQYSDDTEV 437

Query: 233 FFLLEWGVSHL--QRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKI 290
            F +    + +  ++ I  + +    T +   L Y    I +    R             
Sbjct: 438 EFYITDYSNDIDLRKAIFNIKQLTGGTYTGKALDYILQIIKNGMKDRMSK------VPCY 491

Query: 291 IVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVEN 350
           ++ +TDG +       + +      +     V+A+GI      E              +N
Sbjct: 492 LIVLTDGMSTD-----RVVEPAKRLRAEQITVHAVGIGAANKIELQEIAGKEERVSFGQN 546

Query: 351 PHSMYDAFSHIGKDIVTKRIWYDK 374
               +DA   I  ++V + I  +K
Sbjct: 547 ----FDALKSIKNEVV-REICAEK 565



 Score = 47.1 bits (110), Expect = 0.004,   Method: Composition-based stats.
 Identities = 23/150 (15%), Positives = 53/150 (35%), Gaps = 13/150 (8%)

Query: 208 EVKLIPDVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKY-LSKFGVSTNSTPGLK 264
            +  +P   N  +  L  +S++    F L    G S +   +K      G S      L+
Sbjct: 1   MINSLPIEANKYRVALAQYSDEFHSEFHLSTFKGRSPMLNHLKKNFQFIGGSLQIGKALQ 60

Query: 265 YAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYA 324
            A+   F      +    +   +  I+V +      S + + +        +K G  + +
Sbjct: 61  EAHRTYFSAPINGR----DRKQFPPILVVL-----ASAESEDEVEEASKALQKDGVKIIS 111

Query: 325 IGIRVIRSHEFLRACASPNSFYLVENPHSM 354
           +G++       L+A A+ +  + +     +
Sbjct: 112 VGVQKASEEN-LKAMATSHFHFNLRTIRDL 140


>gi|297291177|ref|XP_001109727.2| PREDICTED: collagen alpha-1(XII) chain-like [Macaca mulatta]
          Length = 3095

 Score = 87.1 bits (214), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 53/267 (19%), Positives = 103/267 (38%), Gaps = 37/267 (13%)

Query: 111 VRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDA 170
            ++T+L +  +  +  Y IS  +   +       I   T    + +  +  V + +    
Sbjct: 384 PQTTTLSVRDLSADTEYQISVSAMKGMTSSEPISIMEKTQPMKVQVECSRGVDIKA---- 439

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
             D++ ++D S S+     ++  K+   ++ +      VK      N VQ  LV +S   
Sbjct: 440 --DIVFLVDGSYSIG---IANFVKVRAFLEVL------VKSFEISPNRVQISLVQYSRDP 488

Query: 231 EEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
              F L+       +   I      G STN+   + Y   +IF             +N  
Sbjct: 489 HTEFTLKKFTKVEDIIEAINTFPYRGGSTNTGKAMTYVREKIF------VPSKGSRSNVP 542

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NSF 345
           K+++ +TDG++     D        + +     ++A+G++     E L A ASP      
Sbjct: 543 KVMILITDGKSSDAFRD-----PAIKLRNSDVEIFAVGVKDAVRSE-LEAIASPPAETHV 596

Query: 346 YLVENPHSMYDAFSHIGKDIVTKRIWY 372
           + VE+    +DAF  I  ++ T+ I  
Sbjct: 597 FTVED----FDAFQRISFEL-TQSICL 618



 Score = 86.7 bits (213), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 46/279 (16%), Positives = 100/279 (35%), Gaps = 34/279 (12%)

Query: 101 NGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIP--LKFCTFIPWYTNSRHIVMPI 158
           +G   +      +T   +  +     Y ++  S  ++   +     +   T S    +  
Sbjct: 64  DGPTKEFTLAASTTETLLSELVPETEYVVTITSYDEVEESVPVIGQLTIQTGSSTKPVEK 123

Query: 159 -TSSVKVNSQTDAR-LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVN 216
                ++   + +   D++ ++D S S+      +   I   I ++      V       
Sbjct: 124 KPGKTEIQKCSVSAWTDLIFLVDGSWSVGRN---NFKYILDFIAAL------VSAFDIGE 174

Query: 217 NVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKY-AYNQIFDM 273
              + G+V +S+     F L   +    L   IK +   G +T +   + Y   N   + 
Sbjct: 175 EKTRVGVVQYSSDTRTEFNLNQYYQRDELLAAIKKIPYKGGNTMTGDAIDYLVKNTFTES 234

Query: 274 QGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSH 333
            G R         + K+ + +TDG     K   +      E +  G  V+++GI+   + 
Sbjct: 235 AGARVG-------FPKVAIIITDG-----KSQDEVEIPARELRNVGVEVFSLGIKAADAK 282

Query: 334 EFLRACASP--NSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           E  +  ++P  N  + V N    +DA   I  +I+++  
Sbjct: 283 ELKQIASTPSLNHVFNVAN----FDAIVDIQNEIISQVC 317



 Score = 47.5 bits (111), Expect = 0.004,   Method: Composition-based stats.
 Identities = 44/248 (17%), Positives = 72/248 (29%), Gaps = 45/248 (18%)

Query: 124  NEGYSISAISRYKI-PLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSR 182
               Y ++    +              T S   VMPI SS  +   T A  D+++++D S 
Sbjct: 1150 GTTYKVNVFGMFDGGESSPLVGQEMTTLSDTTVMPILSS-GMECLTRAEADIVLLVDGSW 1208

Query: 183  SMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSH 242
            S+                 I+ ++E   + P     VQ  L  +S        L      
Sbjct: 1209 SIG------RANFRTVRSFISRIVEVFDIGP---KRVQIALAQYSGDPRTEGQL------ 1253

Query: 243  LQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLST 302
                    S       +  G+                        +KI V +TDG     
Sbjct: 1254 -NAHRDKKSXXXXXXXTQAGM--------------------RPRARKIGVLITDG----- 1287

Query: 303  KEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIG 362
            K          + K  G  ++AIGI+     E       P+      N    +++ S I 
Sbjct: 1288 KSQDDVEAPSKKLKDEGVELFAIGIKNADEVELKMIATDPDDT-HAYNVAD-FESLSRIV 1345

Query: 363  KDIVTKRI 370
             D+     
Sbjct: 1346 DDLTINLC 1353


>gi|114608138|ref|XP_518589.2| PREDICTED: collagen, type XII, alpha 1 isoform 3 [Pan troglodytes]
          Length = 3119

 Score = 87.1 bits (214), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 53/267 (19%), Positives = 103/267 (38%), Gaps = 37/267 (13%)

Query: 111 VRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDA 170
            ++T+L +  +  +  Y IS  +   +       I   T    + +  +  V + +    
Sbjct: 384 PQTTTLSVRDLSADTEYQISVSAMKGMTSSEPISIMEKTQPMKVQVECSRGVDIKA---- 439

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
             D++ ++D S S+     ++  K+   ++ +      VK      N VQ  LV +S   
Sbjct: 440 --DIVFLVDGSYSIG---IANFVKVRAFLEVL------VKSFEISPNRVQISLVQYSRDP 488

Query: 231 EEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
              F L+       +   I      G STN+   + Y   +IF             +N  
Sbjct: 489 HTEFTLKKFTKVEDIIEAINTFPYRGGSTNTGKAMTYVREKIF------VPSKGSRSNVP 542

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NSF 345
           K+++ +TDG++     D        + +     ++A+G++     E L A ASP      
Sbjct: 543 KVMILITDGKSSDAFRD-----PAIKLRNSDVEIFAVGVKDAVRSE-LEAIASPPAETHV 596

Query: 346 YLVENPHSMYDAFSHIGKDIVTKRIWY 372
           + VE+    +DAF  I  ++ T+ I  
Sbjct: 597 FTVED----FDAFQRISFEL-TQSICL 618



 Score = 86.4 bits (212), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 46/279 (16%), Positives = 100/279 (35%), Gaps = 34/279 (12%)

Query: 101 NGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIP--LKFCTFIPWYTNSRHIVMPI 158
           +G   +      +T   +  +     Y ++  S  ++   +     +   T S    +  
Sbjct: 64  DGPTKEFTLSASTTETLLSELVPETEYVVTITSYDEVEESVPVIGQLTIQTGSSTKPVEK 123

Query: 159 -TSSVKVNSQTDAR-LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVN 216
                ++   + +   D++ ++D S S+      +   I   I ++      V       
Sbjct: 124 KPGKTEIQKCSVSAWTDLVFLVDGSWSVGRN---NFKYILDFIAAL------VSAFDIGE 174

Query: 217 NVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKY-AYNQIFDM 273
              + G+V +S+     F L   +    L   IK +   G +T +   + Y   N   + 
Sbjct: 175 EKTRVGVVQYSSDTRTEFNLNQYYQRDELLAAIKKIPYKGGNTMTGDAIDYLVKNTFTES 234

Query: 274 QGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSH 333
            G R         + K+ + +TDG     K   +      E +  G  V+++GI+   + 
Sbjct: 235 AGARVG-------FPKVAIIITDG-----KSQDEVEIPARELRNVGVEVFSLGIKAADAK 282

Query: 334 EFLRACASP--NSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           E  +  ++P  N  + V N    +DA   I  +I+++  
Sbjct: 283 ELKQIASTPSLNHVFNVAN----FDAIVDIQNEIISQVC 317



 Score = 62.5 bits (150), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 50/250 (20%), Positives = 82/250 (32%), Gaps = 26/250 (10%)

Query: 124  NEGYSISAISRYKI-PLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSR 182
               Y ++    +              T S   VMPI SS  +   T A  D+++++D S 
Sbjct: 1150 GTTYKVNVFGMFDGGESSPLVGQEMTTLSDTTVMPILSS-GMECLTRAEADIVLLVDGSW 1208

Query: 183  SMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLE--WGV 240
            S+                 I+ ++E   + P     VQ  L  +S      + L      
Sbjct: 1209 SIG------RANFRTVRSFISRIVEVFDIGP---KRVQIALAQYSGDPRTEWQLNAHRDK 1259

Query: 241  SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENL 300
              L + +  L   G +T +   L +   Q F  Q             +KI V +TDG   
Sbjct: 1260 KSLLQAVANLPYKGGNTLTGMALNFIRQQNFRTQ------AGMRPRARKIGVLITDG--- 1310

Query: 301  STKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSH 360
              K          + K  G  ++AIGI+     E       P+      N    +++ S 
Sbjct: 1311 --KSQDDVEAPSKKLKDEGVELFAIGIKNADEVELKMIATDPDDT-HAYNVAD-FESLSR 1366

Query: 361  IGKDIVTKRI 370
            I  D+     
Sbjct: 1367 IVDDLTINLC 1376


>gi|126310411|ref|XP_001373784.1| PREDICTED: similar to collagen type XII alpha 1 [Monodelphis
           domestica]
          Length = 3116

 Score = 86.7 bits (213), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 55/277 (19%), Positives = 105/277 (37%), Gaps = 37/277 (13%)

Query: 101 NGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITS 160
                 +    ++TSL++  +  +  Y IS  S   +       I   T    + +  + 
Sbjct: 366 GSKQQALSVGPQTTSLNVRDLSADTEYQISVYSMKGLTSSEPISIMEKTQPMKVQVECSR 425

Query: 161 SVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQ 220
            V + +      D++ ++D S S+     ++  K+   ++ +      VK      N VQ
Sbjct: 426 GVDIKA------DIVFLVDGSYSIG---IANFVKVRAFLEVL------VKSFEISPNRVQ 470

Query: 221 SGLVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQ 278
             LV +S      F L+       +   I      G STN+   + Y   +IF       
Sbjct: 471 ISLVQYSRDPHTEFTLKKFTRVEDIIEAINTFPYRGGSTNTGKAMTYVREKIFVAS---- 526

Query: 279 HCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRA 338
                 +N  K+++ +TDG++     D        + +     ++A+G++     E L A
Sbjct: 527 --KGSRSNVPKVMILITDGKSSDAFRD-----PAIKLRNSDVEIFAVGVKDAVRSE-LEA 578

Query: 339 CASP---NSFYLVENPHSMYDAFSHIGKDIVTKRIWY 372
            ASP      + VE+    +DAF  I  ++ T+ I  
Sbjct: 579 IASPPPETHVFTVED----FDAFQRISFEL-TQSICL 610



 Score = 81.0 bits (198), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 47/244 (19%), Positives = 87/244 (35%), Gaps = 38/244 (15%)

Query: 130 SAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFD 189
               +   P+      P  T  +   +   +            D++ ++D S S+     
Sbjct: 101 QLTIQTGGPVDPKEKKPGQTEIQKCSLSAWT------------DLVFLVDGSWSVGRN-- 146

Query: 190 SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKI 247
            +   I   I ++      V          + G+V +S+     F L   +    L   I
Sbjct: 147 -NFKYILDFIAAL------VSAFDVGEGKTRVGVVQYSSDTRTEFNLNQYYQRKDLLAAI 199

Query: 248 KYLSKFGVSTNSTPGLKY-AYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQ 306
           K +   G +T +   + Y   N   +  G R         + K+ + +TDG     K   
Sbjct: 200 KKIPYKGGNTMTGDAIDYLIKNTFTESAGARVG-------FPKVAIIITDG-----KSQD 247

Query: 307 QSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIV 366
           +      E +  G  V+++GI+   + E LR  ASP S   V N  + +DA   I  +I+
Sbjct: 248 EVEIPARELRNIGVEVFSLGIKAADAKE-LRQIASPPSLKHVFNVAN-FDAIVDIQNEII 305

Query: 367 TKRI 370
           ++  
Sbjct: 306 SQVC 309



 Score = 59.4 bits (142), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 49/251 (19%), Positives = 81/251 (32%), Gaps = 28/251 (11%)

Query: 124  NEGYSISAISRYKI-PLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSR 182
               Y ++    +              T S   VMP  S   +   T A  D+++++D S 
Sbjct: 1142 GTTYKVNVFGMFDGGESSPLIGQEMTTLSDTTVMPFLSK-GMECFTRAEADIVLLVDGSW 1200

Query: 183  SMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLL---EWG 239
            S+                 I+ ++E  ++ P     VQ  L  +S      + L   +  
Sbjct: 1201 SIG------RANFKTIRSFISRIVEVFEIGP---KRVQIALAQYSGDPRTEWQLNAHKDR 1251

Query: 240  VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGEN 299
             S L   +  L   G +T +   L       F  Q   +         +KI V +TDG  
Sbjct: 1252 RSLLDS-VANLPYKGGNTLTGMALN------FIRQNNFRPQAGMRPRARKIGVLITDG-- 1302

Query: 300  LSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFS 359
               K          + K  G  ++AIGI+     E       P+      N    +D+ S
Sbjct: 1303 ---KSQDDVEAPSKKLKDDGVELFAIGIKNADESELKMIATDPDDT-HAYNVAD-FDSLS 1357

Query: 360  HIGKDIVTKRI 370
             I  D+     
Sbjct: 1358 RIVDDLTVNLC 1368


>gi|126273404|ref|XP_001377627.1| PREDICTED: similar to AMACO [Monodelphis domestica]
          Length = 784

 Score = 86.7 bits (213), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 38/216 (17%), Positives = 83/216 (38%), Gaps = 29/216 (13%)

Query: 161 SVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVN-NVV 219
           S++        LD++ +LD S ++      + TK+        + +    L  ++N +V 
Sbjct: 522 SLQRPGCQSQSLDLVFLLDASATVGQE---NFTKLQ-------SFVRGSSLQFNINRDVT 571

Query: 220 QSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           Q GLV + ++++  F L+     S L + I        + ++   L + Y ++  +Q   
Sbjct: 572 QIGLVVYGSRVQTTFALDTHPTSSSLLQAISQAPYMDGAGSTGSALLHVYEEVMTVQ--- 628

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                      K +V +T+G        + ++    + +  G  V  I +  +     LR
Sbjct: 629 ---KGARPGVSKAVVVITEGTGT-----EDAVVPAQKLRNNGISVLVIAVGPVLKETLLR 680

Query: 338 ACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
              SP+    V +   +        +D+  +RI  +
Sbjct: 681 LAGSPDFLIHVASYEDL-----ENYQDLFIERICEE 711



 Score = 72.9 bits (177), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 43/189 (22%), Positives = 81/189 (42%), Gaps = 24/189 (12%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           SS     Q  A LD++  LD S S+           + +      M + + + PD    V
Sbjct: 38  SSASQLMQCSAALDVLFALDGSHSIGK------GSFERSKYFAIKMCDALAIYPD---RV 88

Query: 220 QSGLVTFSNKIEEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + G++ FS+  +  F L+   +   ++ KIK +   G ST +   LKY           +
Sbjct: 89  RVGVLQFSSVPQLEFPLDSFFTREEVKEKIKKIVFKGGSTETGLALKYLL--------HK 140

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                 +++  ++++ +TDG++    +        N+ K+RG +V+A+G+R  R  E   
Sbjct: 141 GFPGGRNSSVPQLLIIVTDGKSQGNID-----LPANQLKERGVMVFAVGVRFPRWTELHT 195

Query: 338 ACASPNSFY 346
             + P   Y
Sbjct: 196 LASEPKDQY 204


>gi|326918160|ref|XP_003205359.1| PREDICTED: hypothetical protein LOC100539194 [Meleagris gallopavo]
          Length = 1584

 Score = 86.7 bits (213), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 37/220 (16%), Positives = 85/220 (38%), Gaps = 25/220 (11%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           +  +     +   D++ +LD S S+           +   + ++ ++E  ++ PD     
Sbjct: 25  TEAQRAGCKNVHYDLVFILDASSSVGK------EDFEKVRQWVSNLVETFEIGPDK---T 75

Query: 220 QSGLVTFSNKIEEFFLLEWGVSHLQRKIK----YLSKFGVSTNSTPGLKYAYNQIFDMQG 275
           + G+V +S++    F L  G    + +IK     +  +G +TN+   L+Y     F  + 
Sbjct: 76  RVGVVRYSDRPTTEFDL--GKYKTREEIKEAARKIRYYGGNTNTGDALRYINTYSFSKE- 132

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF 335
                   D   KK+ + +TDG           L   N A++ G  ++A+G+      E 
Sbjct: 133 --AGGRLSDRTVKKVAILLTDGR-----SQDYVLDPANAARQAGIRIFAVGVGEALKEEL 185

Query: 336 LRACASPN--SFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
               + P     + V + +++      + + +    +  +
Sbjct: 186 DEIASEPKSAHVFHVSDYNAIDKIRGKLRRRLCENVLCPN 225


>gi|12052774|emb|CAB66559.1| hypothetical protein [Homo sapiens]
          Length = 957

 Score = 86.7 bits (213), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 43/214 (20%), Positives = 83/214 (38%), Gaps = 33/214 (15%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           +S   A  D++ +LD S S+           ++  K +  + +   + P     +Q G+V
Sbjct: 29  SSCRTAPTDLVFILDGSYSVGP------ENFEIVKKWLVNITKNFDIGP---KFIQVGVV 79

Query: 225 TFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S+       L       HL   ++ +   G +T +   +++A + +FD          
Sbjct: 80  QYSDYPVLEIPLGSYDSGEHLTAAVESILYLGGNTKTGKAIQFALDYLFD---------K 130

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA-- 340
                 KI V +TDG     K           A+     ++AIG+        LRA A  
Sbjct: 131 SSRFLTKIAVVLTDG-----KSQDDVKDAAQAARDSKITLFAIGVGSETEDAELRAIANK 185

Query: 341 -SPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
            S    + VE+    Y A S I ++++ +++  +
Sbjct: 186 PSSTYVFYVED----YIAISKI-REVMKQKLCEE 214


>gi|293349450|ref|XP_001073278.2| PREDICTED: collagen type VI alpha 5-like [Rattus norvegicus]
          Length = 2640

 Score = 86.7 bits (213), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 49/279 (17%), Positives = 99/279 (35%), Gaps = 34/279 (12%)

Query: 103 FVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSV 162
           F   +     +   DIV  P  +  SIS  S YK    +        ++       T + 
Sbjct: 395 FAMSVQGANNTQLEDIVSYPSRQ--SISTHSSYKHLESYSGNFLKKIHNEIWTQVSTHAE 452

Query: 163 KVNSQTDARLD-----MMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNN 217
           ++       +D     +  ++D S S+         +I + + S+      V + P   N
Sbjct: 453 QMELDKTGCVDTKEADIYFLIDGSSSIR---RKEFEQIQIFMSSV------VDMFPIGPN 503

Query: 218 VVQSGLVTFSNKIEEFFLLEWGVSHL--QRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQG 275
            V+ G+V +S++ E  F +      +  ++ +  + +    T +   L +    I   + 
Sbjct: 504 NVRVGVVQYSHRNEVEFPVSQYTKGIELRKAVWNIKQLKGGTFTGKALDFILPIIKKGKS 563

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF 335
            R H           ++ +TDG     K +   L   N  +     ++A+GI      + 
Sbjct: 564 ERIH------EVPCYLIVLTDG-----KSNDSVLEPANRLRAEHITIHAVGIGEANKTQL 612

Query: 336 LRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYDK 374
            +           +N    +D+  +I  +IV + I  DK
Sbjct: 613 QQIAGKDERVSFGQN----FDSLKYIKNEIVHR-ICSDK 646



 Score = 80.6 bits (197), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 46/281 (16%), Positives = 103/281 (36%), Gaps = 33/281 (11%)

Query: 97  ELRDNGFVNDIDDIVRSTSLDI--VVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRH- 153
           + + N  V +  + +R+  + I  V + +     +  I+     + F          ++ 
Sbjct: 578 DGKSNDSVLEPANRLRAEHITIHAVGIGEANKTQLQQIAGKDERVSFGQNFDSLKYIKNE 637

Query: 154 IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
           IV  I S        D + D+M ++D S S+     ++  K+   +K++         I 
Sbjct: 638 IVHRICSD---KGCEDMKADIMFLVDSSGSIG---LTNFEKMKTFMKNLVG------KIE 685

Query: 214 DVNNVVQSGLVTFSNKIEEFFLL-EWGV-SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIF 271
              +  Q G+V FS+  +E F L ++     +   I  +S    +T +   L +  N+ F
Sbjct: 686 IGADRSQVGVVQFSDYNKEEFQLNKYSTREEVYAAIDGMSPINRNTLTGSALTF-VNEYF 744

Query: 272 DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR 331
           D+              +K ++ +TDGE        +        + +   ++++G+    
Sbjct: 745 DIS------KGGRPQVRKFLILLTDGE-----AQDEVGGPAMALRSKSVTIFSVGVYGAN 793

Query: 332 SHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIWY 372
             +        +  + VEN    +D    I   ++ +    
Sbjct: 794 RTQLEEISGEGSLVFHVEN----FDHLKTIESKLIFRVCAL 830



 Score = 80.2 bits (196), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 41/189 (21%), Positives = 77/189 (40%), Gaps = 19/189 (10%)

Query: 172  LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
            LD++ VLD S S+      S+         IN  +  V+      + VQ G + +SN  E
Sbjct: 839  LDIVFVLDHSGSIGPREQESM---------INLTIHLVEKADVGRDRVQFGALMYSNNPE 889

Query: 232  EFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
              F L      S +   +K        T +   L++A N +F    M +H +    N ++
Sbjct: 890  ILFYLNTYSSRSAITEHLKRPRDTRGDTYTAKALQHA-NILF----MEEHGSRLKQNVRQ 944

Query: 290  IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVE 349
            +++ +TDGE+    +  +      E + +G  ++A+G+      E         +   V+
Sbjct: 945  LMIVITDGES---HDRDKLNDTARELRDKGITIFAVGVGRANQDELETMAGKKENTIHVD 1001

Query: 350  NPHSMYDAF 358
            N   + D +
Sbjct: 1002 NFDKLRDIY 1010



 Score = 52.5 bits (124), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 44/291 (15%), Positives = 106/291 (36%), Gaps = 32/291 (10%)

Query: 72   NNRKKLKGGDILCRIKNTWNMSFR-NELRDNGFVNDIDDIVR-STSLDIVVVPQNEGYSI 129
            +N +      IL        +         N  V   +   +  T++D V   Q+     
Sbjct: 1898 SNGQAASRASILTATMEFSALDISLAVFAHNERVFLDEAFGQCETAVDPVRSWQH----F 1953

Query: 130  SAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFD 189
                +Y +  +  ++ P    +++   P T + +     ++ +D+  +LD SR++ S   
Sbjct: 1954 PPPIQYMLHEQLVSWTP--VTNQNKCFPNTCAEEPFFPENSYMDVAFLLDNSRNIAS--- 2008

Query: 190  SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF----SNKIEEFFLLEWGVSH--- 242
                 +   + S+              +  +  L+++    +++ +     E+G +    
Sbjct: 2009 DDFQAVKGLVSSVIDGFHITSNPSTSESGDRVALLSYSPSENSRRKGSVKTEFGFTTFDS 2068

Query: 243  ---LQRKI-KYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGE 298
               ++  I   L +          L++A   +F          T +    K+I+ ++ GE
Sbjct: 2069 ESIMKNYIHTSLQQLNGDAAIGLALEWAMEGLFLG--------TPNPRKHKVIIVISAGE 2120

Query: 299  NLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVE 349
            N   KE  +++     AK +G I++ + +   R  E     + P   +L++
Sbjct: 2121 NHEEKEFVKTVAL--RAKCQGYIIFVVSLGSTRRDEMEELASYPLDHHLIQ 2169



 Score = 51.7 bits (122), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 27/206 (13%), Positives = 70/206 (33%), Gaps = 25/206 (12%)

Query: 154 IVMPITSSVKVNSQTDARL-DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLI 212
           +++   +    +     +  D++ ++D S  +       I         +N ++  +   
Sbjct: 10  LILWTETLSDQSPGPGPKYADVVFLVDSSDYLG------IKSFPFVRTFLNKIISSL--- 60

Query: 213 PDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKF----GVSTNSTPGLKYAYN 268
           P   N  +  L  +S+ +   F L    +     + +L K     G S      L+ A+ 
Sbjct: 61  PVEANKYRVALAQYSDALHNEFHLGAFKNR-NPMLNHLKKNFGFIGGSLKIGNALQEAHR 119

Query: 269 QIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR 328
             F      +        +  I+V +      S + +          ++ G  + ++G++
Sbjct: 120 TYFSAPTNGRDKK----QFPPILVVL-----ASAESEDDVEEASKALREDGVKIISVGVQ 170

Query: 329 VIRSHEFLRACASPNSFYLVENPHSM 354
                + L+A A+P   + +     +
Sbjct: 171 KASEED-LKAMATPQFHFNLRTARDL 195



 Score = 45.9 bits (107), Expect = 0.010,   Method: Composition-based stats.
 Identities = 37/292 (12%), Positives = 98/292 (33%), Gaps = 31/292 (10%)

Query: 50  LHSMIDRSLVHAATQIMNEG----NGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVN 105
           L S      V  A++ + E          +K    D+       ++ + R     + F  
Sbjct: 141 LASAESEDDVEEASKALREDGVKIISVGVQKASEEDLKAMATPQFHFNLRTARDLSLFAP 200

Query: 106 DIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVN 165
           D+  I++    D+    +    ++        P    T     T + ++   +      +
Sbjct: 201 DMAQIIQ----DVTQYREGTTVAVVTDVAPTTPEPLITPAALTTPANNVDETVPFLA--S 254

Query: 166 SQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVT 225
            Q D+  D++ ++D S         +   +      +  +   V +  +    ++ GL++
Sbjct: 255 CQKDSLADLIFLVDES-------VGTTQNLRDLQNFLENVTSSVDVKDNC---MRLGLMS 304

Query: 226 FSN--KIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           FS+  +           S  Q++I+ LS    ++N    +++    +          + +
Sbjct: 305 FSDKARTVSSLKSSTSQSDFQQQIQKLSLRTGASNVGAAIEH----MRTEGFSESSGSRK 360

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF 335
                +I V +T         D        + + +G  ++A+ ++   + + 
Sbjct: 361 AQGVPQIAVLVT-----HRASDDAVREAALDLRLQGVTMFAMSVQGANNTQL 407


>gi|296198593|ref|XP_002806760.1| PREDICTED: LOW QUALITY PROTEIN: collagen alpha-1(XII) chain-like
           [Callithrix jacchus]
          Length = 3113

 Score = 86.7 bits (213), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 53/267 (19%), Positives = 102/267 (38%), Gaps = 37/267 (13%)

Query: 111 VRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDA 170
            ++T L +  +  +  Y IS  +   +       I   T    + +  +  V + +    
Sbjct: 384 PQTTMLSVRDLSADTEYQISVSAMKGMTSSEPISIMEKTQPMKVQVECSRGVDIKA---- 439

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
             D++ ++D S S+     ++  K+   ++ +      VK      N VQ  LV +S   
Sbjct: 440 --DIVFLVDGSYSIG---IANFVKVRAFLEVL------VKSFEISPNRVQISLVQYSRDP 488

Query: 231 EEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
              F L+       +   I      G STN+   + Y   +IF             +N  
Sbjct: 489 HTEFTLKXFTKVEDIIEAINNFPYRGGSTNTGKAMTYVREKIF------VPSKGSRSNVP 542

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NSF 345
           K+++ +TDG++     D        + +     ++A+G++     E L A ASP      
Sbjct: 543 KVMILITDGKSSDAFRD-----PAIKLRNSDVEIFAVGVKDAVRSE-LEAIASPPAETHV 596

Query: 346 YLVENPHSMYDAFSHIGKDIVTKRIWY 372
           + VE+    +DAF  I  ++ T+ I  
Sbjct: 597 FTVED----FDAFQRISFEL-TQSICL 618



 Score = 86.4 bits (212), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 45/279 (16%), Positives = 100/279 (35%), Gaps = 34/279 (12%)

Query: 101 NGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIP--LKFCTFIPWYTNSRHIVMPI 158
           +G   +      +T   +  +     Y ++  S  ++   +     +   T S       
Sbjct: 64  DGPTKEFTLAASTTETLLSELVPETEYVVTITSYDEVEESVPVIGQLTIQTGSSTKPGEK 123

Query: 159 -TSSVKVNSQTDAR-LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVN 216
                ++   + +   D++ ++D S S+      +   I   I ++      V       
Sbjct: 124 KPGKTEIQKCSVSAWTDLIFLVDGSWSVGRN---NFKYILDFIAAL------VSAFDIGE 174

Query: 217 NVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKY-AYNQIFDM 273
           +  + G+V +S+     F L   +    L   IK +   G +T +   + Y   N   + 
Sbjct: 175 DKTRVGVVQYSSDTRTEFNLNQYYQRDELLAAIKKIPYKGGNTMTGDAIDYLVKNTFTES 234

Query: 274 QGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSH 333
            G R         + K+ + +TDG     K   +      E +  G  V+++GI+   + 
Sbjct: 235 AGARVG-------FPKVAIVITDG-----KSQDEVEIPARELRNVGVEVFSLGIKAADAK 282

Query: 334 EFLRACASPN--SFYLVENPHSMYDAFSHIGKDIVTKRI 370
           E  +  ++P+    + V N    +DA   I  +I+++  
Sbjct: 283 ELKQIASTPSLTHVFNVAN----FDAIVDIQNEIISQVC 317



 Score = 63.3 bits (152), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 50/250 (20%), Positives = 82/250 (32%), Gaps = 26/250 (10%)

Query: 124  NEGYSISAISRYKI-PLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSR 182
               Y ++    +              T S   VMPI SS  +   T A  D+++++D S 
Sbjct: 1150 GTTYKVNVFGMFDGGESSPLVGQEMTTLSDTTVMPILSS-GMECLTRAEADIVLLVDGSW 1208

Query: 183  SMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEW--GV 240
            S+                 I+ ++E   + P     VQ  L  +S      + L      
Sbjct: 1209 SIG------RANFRTVRSFISRIVEVFDIGP---KRVQIALAQYSGDPRTEWQLNTHRDK 1259

Query: 241  SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENL 300
              L + +  L   G +T +   L +   Q F  Q             +KI V +TDG   
Sbjct: 1260 KSLLQAVANLPYKGGNTLTGMALNFIRQQSFRTQ------AGMRPRARKIGVLITDG--- 1310

Query: 301  STKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSH 360
              K          + K  G  ++AIGI+     E       P+      N    +++ S 
Sbjct: 1311 --KSQDDVEAPSKKLKDEGVELFAIGIKNADEVELKMIATDPDDT-HAYNVAD-FESLSR 1366

Query: 361  IGKDIVTKRI 370
            I  D+     
Sbjct: 1367 IVDDLTINLC 1376


>gi|323700353|ref|ZP_08112265.1| von Willebrand factor type A [Desulfovibrio sp. ND132]
 gi|323460285|gb|EGB16150.1| von Willebrand factor type A [Desulfovibrio desulfuricans ND132]
          Length = 400

 Score = 86.7 bits (213), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 58/436 (13%), Positives = 132/436 (30%), Gaps = 136/436 (31%)

Query: 24  AIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDIL 83
           A+ LP++  V G+ +++ +++   T L + +D   +  + ++  + + +           
Sbjct: 2   ALLLPVLLGVAGIAVDMGNMYMTHTRLQAAVDAGALAGSLELPYDPDLS----------- 50

Query: 84  CRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCT 143
              K     +  + +  N     + +I   T +           S+   ++ ++ +    
Sbjct: 51  ---KGIVTQAVNDMVETNMEEAVVTEISAGTEI----------RSVKVTAQAEVRMLLME 97

Query: 144 FIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSIN 203
            +     +      + +S          L+++ V+D S SM        T ID+  ++  
Sbjct: 98  VLGMADKT------VEASAMAGFNK---LEVVFVIDNSGSM------KGTPIDLVKQASE 142

Query: 204 AMLEEVKLIPDVNNVVQSGLVTFSNKIE-------------------------------- 231
            + + +          + GLV F  KI                                 
Sbjct: 143 ELTDLLIP-DGTTPDTKVGLVPFRGKIRLGEAVDGYAEGCVNADGSLNTGINEEFMDEYN 201

Query: 232 -------------------EFFLLEWGVSHLQRKIKYLSKFGV--STNSTPGLKYAYNQI 270
                                  L    S +   I   +  G    T  + G+K+  N +
Sbjct: 202 ALPYYYKRYITLDTCSDIPTVLPLSKNKSTIIAAIGSQTATGAASGTVISEGIKWGRNIL 261

Query: 271 FDMQGMRQHCNTEDANYKKIIVFMTDGE-------------------------------- 298
                  Q  + ED  ++KI++ +TDG+                                
Sbjct: 262 TPDAPFTQAGSKED--FRKIMIVLTDGDTEDGECGGTYRATYRPNNYWTNAYYGMGVDTA 319

Query: 299 --NLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHE--FLRACASP-----NSFYLVE 349
             N     +   L     AK  G  +++I      + +   ++  AS      + ++   
Sbjct: 320 HCNDGGVLNADMLSEAQLAKDAGIEIFSIRFGSSDTTDINLMKEIASSKAGTDDHYFDAP 379

Query: 350 NPHSMYDAFSHIGKDI 365
           + + + D F  IGK +
Sbjct: 380 SVYDIPDIFKQIGKQL 395


>gi|332817900|ref|XP_526306.3| PREDICTED: collagen alpha-5(VI) chain isoform 2 [Pan troglodytes]
          Length = 2526

 Score = 86.7 bits (213), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 63/349 (18%), Positives = 127/349 (36%), Gaps = 53/349 (15%)

Query: 41  SHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRD 100
            + +F +  +   IDR  +      +NEG          G  L  +   +  S    L  
Sbjct: 682 LNRYFTQQEISDAIDRMSL------INEGTLT-------GKALNFVGQYFTHSKGARLGA 728

Query: 101 NGFVNDIDDIVRSTSL-DIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNS-------- 151
             F+  I D V    + D   + + +  +I ++  Y         I   ++         
Sbjct: 729 KKFLILITDGVAQDDVRDPARILRGKDVTIFSVGVYNANRSQLEEISGDSSLVFHVENFD 788

Query: 152 ------RHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAM 205
                 R ++  + +       T   LD++ VLD S S++  +   +         IN  
Sbjct: 789 HLKALERKLIFHVCALHDCKRITL--LDVVFVLDHSGSIKKQYQDHM---------INLT 837

Query: 206 LEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGL 263
           +  VK      + VQ G + +S++    F L      S +   ++     G +T +   L
Sbjct: 838 IHLVKKADVGRDRVQFGALKYSDQPNILFYLNTYSNRSAIIENLRKRRDTGGNTYTAKAL 897

Query: 264 KYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVY 323
           K+A N +F      +H +    N K++++ +TDGE+    +   +     E + +G  ++
Sbjct: 898 KHA-NALFT----EEHGSRIKQNVKQMLIVITDGESHDHDQLNDTAL---ELRNKGITIF 949

Query: 324 AIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIWY 372
           A+G+      E      + N+   V+N   + D F+     +  +    
Sbjct: 950 AVGVGKANQKELEGMAGNKNNTIYVDNFDKLKDVFT----LVQERMCTE 994



 Score = 78.7 bits (192), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 33/192 (17%), Positives = 70/192 (36%), Gaps = 23/192 (11%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
               D + D+M ++D S S+    + +  K+ + +K++      +  I    +  Q G+V
Sbjct: 620 KGCEDMKADIMFLVDSSWSIG---NENFRKMKIFMKNL------LTKIQIGADKTQIGVV 670

Query: 225 TFSNKIEEFFLL-EWGVS-HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS+K +E F L  +     +   I  +S     T +   L +        +G R     
Sbjct: 671 QFSDKTKEEFQLNRYFTQQEISDAIDRMSLINEGTLTGKALNFVGQYFTHSKGARLGA-- 728

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                KK ++ +TDG                  + +   ++++G+      +        
Sbjct: 729 -----KKFLILITDG-----VAQDDVRDPARILRGKDVTIFSVGVYNANRSQLEEISGDS 778

Query: 343 NSFYLVENPHSM 354
           +  + VEN   +
Sbjct: 779 SLVFHVENFDHL 790



 Score = 73.3 bits (178), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 31/203 (15%), Positives = 71/203 (34%), Gaps = 22/203 (10%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D+  ++D S S++      I +          MLE  ++     + V+ G+V +S+  E 
Sbjct: 442 DIHFLIDGSSSIQEKQFEQIKRF---------MLEVTEMFSIGPDKVRVGVVQYSDDTEV 492

Query: 233 FFLLEWGVSHL--QRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKI 290
            F +    + +  ++ I  + +    T +   L Y    I +    R             
Sbjct: 493 EFYVTDYSNDIDLRKAIFNIKQLTGGTYTGKALDYILQIIKNGMKDRMSK------VPCY 546

Query: 291 IVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVEN 350
           ++ +TDG +       + +      +     V+A+GI      E              +N
Sbjct: 547 LIVLTDGMSTD-----RVVEPAKRLRAEQITVHAVGIGAANKTELQEIAGKEERVSFGQN 601

Query: 351 PHSMYDAFSHIGKDIVTKRIWYD 373
             ++    + + ++I  ++   D
Sbjct: 602 FDALKSIKNEVIREICAEKGCED 624



 Score = 50.2 bits (118), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 28/185 (15%), Positives = 65/185 (35%), Gaps = 22/185 (11%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D++ ++D S   +     S   +   I       + +  +P   N  +  L  +S++   
Sbjct: 30  DVVFLVDSS---DHLGPKSFPFVKTFIS------KMINSLPIEANKYRVALAQYSDEFHS 80

Query: 233 FFLLEW--GVSHLQRKIKY-LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
            F L    G S +   +K      G S      L+ A+   F      +    +   +  
Sbjct: 81  EFHLSTFEGRSPMLNHLKKNFQFIGGSLQIGKALQEAHRTYFSAPTNGR----DRKQFPP 136

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVE 349
           I+V +      S + + +        +K G  + ++G++       L+A A+ +  + + 
Sbjct: 137 ILVVL-----ASAESEDEVEGASKALQKDGVKIISVGVQEASEEN-LKAMATSHFHFNLR 190

Query: 350 NPHSM 354
               +
Sbjct: 191 TIRDL 195


>gi|332210152|ref|XP_003254169.1| PREDICTED: collagen alpha-1(XXI) chain [Nomascus leucogenys]
          Length = 957

 Score = 86.7 bits (213), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 42/214 (19%), Positives = 82/214 (38%), Gaps = 33/214 (15%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           +S   A  D++ +LD S S+           ++  K +  + +   + P     +Q G+V
Sbjct: 29  SSCRTAPTDLVFILDGSYSVGP------ENFEIVKKWLVNITKNFDIGP---KFIQVGVV 79

Query: 225 TFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S+       L       HL   ++ +   G +T +   +++A + +F           
Sbjct: 80  QYSDYPVLEIPLGSYDSGEHLTAAVESILYLGGNTRTGKAIQFALDYLF---------AK 130

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA-- 340
                 KI V +TDG     K           A+     ++AIG+        LRA A  
Sbjct: 131 SSRFLTKIAVVLTDG-----KSQDDVKDAAQAARDSKITLFAIGVGSETEDAELRAIANK 185

Query: 341 -SPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
            S    + VE+    Y A S I ++++ +++  +
Sbjct: 186 PSSTYVFYVED----YIAISKI-REVMKQKLCEE 214


>gi|297678422|ref|XP_002817079.1| PREDICTED: collagen alpha-1(XXI) chain-like [Pongo abelii]
          Length = 612

 Score = 86.7 bits (213), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 42/214 (19%), Positives = 82/214 (38%), Gaps = 33/214 (15%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           +S   A  D++ +LD S S+           ++  K +  + +   + P     +Q G+V
Sbjct: 29  SSCRTAPTDLVFILDGSYSVGP------ENFEIVKKWLVNITKNFDIGP---KFIQVGVV 79

Query: 225 TFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S+       L       HL   ++ +   G +T +   +++A + +F           
Sbjct: 80  QYSDYPVLEIPLGSYDSGEHLTAAVESILYLGGNTRTGKAIQFALDYLF---------AK 130

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA-- 340
                 KI V +TDG     K           A+     ++AIG+        LRA A  
Sbjct: 131 SSRFLTKIAVVLTDG-----KSQDDVKDAAQAARDSKITLFAIGVGSETEDAELRAIANK 185

Query: 341 -SPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
            S    + VE+    Y A S I ++++ +++  +
Sbjct: 186 PSSTYVFYVED----YIAISKI-REVMKQKLCEE 214


>gi|1846005|gb|AAC51244.1| collagen type XII alpha-1 [Homo sapiens]
          Length = 3063

 Score = 86.4 bits (212), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 53/267 (19%), Positives = 103/267 (38%), Gaps = 37/267 (13%)

Query: 111 VRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDA 170
            ++T+L +  +  +  Y IS  +   +       I   T    + +  +  V + +    
Sbjct: 384 PQTTTLSVRDLSADTEYQISVSAMKGMTSSEPISIMEKTQPMKVQVECSRGVDIKA---- 439

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
             D++ ++D S S+     ++  K+   ++ +      VK      N VQ  LV +S   
Sbjct: 440 --DIVFLVDGSYSIG---IANFVKVRAFLEVL------VKSFEISPNRVQISLVQYSRDP 488

Query: 231 EEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
              F L+       +   I      G STN+   + Y   +IF             +N  
Sbjct: 489 HTEFTLKKFTKVEDIIEAINTFPYRGGSTNTGKAMTYVREKIF------VPSKGSRSNVP 542

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NSF 345
           K+++ +TDG++     D        + +     ++A+G++     E L A ASP      
Sbjct: 543 KVMILITDGKSSDAFRD-----PAIKLRNSDVEIFAVGVKDAVRSE-LEAIASPPAETHV 596

Query: 346 YLVENPHSMYDAFSHIGKDIVTKRIWY 372
           + VE+    +DAF  I  ++ T+ I  
Sbjct: 597 FTVED----FDAFQRISFEL-TQSICL 618



 Score = 86.0 bits (211), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 46/279 (16%), Positives = 100/279 (35%), Gaps = 34/279 (12%)

Query: 101 NGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIP--LKFCTFIPWYTNSRHIVMPI 158
           +G   +      +T   +  +     Y ++  S  ++   +     +   T S    +  
Sbjct: 64  DGPTKEFTLSASTTETLLSELVPETEYVVTITSYDEVEESVPVIGQLTIQTGSSTKPVEK 123

Query: 159 -TSSVKVNSQTDAR-LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVN 216
                ++   + +   D++ ++D S S+      +   I   I ++      V       
Sbjct: 124 KPGKTEIQKCSVSAWTDLVFLVDGSWSVGRN---NFKYILDFIAAL------VSAFDIGE 174

Query: 217 NVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKY-AYNQIFDM 273
              + G+V +S+     F L   +    L   IK +   G +T +   + Y   N   + 
Sbjct: 175 EKTRVGVVQYSSDTRTEFNLNQYYQRDELLAAIKKIPYKGGNTMTGDAIDYLVKNTFTES 234

Query: 274 QGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSH 333
            G R         + K+ + +TDG     K   +      E +  G  V+++GI+   + 
Sbjct: 235 AGARVG-------FPKVAIIITDG-----KSQDEVEIPARELRNVGVEVFSLGIKAADAK 282

Query: 334 EFLRACASP--NSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           E  +  ++P  N  + V N    +DA   I  +I+++  
Sbjct: 283 ELKQIASTPSLNHVFNVAN----FDAIVDIQNEIISQVC 317



 Score = 61.7 bits (148), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 49/250 (19%), Positives = 82/250 (32%), Gaps = 26/250 (10%)

Query: 124  NEGYSISAISRYKI-PLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSR 182
               Y ++    +              T S   VMPI SS  +   T A  D+++++D S 
Sbjct: 1150 GTTYKVNVFGMFDGGESSPLVGQEMTTLSDTTVMPILSS-GMECLTRAEADIVLLVDGSW 1208

Query: 183  SMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLE--WGV 240
            S+                 I+ ++E   + P     VQ  L  +S      + L      
Sbjct: 1209 SIG------RANFRTVRSFISRIVEVFDIGP---KRVQIALAQYSGDPRTEWQLNAHRDK 1259

Query: 241  SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENL 300
              L + +  L   G +T +   L +   Q F  Q             +KI V +TDG   
Sbjct: 1260 KSLLQAVANLPYKGGNTLTGMALNFIRQQNFRTQ------AGMRPRARKIGVLITDG--- 1310

Query: 301  STKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSH 360
              K          + K  G  ++AIGI+     E       P+  +        +++ S 
Sbjct: 1311 --KSQDDVEAPSKKLKDEGVELFAIGIKNADEVELKMIATDPDDTHDYNVAD--FESLSR 1366

Query: 361  IGKDIVTKRI 370
            I  D+     
Sbjct: 1367 IVDDLTINLC 1376


>gi|119569135|gb|EAW48750.1| collagen, type XII, alpha 1, isoform CRA_c [Homo sapiens]
          Length = 3063

 Score = 86.4 bits (212), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 53/267 (19%), Positives = 103/267 (38%), Gaps = 37/267 (13%)

Query: 111 VRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDA 170
            ++T+L +  +  +  Y IS  +   +       I   T    + +  +  V + +    
Sbjct: 384 PQTTTLSVRDLSADTEYQISVSAMKGMTSSEPISIMEKTQPMKVQVECSRGVDIKA---- 439

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
             D++ ++D S S+     ++  K+   ++ +      VK      N VQ  LV +S   
Sbjct: 440 --DIVFLVDGSYSIG---IANFVKVRAFLEVL------VKSFEISPNRVQISLVQYSRDP 488

Query: 231 EEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
              F L+       +   I      G STN+   + Y   +IF             +N  
Sbjct: 489 HTEFTLKKFTKVEDIIEAINTFPYRGGSTNTGKAMTYVREKIF------VPSKGSRSNVP 542

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NSF 345
           K+++ +TDG++     D        + +     ++A+G++     E L A ASP      
Sbjct: 543 KVMILITDGKSSDAFRD-----PAIKLRNSDVEIFAVGVKDAVRSE-LEAIASPPAETHV 596

Query: 346 YLVENPHSMYDAFSHIGKDIVTKRIWY 372
           + VE+    +DAF  I  ++ T+ I  
Sbjct: 597 FTVED----FDAFQRISFEL-TQSICL 618



 Score = 86.0 bits (211), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 46/279 (16%), Positives = 100/279 (35%), Gaps = 34/279 (12%)

Query: 101 NGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIP--LKFCTFIPWYTNSRHIVMPI 158
           +G   +      +T   +  +     Y ++  S  ++   +     +   T S    +  
Sbjct: 64  DGPTKEFTLSASTTETLLSELVPETEYVVTITSYDEVEESVPVIGQLTIQTGSSTKPVEK 123

Query: 159 -TSSVKVNSQTDAR-LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVN 216
                ++   + +   D++ ++D S S+      +   I   I ++      V       
Sbjct: 124 KPGKTEIQKCSVSAWTDLVFLVDGSWSVGRN---NFKYILDFIAAL------VSAFDIGE 174

Query: 217 NVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKY-AYNQIFDM 273
              + G+V +S+     F L   +    L   IK +   G +T +   + Y   N   + 
Sbjct: 175 EKTRVGVVQYSSDTRTEFNLNQYYQRDELLAAIKKIPYKGGNTMTGDAIDYLVKNTFTES 234

Query: 274 QGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSH 333
            G R         + K+ + +TDG     K   +      E +  G  V+++GI+   + 
Sbjct: 235 AGARVG-------FPKVAIIITDG-----KSQDEVEIPARELRNVGVEVFSLGIKAADAK 282

Query: 334 EFLRACASP--NSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           E  +  ++P  N  + V N    +DA   I  +I+++  
Sbjct: 283 ELKQIASTPSLNHVFNVAN----FDAIVDIQNEIISQVC 317



 Score = 62.1 bits (149), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 50/250 (20%), Positives = 82/250 (32%), Gaps = 26/250 (10%)

Query: 124  NEGYSISAISRYKI-PLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSR 182
               Y ++    +              T S   VMPI SS  +   T A  D+++++D S 
Sbjct: 1150 GTTYKVNVFGMFDGGESSPLVGQEMTTLSDTTVMPILSS-GMECLTRAEADIVLLVDGSW 1208

Query: 183  SMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLE--WGV 240
            S+                 I+ ++E   + P     VQ  L  +S      + L      
Sbjct: 1209 SIG------RANFRTVRSFISRIVEVFDIGP---KRVQIALAQYSGDPRTEWQLNAHRDK 1259

Query: 241  SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENL 300
              L + +  L   G +T +   L +   Q F  Q             +KI V +TDG   
Sbjct: 1260 KSLLQAVANLPYKGGNTLTGMALNFIRQQNFRTQ------AGMRPRARKIGVLITDG--- 1310

Query: 301  STKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSH 360
              K          + K  G  ++AIGI+     E       P+      N    +++ S 
Sbjct: 1311 --KSQDDVEAPSKKLKDEGVELFAIGIKNADEVELKMIATDPDDT-HAYNVAD-FESLSR 1366

Query: 361  IGKDIVTKRI 370
            I  D+     
Sbjct: 1367 IVDDLTINLC 1376


>gi|114608140|ref|XP_001142912.1| PREDICTED: collagen alpha-1(XII) chain isoform 2 [Pan troglodytes]
          Length = 3063

 Score = 86.4 bits (212), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 53/267 (19%), Positives = 103/267 (38%), Gaps = 37/267 (13%)

Query: 111 VRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDA 170
            ++T+L +  +  +  Y IS  +   +       I   T    + +  +  V + +    
Sbjct: 384 PQTTTLSVRDLSADTEYQISVSAMKGMTSSEPISIMEKTQPMKVQVECSRGVDIKA---- 439

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
             D++ ++D S S+     ++  K+   ++ +      VK      N VQ  LV +S   
Sbjct: 440 --DIVFLVDGSYSIG---IANFVKVRAFLEVL------VKSFEISPNRVQISLVQYSRDP 488

Query: 231 EEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
              F L+       +   I      G STN+   + Y   +IF             +N  
Sbjct: 489 HTEFTLKKFTKVEDIIEAINTFPYRGGSTNTGKAMTYVREKIF------VPSKGSRSNVP 542

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NSF 345
           K+++ +TDG++     D        + +     ++A+G++     E L A ASP      
Sbjct: 543 KVMILITDGKSSDAFRD-----PAIKLRNSDVEIFAVGVKDAVRSE-LEAIASPPAETHV 596

Query: 346 YLVENPHSMYDAFSHIGKDIVTKRIWY 372
           + VE+    +DAF  I  ++ T+ I  
Sbjct: 597 FTVED----FDAFQRISFEL-TQSICL 618



 Score = 86.0 bits (211), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 46/279 (16%), Positives = 100/279 (35%), Gaps = 34/279 (12%)

Query: 101 NGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIP--LKFCTFIPWYTNSRHIVMPI 158
           +G   +      +T   +  +     Y ++  S  ++   +     +   T S    +  
Sbjct: 64  DGPTKEFTLSASTTETLLSELVPETEYVVTITSYDEVEESVPVIGQLTIQTGSSTKPVEK 123

Query: 159 -TSSVKVNSQTDAR-LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVN 216
                ++   + +   D++ ++D S S+      +   I   I ++      V       
Sbjct: 124 KPGKTEIQKCSVSAWTDLVFLVDGSWSVGRN---NFKYILDFIAAL------VSAFDIGE 174

Query: 217 NVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKY-AYNQIFDM 273
              + G+V +S+     F L   +    L   IK +   G +T +   + Y   N   + 
Sbjct: 175 EKTRVGVVQYSSDTRTEFNLNQYYQRDELLAAIKKIPYKGGNTMTGDAIDYLVKNTFTES 234

Query: 274 QGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSH 333
            G R         + K+ + +TDG     K   +      E +  G  V+++GI+   + 
Sbjct: 235 AGARVG-------FPKVAIIITDG-----KSQDEVEIPARELRNVGVEVFSLGIKAADAK 282

Query: 334 EFLRACASP--NSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           E  +  ++P  N  + V N    +DA   I  +I+++  
Sbjct: 283 ELKQIASTPSLNHVFNVAN----FDAIVDIQNEIISQVC 317



 Score = 62.1 bits (149), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 50/250 (20%), Positives = 82/250 (32%), Gaps = 26/250 (10%)

Query: 124  NEGYSISAISRYKI-PLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSR 182
               Y ++    +              T S   VMPI SS  +   T A  D+++++D S 
Sbjct: 1150 GTTYKVNVFGMFDGGESSPLVGQEMTTLSDTTVMPILSS-GMECLTRAEADIVLLVDGSW 1208

Query: 183  SMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLE--WGV 240
            S+                 I+ ++E   + P     VQ  L  +S      + L      
Sbjct: 1209 SIG------RANFRTVRSFISRIVEVFDIGP---KRVQIALAQYSGDPRTEWQLNAHRDK 1259

Query: 241  SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENL 300
              L + +  L   G +T +   L +   Q F  Q             +KI V +TDG   
Sbjct: 1260 KSLLQAVANLPYKGGNTLTGMALNFIRQQNFRTQ------AGMRPRARKIGVLITDG--- 1310

Query: 301  STKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSH 360
              K          + K  G  ++AIGI+     E       P+      N    +++ S 
Sbjct: 1311 --KSQDDVEAPSKKLKDEGVELFAIGIKNADEVELKMIATDPDDT-HAYNVAD-FESLSR 1366

Query: 361  IGKDIVTKRI 370
            I  D+     
Sbjct: 1367 IVDDLTINLC 1376


>gi|73974730|ref|XP_539177.2| PREDICTED: similar to collagen, type XXII, alpha 1 [Canis
           familiaris]
          Length = 1628

 Score = 86.4 bits (212), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 36/216 (16%), Positives = 82/216 (37%), Gaps = 26/216 (12%)

Query: 162 VKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQS 221
            +         D++ +LD S S+           +   + +  +++  ++ PD     + 
Sbjct: 35  AQRAGCKTVHYDLVFLLDTSSSVGK------EDFEKVRQWVANLVDTFEVGPD---RTRV 85

Query: 222 GLVTFSNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQH 279
           G+V +S++    F L        ++   ++L+  G +TN+   L++     F  Q     
Sbjct: 86  GVVRYSDRPTTAFELGLFGSREAVKAAARHLAYHGGNTNTGDALRFITRHSFSRQ---AG 142

Query: 280 CNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRAC 339
               D  +K++ + +TDG           L     A + G  ++A+G+      E     
Sbjct: 143 GRPGDRAFKQVAILLTDGR-----SQDLVLDAAATAHRAGIRIFAVGVGAALREELEEIA 197

Query: 340 ASPN--SFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
           + P     + V +    +DA   I +  + +R+  +
Sbjct: 198 SEPKSAHVFHVSD----FDAIDKI-RGKLRRRLCEN 228


>gi|93141047|ref|NP_004361.3| collagen alpha-1(XII) chain long isoform precursor [Homo sapiens]
 gi|146345397|sp|Q99715|COCA1_HUMAN RecName: Full=Collagen alpha-1(XII) chain; Flags: Precursor
 gi|55662663|emb|CAH71310.1| collagen, type XII, alpha 1 [Homo sapiens]
 gi|56203512|emb|CAI19898.1| collagen, type XII, alpha 1 [Homo sapiens]
 gi|56203521|emb|CAI19908.1| collagen, type XII, alpha 1 [Homo sapiens]
          Length = 3063

 Score = 86.4 bits (212), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 53/267 (19%), Positives = 103/267 (38%), Gaps = 37/267 (13%)

Query: 111 VRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDA 170
            ++T+L +  +  +  Y IS  +   +       I   T    + +  +  V + +    
Sbjct: 384 PQTTTLSVRDLSADTEYQISVSAMKGMTSSEPISIMEKTQPMKVQVECSRGVDIKA---- 439

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
             D++ ++D S S+     ++  K+   ++ +      VK      N VQ  LV +S   
Sbjct: 440 --DIVFLVDGSYSIG---IANFVKVRAFLEVL------VKSFEISPNRVQISLVQYSRDP 488

Query: 231 EEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
              F L+       +   I      G STN+   + Y   +IF             +N  
Sbjct: 489 HTEFTLKKFTKVEDIIEAINTFPYRGGSTNTGKAMTYVREKIF------VPSKGSRSNVP 542

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NSF 345
           K+++ +TDG++     D        + +     ++A+G++     E L A ASP      
Sbjct: 543 KVMILITDGKSSDAFRD-----PAIKLRNSDVEIFAVGVKDAVRSE-LEAIASPPAETHV 596

Query: 346 YLVENPHSMYDAFSHIGKDIVTKRIWY 372
           + VE+    +DAF  I  ++ T+ I  
Sbjct: 597 FTVED----FDAFQRISFEL-TQSICL 618



 Score = 86.0 bits (211), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 46/279 (16%), Positives = 100/279 (35%), Gaps = 34/279 (12%)

Query: 101 NGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIP--LKFCTFIPWYTNSRHIVMPI 158
           +G   +      +T   +  +     Y ++  S  ++   +     +   T S    +  
Sbjct: 64  DGPTKEFTLSASTTETLLSELVPETEYVVTITSYDEVEESVPVIGQLTIQTGSSTKPVEK 123

Query: 159 -TSSVKVNSQTDAR-LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVN 216
                ++   + +   D++ ++D S S+      +   I   I ++      V       
Sbjct: 124 KPGKTEIQKCSVSAWTDLVFLVDGSWSVGRN---NFKYILDFIAAL------VSAFDIGE 174

Query: 217 NVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKY-AYNQIFDM 273
              + G+V +S+     F L   +    L   IK +   G +T +   + Y   N   + 
Sbjct: 175 EKTRVGVVQYSSDTRTEFNLNQYYQRDELLAAIKKIPYKGGNTMTGDAIDYLVKNTFTES 234

Query: 274 QGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSH 333
            G R         + K+ + +TDG     K   +      E +  G  V+++GI+   + 
Sbjct: 235 AGARVG-------FPKVAIIITDG-----KSQDEVEIPARELRNVGVEVFSLGIKAADAK 282

Query: 334 EFLRACASP--NSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           E  +  ++P  N  + V N    +DA   I  +I+++  
Sbjct: 283 ELKQIASTPSLNHVFNVAN----FDAIVDIQNEIISQVC 317



 Score = 62.1 bits (149), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 50/250 (20%), Positives = 82/250 (32%), Gaps = 26/250 (10%)

Query: 124  NEGYSISAISRYKI-PLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSR 182
               Y ++    +              T S   VMPI SS  +   T A  D+++++D S 
Sbjct: 1150 GTTYKVNVFGMFDGGESSPLVGQEMTTLSDTTVMPILSS-GMECLTRAEADIVLLVDGSW 1208

Query: 183  SMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLE--WGV 240
            S+                 I+ ++E   + P     VQ  L  +S      + L      
Sbjct: 1209 SIG------RANFRTVRSFISRIVEVFDIGP---KRVQIALAQYSGDPRTEWQLNAHRDK 1259

Query: 241  SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENL 300
              L + +  L   G +T +   L +   Q F  Q             +KI V +TDG   
Sbjct: 1260 KSLLQAVANLPYKGGNTLTGMALNFIRQQNFRTQ------AGMRPRARKIGVLITDG--- 1310

Query: 301  STKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSH 360
              K          + K  G  ++AIGI+     E       P+      N    +++ S 
Sbjct: 1311 --KSQDDVEAPSKKLKDEGVELFAIGIKNADEVELKMIATDPDDT-HAYNVAD-FESLSR 1366

Query: 361  IGKDIVTKRI 370
            I  D+     
Sbjct: 1367 IVDDLTINLC 1376


>gi|291399641|ref|XP_002716222.1| PREDICTED: collagen, type XXIX, alpha 1 [Oryctolagus cuniculus]
          Length = 2738

 Score = 86.4 bits (212), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 35/217 (16%), Positives = 77/217 (35%), Gaps = 27/217 (12%)

Query: 158 ITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNN 217
           + S        D + D+M ++D S S+     ++  K+   ++++      +  I    +
Sbjct: 613 VHSICTEKGCEDMKADIMFLVDGSSSIGY---ANFEKMKNFMQTL------LAKIQIGAD 663

Query: 218 VVQSGLVTFSNKIEEFFLL-EWGV-SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQG 275
             Q G+  FS+  +E F L ++     +   I  +     +T +   LK+        +G
Sbjct: 664 KTQIGVAQFSDYNKEEFPLNKYFTQKEISDAIDRMLLITGNTLTGSALKFIDTYFTQSKG 723

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF 335
            R          KK ++ +TDGE                 + +G I+ ++G+      + 
Sbjct: 724 ARHG-------VKKFLILITDGE-----AQDDVREPAVALRDKGVIILSVGVYGANRTQL 771

Query: 336 LRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIWY 372
                  +  + VEN   +      I + ++      
Sbjct: 772 EEISGDGSLVFHVENFEDL----KEIERKLIFLVCTL 804



 Score = 79.8 bits (195), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 44/256 (17%), Positives = 87/256 (33%), Gaps = 27/256 (10%)

Query: 125 EGYSISAISRY----KIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQ-TDARLDMMIVLD 179
            G S+S +S Y        KF   +     ++   +     +           D+  ++D
Sbjct: 389 PGQSVSVMSSYADLGNYTTKFMKKLQNEIWAQVSTVAEQMELDKTGCVDTKEADIYFLID 448

Query: 180 VSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK--IEEFFLLE 237
            S S+    D    +I   + ++  M           + V+ G+V +SN   +E    + 
Sbjct: 449 GSSSIR---DKQFLQIKEFMLAVTDMFNI------GPDKVRVGVVQYSNDRAVEFDIDVY 499

Query: 238 WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDG 297
              S L++ I  + +    T +   L       F +  M++   T  +     ++ +TDG
Sbjct: 500 HDNSVLRKAIYNIKQLKGGTLTGKALD------FILPIMKKGRKTRASQVPCYLLVLTDG 553

Query: 298 ENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDA 357
                K + + L      +      +AIGI      E L+           +N  ++   
Sbjct: 554 -----KSEDEVLGPAERIRAEQISTHAIGIGKAHKKELLQIAGEEERVNFGQNTDALKSI 608

Query: 358 FSHIGKDIVTKRIWYD 373
              I   I T++   D
Sbjct: 609 KKEIVHSICTEKGCED 624



 Score = 79.4 bits (194), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 53/326 (16%), Positives = 108/326 (33%), Gaps = 31/326 (9%)

Query: 41  SHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRD 100
            + +F +  +   IDR L+     +     G+  K +       +        F   + D
Sbjct: 682 LNKYFTQKEISDAIDRMLLITGNTL----TGSALKFIDTYFTQSKGARHGVKKFLILITD 737

Query: 101 NGFVNDIDDIVRSTS------LDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHI 154
               +D+ +   +        L + V   N            +      F       R +
Sbjct: 738 GEAQDDVREPAVALRDKGVIILSVGVYGANRTQLEEISGDGSLVFHVENFEDLKEIERKL 797

Query: 155 VMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPD 214
           +  + +           LD++ VLD S S+ S    S+         IN  +  VK    
Sbjct: 798 IFLVCTLHDCKRIQL--LDVVFVLDHSGSINSEQQESM---------INLTIHLVKKSDV 846

Query: 215 VNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFD 272
             + VQ G + +S+  +  F L      S +   ++     G ST +   L  +      
Sbjct: 847 GRDRVQFGALRYSDDPDILFYLNTYSNRSAIIEHLRRRRDTGGSTFTAKALGRS-----A 901

Query: 273 MQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRS 332
                QH +    N K++++ +TDGE+        +     + + +G  + A+G+     
Sbjct: 902 TLFEEQHGSRIKQNVKQMLIIITDGESHDRHLLNDTAL---KLRNKGITIIAVGVGKANQ 958

Query: 333 HEFLRACASPNSFYLVENPHSMYDAF 358
            E      +  +   V++   + D +
Sbjct: 959 EELEAMAGNKENTIHVKDFDKLKDVY 984



 Score = 49.0 bits (115), Expect = 0.001,   Method: Composition-based stats.
 Identities = 32/238 (13%), Positives = 80/238 (33%), Gaps = 32/238 (13%)

Query: 128  SISAIS-RYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMES 186
            +   I        +    +   T       P   +  +    ++ +D+  ++D SR + S
Sbjct: 1918 TFQVIPVPPDGEYEPLDRLQRCTLCYDKCFPNACAKDIFLTEESYMDIAFLIDNSRHVAS 1977

Query: 187  FFDSSITKIDMAIKSINAMLEEVKLIPD---VNNVVQSGLVTFSN-----------KIEE 232
                   +       ++  ++   +  D    N+  +  L+++S            K E 
Sbjct: 1978 ------DEFKAVKDMVSLTIDNFNIASDPLISNSGDRIALLSYSASGSSRRNTSTVKTEF 2031

Query: 233  FFLLEWGVSHLQRKI-KYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKII 291
             F +    + ++  I   L +          L +    +F          T +    K+I
Sbjct: 2032 DFTMYGNQALMKNYIQNSLQQLNGEATIGHALLWTMENLFS--------ETPNIRRHKVI 2083

Query: 292  VFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVE 349
            + ++ GEN   +E  + +     AK +G +++ I +      +     + P   +L++
Sbjct: 2084 LVVSAGENHERREFVKKMAL--RAKCQGYVIFVISLGPAPRDDLEELASHPLDHHLIQ 2139



 Score = 40.9 bits (94), Expect = 0.29,   Method: Composition-based stats.
 Identities = 28/172 (16%), Positives = 59/172 (34%), Gaps = 23/172 (13%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVN-NVVQSGLVT 225
           Q D+  D++ ++D S                  + +   LE++    DV  N  + GL+ 
Sbjct: 230 QKDSLADLVFLVDESLGSRQNL-----------RHLQTFLEDISSSMDVKENCTRLGLMR 278

Query: 226 FSNKIEEF--FLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           +S   +           S  Q++++ LS      ++   +     Q+          +  
Sbjct: 279 YSTSTKTVSSLKSSRSQSEFQQQVQKLSLQAGRAHTGAAI----EQLRREGFSEAGGSRR 334

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF 335
                +I V +T     S   D +      + +  G  V+A+ I+   S + 
Sbjct: 335 AQGVPQIAVLVT-----SRPSDDEVRDAALDLRLEGVTVFAVNIQGANSTQL 381


>gi|193786838|dbj|BAG52161.1| unnamed protein product [Homo sapiens]
          Length = 496

 Score = 86.4 bits (212), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 35/200 (17%), Positives = 83/200 (41%), Gaps = 21/200 (10%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D++ V+D SRS+         + +     ++ ++E + + P+     + G+V +++ +++
Sbjct: 41  DLVFVVDSSRSVRP------VEFEKVKVFLSQVIESLDVGPNA---TRVGMVNYASTVKQ 91

Query: 233 FFLLEWGVSHLQ--RKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKI 290
            F L   VS     + ++ +      T +   +++A  + F   G  +   +   +  K+
Sbjct: 92  EFSLRAHVSKAALLQAVRRIQPLSTGTMTGLAIQFAITKAF---GDAEGGRSRSPDISKV 148

Query: 291 IVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVEN 350
           ++ +TDG    + +D  +      A+  G  ++AIG+  +     LR  AS      V+ 
Sbjct: 149 VIVVTDGRPQDSVQDVSAR-----ARASGVELFAIGVGSVD-KATLRQIASEPQDEHVDY 202

Query: 351 PHSMYDAFSHIGKDIVTKRI 370
             S Y     + +       
Sbjct: 203 VES-YSVIEKLSRKFQEAFC 221



 Score = 80.6 bits (197), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 40/220 (18%), Positives = 84/220 (38%), Gaps = 30/220 (13%)

Query: 159 TSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNV 218
           T +V       +  D++ ++D S+S+           ++  K I+ +++ + +      +
Sbjct: 261 TCNVCSGGGGSSATDLVFLIDGSKSVRP------ENFELVKKFISQIVDTLDVSD---KL 311

Query: 219 VQSGLVTFSNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAY-NQIFDMQG 275
            Q GLV +S+ + + F L        ++  ++ +S    ST +   LKY   N      G
Sbjct: 312 AQVGLVQYSSSVRQEFPLGRFHTKKDIKAAVRNMSYMEKSTMTGAALKYLIDNSFTVSSG 371

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF 335
            R          +K+ +  TDG +     D        +AK  G  ++A+G+      E 
Sbjct: 372 ARPGA-------QKVGIVFTDGRSQDYINDA-----AKKAKDLGFKMFAVGVGNAVEDEL 419

Query: 336 LRACASP--NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
               + P    ++   +    +   + IGK +  K    +
Sbjct: 420 REIASEPVAEHYFYTAD----FKTINQIGKKLQKKICVEE 455


>gi|332817898|ref|XP_003310056.1| PREDICTED: collagen alpha-5(VI) chain isoform 1 [Pan troglodytes]
          Length = 2615

 Score = 86.4 bits (212), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 63/349 (18%), Positives = 127/349 (36%), Gaps = 53/349 (15%)

Query: 41  SHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRD 100
            + +F +  +   IDR  +      +NEG          G  L  +   +  S    L  
Sbjct: 682 LNRYFTQQEISDAIDRMSL------INEGTLT-------GKALNFVGQYFTHSKGARLGA 728

Query: 101 NGFVNDIDDIVRSTSL-DIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNS-------- 151
             F+  I D V    + D   + + +  +I ++  Y         I   ++         
Sbjct: 729 KKFLILITDGVAQDDVRDPARILRGKDVTIFSVGVYNANRSQLEEISGDSSLVFHVENFD 788

Query: 152 ------RHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAM 205
                 R ++  + +       T   LD++ VLD S S++  +   +         IN  
Sbjct: 789 HLKALERKLIFHVCALHDCKRITL--LDVVFVLDHSGSIKKQYQDHM---------INLT 837

Query: 206 LEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGL 263
           +  VK      + VQ G + +S++    F L      S +   ++     G +T +   L
Sbjct: 838 IHLVKKADVGRDRVQFGALKYSDQPNILFYLNTYSNRSAIIENLRKRRDTGGNTYTAKAL 897

Query: 264 KYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVY 323
           K+A N +F      +H +    N K++++ +TDGE+    +   +     E + +G  ++
Sbjct: 898 KHA-NALFT----EEHGSRIKQNVKQMLIVITDGESHDHDQLNDTAL---ELRNKGITIF 949

Query: 324 AIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIWY 372
           A+G+      E      + N+   V+N   + D F+     +  +    
Sbjct: 950 AVGVGKANQKELEGMAGNKNNTIYVDNFDKLKDVFT----LVQERMCTE 994



 Score = 78.7 bits (192), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 33/192 (17%), Positives = 70/192 (36%), Gaps = 23/192 (11%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
               D + D+M ++D S S+    + +  K+ + +K++      +  I    +  Q G+V
Sbjct: 620 KGCEDMKADIMFLVDSSWSIG---NENFRKMKIFMKNL------LTKIQIGADKTQIGVV 670

Query: 225 TFSNKIEEFFLL-EWGVS-HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS+K +E F L  +     +   I  +S     T +   L +        +G R     
Sbjct: 671 QFSDKTKEEFQLNRYFTQQEISDAIDRMSLINEGTLTGKALNFVGQYFTHSKGARLGA-- 728

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                KK ++ +TDG                  + +   ++++G+      +        
Sbjct: 729 -----KKFLILITDG-----VAQDDVRDPARILRGKDVTIFSVGVYNANRSQLEEISGDS 778

Query: 343 NSFYLVENPHSM 354
           +  + VEN   +
Sbjct: 779 SLVFHVENFDHL 790



 Score = 73.3 bits (178), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 31/203 (15%), Positives = 71/203 (34%), Gaps = 22/203 (10%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D+  ++D S S++      I +          MLE  ++     + V+ G+V +S+  E 
Sbjct: 442 DIHFLIDGSSSIQEKQFEQIKRF---------MLEVTEMFSIGPDKVRVGVVQYSDDTEV 492

Query: 233 FFLLEWGVSHL--QRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKI 290
            F +    + +  ++ I  + +    T +   L Y    I +    R             
Sbjct: 493 EFYVTDYSNDIDLRKAIFNIKQLTGGTYTGKALDYILQIIKNGMKDRMSK------VPCY 546

Query: 291 IVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVEN 350
           ++ +TDG +       + +      +     V+A+GI      E              +N
Sbjct: 547 LIVLTDGMSTD-----RVVEPAKRLRAEQITVHAVGIGAANKTELQEIAGKEERVSFGQN 601

Query: 351 PHSMYDAFSHIGKDIVTKRIWYD 373
             ++    + + ++I  ++   D
Sbjct: 602 FDALKSIKNEVIREICAEKGCED 624



 Score = 50.2 bits (118), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 28/185 (15%), Positives = 65/185 (35%), Gaps = 22/185 (11%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D++ ++D S   +     S   +   I       + +  +P   N  +  L  +S++   
Sbjct: 30  DVVFLVDSS---DHLGPKSFPFVKTFIS------KMINSLPIEANKYRVALAQYSDEFHS 80

Query: 233 FFLLEW--GVSHLQRKIKY-LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
            F L    G S +   +K      G S      L+ A+   F      +    +   +  
Sbjct: 81  EFHLSTFEGRSPMLNHLKKNFQFIGGSLQIGKALQEAHRTYFSAPTNGR----DRKQFPP 136

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVE 349
           I+V +      S + + +        +K G  + ++G++       L+A A+ +  + + 
Sbjct: 137 ILVVL-----ASAESEDEVEGASKALQKDGVKIISVGVQEASEEN-LKAMATSHFHFNLR 190

Query: 350 NPHSM 354
               +
Sbjct: 191 TIRDL 195


>gi|71896057|ref|NP_001025613.1| matrilin 1, cartilage matrix protein [Xenopus (Silurana)
           tropicalis]
 gi|60552391|gb|AAH91071.1| MGC108367 protein [Xenopus (Silurana) tropicalis]
          Length = 490

 Score = 86.4 bits (212), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 34/203 (16%), Positives = 83/203 (40%), Gaps = 20/203 (9%)

Query: 161 SVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQ 220
           + K  +      D++ ++D SRS+        ++ +     ++ ++E + +     N  +
Sbjct: 26  AQKGPNCRTRPTDILFIIDSSRSVRP------SEFEQVKVFLSQVVESLDV---GANATR 76

Query: 221 SGLVTFSNKIEEFFLLEWGVSH--LQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQ 278
            GLV +++ ++  F L+   +   L + +K +      T +   ++YA N  F      +
Sbjct: 77  VGLVNYASTVKNEFSLKTHKAKPALLQAVKKVQPLSTGTMTGLAIQYAINIAFTEPEGAR 136

Query: 279 HCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRA 338
             +       K+ + +TDG      +D  +      A++ G  +YAIG+  +  +   + 
Sbjct: 137 LKSPG---INKVAIIVTDGRPQDAVKDISAR-----ARESGLEIYAIGVGRVDKNTLRQI 188

Query: 339 CASP-NSFYLVENPHSMYDAFSH 360
            + P +        +S+ +  S 
Sbjct: 189 ASEPLDEHVDYVESYSLIEKLSK 211



 Score = 84.8 bits (208), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 64/399 (16%), Positives = 135/399 (33%), Gaps = 58/399 (14%)

Query: 6   LNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVH-AATQ 64
           + + N+    K   ++ T    P +   +  +  +S        +   I+ +       +
Sbjct: 77  VGLVNYASTVKNEFSLKTHKAKPALLQAVKKVQPLSTGTMTGLAIQYAINIAFTEPEGAR 136

Query: 65  IMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQN 124
           + + G       +  G     +K+    +  + L    +   +  + ++T   I   P +
Sbjct: 137 LKSPGINKVAIIVTDGRPQDAVKDISARARESGLE--IYAIGVGRVDKNTLRQIASEPLD 194

Query: 125 E------GYSISAISRYKIPLKFCTFIPWYTNSRH----IVMPITSSVKVNSQTDARL-- 172
           E       YS+      K    FC      +   H    I +    S     +    L  
Sbjct: 195 EHVDYVESYSLIEKLSKKFQEAFCVTADLCSTGDHDCEQICVSTPGSYTCACRDGFTLNE 254

Query: 173 -------------DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
                        D++ ++D S+S+           ++  + IN ++E + +     +V 
Sbjct: 255 DGKTCNACGASAVDLVFLIDGSKSVRP------ENFELVKQFINQIVESMDVGDHRAHV- 307

Query: 220 QSGLVTFSNKIEEFFLLEWGVSH--LQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
             GLV +S+ + + F L    S   ++  +K +S     T +   L+Y  +  F +    
Sbjct: 308 --GLVQYSSSVRQEFPLGRYTSKKDIKSAVKKMSYMEKGTMTGQALQYLIDNSFAIS--- 362

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
              +       K+ +  TDG +     D         AK+ G  ++A+G+      E   
Sbjct: 363 ---SGGRPAVPKVGIVFTDGRSQDYINDAALR-----AKELGYKMFAVGVGNAVEEELRM 414

Query: 338 ACASP---NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
             + P   +SFY  +     + A   IGK +  K    +
Sbjct: 415 IASEPVVEHSFYTAD-----FKAMKEIGKKLQMKICVEE 448


>gi|211546|gb|AAA48695.1| cartilage matrix protein [Gallus gallus]
          Length = 416

 Score = 86.4 bits (212), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 40/230 (17%), Positives = 86/230 (37%), Gaps = 28/230 (12%)

Query: 148 YTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLE 207
                 +     +    +  + + LD++ ++D S+S+           ++  K IN ++E
Sbjct: 170 CKEGFTLNNDGKTCSACSGGSGSALDLVFLIDGSKSVRP------ENFELVKKFINQIVE 223

Query: 208 EVKLIPDVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKY 265
            +++        Q GLV +S+ + + F L        ++  +K ++     T +   LKY
Sbjct: 224 SLEV---SEKQAQVGLVQYSSSVRQEFPLGQFKNKKDIKAAVKKMAYMEKGTMTGQALKY 280

Query: 266 AYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAI 325
             +  F +       N       K+ +  TDG +     D        +AK  G  ++A+
Sbjct: 281 LVDSSFSI------ANGARPGVPKVGIVFTDGRSQDYITDA-----AKKAKDLGFRMFAV 329

Query: 326 GIRVIRSHEFLRACASP--NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
           G+      E     + P    ++   +    +   S+IGK +  K    +
Sbjct: 330 GVGNAVEDELREIASEPVAEHYFYTAD----FRTISNIGKKLQMKICVEE 375



 Score = 64.8 bits (156), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 22/147 (14%), Positives = 59/147 (40%), Gaps = 15/147 (10%)

Query: 221 SGLVTFSNKIEEFFLLEWGVSHLQ--RKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQ 278
            G++ +++ ++  F L+   +  +  + ++ +      T +   +++A ++ F      +
Sbjct: 1   VGVINYASAVKNEFSLKTHQTKAELLQAVQRIEPLSTGTMTGLAIQFAISRAFS---DTE 57

Query: 279 HCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRA 338
                  N  K+ + +TDG      +D  +      A++ G  ++AIG+  +  H   + 
Sbjct: 58  GARLRSPNINKVAIVVTDGRPQDGVQDVSAR-----ARQAGIEIFAIGVGRVDMHTLRQI 112

Query: 339 CASP--NSFYLVEN---PHSMYDAFSH 360
            + P  +    VE+      +   F  
Sbjct: 113 ASEPLDDHVDYVESYSVIEKLTHKFQE 139


>gi|296484270|gb|DAA26385.1| collagen, type XII, alpha 1 [Bos taurus]
          Length = 3115

 Score = 86.4 bits (212), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 53/267 (19%), Positives = 103/267 (38%), Gaps = 37/267 (13%)

Query: 111 VRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDA 170
            ++T+L +  +  +  Y IS  +   +       I   T    + +  +  V + +    
Sbjct: 384 PQTTTLSVRDLSADTEYQISVSAMKGLTSSEPVSIMEKTQPMKVQVECSRGVDIKA---- 439

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
             D++ ++D S S+     ++  K+   ++ +      VK      N VQ  LV +S   
Sbjct: 440 --DIVFLVDGSYSIG---IANFVKVRAFLEVL------VKSFEISPNRVQISLVQYSRDP 488

Query: 231 EEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
              F L+       +   I      G STN+   + Y   +IF             +N  
Sbjct: 489 HTEFTLKKFTKVEDIIEAINTFPYRGGSTNTGKAMTYVREKIF------VPSKGSRSNVP 542

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NSF 345
           K+++ +TDG++     D        + +     ++A+G++     E L A ASP      
Sbjct: 543 KVMILITDGKSSDAFRD-----PAIKLRNSDVEIFAVGVKDAVRSE-LEAIASPPAETHV 596

Query: 346 YLVENPHSMYDAFSHIGKDIVTKRIWY 372
           + VE+    +DAF  I  ++ T+ I  
Sbjct: 597 FTVED----FDAFQRISFEL-TQSICL 618



 Score = 82.1 bits (201), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 45/279 (16%), Positives = 98/279 (35%), Gaps = 34/279 (12%)

Query: 101 NGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIP--LKFCTFIPWYTNSRHIVMPI 158
           +G   +      +T   +  +     Y ++  S  ++   +     +   T         
Sbjct: 64  DGPTKEFTLSASTTETLLTELIPEIEYVVTITSYDEVEESVPVIGQLTIQTGGPTKPGEK 123

Query: 159 -TSSVKVNSQTDAR-LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVN 216
                ++   + +   D++ ++D S S+      +   I   I ++      V       
Sbjct: 124 KPGKTEIQKCSVSAWTDLVFLVDGSWSVGRN---NFKYILDFIAAL------VSAFDIGE 174

Query: 217 NVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKY-AYNQIFDM 273
              + G+V +S+     F L   +    L   IK +   G +T +   + Y   N   + 
Sbjct: 175 EKTRVGVVQYSSDTRTEFNLNQYYQQEELLAAIKKIPYKGGNTMTGEAIDYLIKNTFTES 234

Query: 274 QGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSH 333
            G R         + K+ + +TDG     K   +      E +  G  V+++GI+   + 
Sbjct: 235 AGARVG-------FPKVAIIITDG-----KSQDEVEIPARELRNIGVEVFSLGIKAADAK 282

Query: 334 EFLRACASP--NSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           E  +  ++P  N  + V N    +DA   I  +I+++  
Sbjct: 283 ELKQIASTPSLNHVFNVAN----FDAIVDIQNEIISQVC 317



 Score = 64.0 bits (154), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 50/250 (20%), Positives = 82/250 (32%), Gaps = 26/250 (10%)

Query: 124  NEGYSISAISRYKI-PLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSR 182
               Y ++    +              T S   VMPI SS  +   T A  D+++++D S 
Sbjct: 1150 GTTYKVNVFGMFDGGESSPLVGQEMTTLSDTTVMPILSS-GMECLTRAEADIVLLVDGSW 1208

Query: 183  SMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSH 242
            S+                 I+ ++E  ++ P     VQ  L  +S      + L      
Sbjct: 1209 SIG------RANFRTVRSFISRIVEVFEIGP---KRVQIALAQYSGDPRTEWQLNAHKDK 1259

Query: 243  LQ--RKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENL 300
                + +  L   G +T +   L +   Q F  Q             +KI V +TDG   
Sbjct: 1260 KSLLQAVANLPYKGGNTLTGMALNFIRQQSFKTQ------AGMRPRARKIGVLITDG--- 1310

Query: 301  STKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSH 360
              K          + K  G  ++AIGI+     E       P+      N    +D+ S 
Sbjct: 1311 --KSQDDVEAPSKKLKDEGVELFAIGIKNADEVELKMIATDPDDI-HAYNVAD-FDSLSR 1366

Query: 361  IGKDIVTKRI 370
            I  D+     
Sbjct: 1367 IVDDLTNNLC 1376


>gi|148726250|emb|CAN88322.1| matrilin 1 [Danio rerio]
 gi|148726498|emb|CAN88268.1| matrilin 1 [Danio rerio]
          Length = 277

 Score = 86.0 bits (211), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 31/216 (14%), Positives = 82/216 (37%), Gaps = 27/216 (12%)

Query: 153 HIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLI 212
            + +   +++          D++ ++D SRS+        ++ +     +  +++ + + 
Sbjct: 18  TVDLRQAAAMAAGLCNTKPTDVVFIVDSSRSVRP------SEFEQVKVFLAKVIDGLSVG 71

Query: 213 PDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQ--RKIKYLSKFGVSTNSTPGLKYAYNQI 270
           PD     + G+V ++++++    L+   +     + +  +      T +   +++A N  
Sbjct: 72  PDA---TRVGVVNYASRVKNEVSLKSHKTKAALVKAVSKIEPLSTGTMTGLAIQFAMNVA 128

Query: 271 FDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI 330
           F      +    +  +  K+ + +TDG       D         A++ G  ++AIG+  +
Sbjct: 129 FSEAEGGR----KSPDISKVAIIVTDGRPQDNIRD-----IAARAREAGIEIFAIGVGRV 179

Query: 331 RSHEFLRACAS---PNSFYLVEN---PHSMYDAFSH 360
                LR  AS    +    VE+      +   F  
Sbjct: 180 D-MTTLRQMASEPLEDHVDYVESYSLIEKLTKKFQE 214


>gi|293361347|ref|XP_576462.3| PREDICTED: collagen type VI alpha 5 [Rattus norvegicus]
          Length = 1730

 Score = 86.0 bits (211), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 49/279 (17%), Positives = 99/279 (35%), Gaps = 34/279 (12%)

Query: 103 FVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSV 162
           F   +     +   DIV  P  +  SIS  S YK    +        ++       T + 
Sbjct: 395 FAMSVQGANNTQLEDIVSYPSRQ--SISTHSSYKHLESYSGNFLKKIHNEIWTQVSTHAE 452

Query: 163 KVNSQTDARLD-----MMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNN 217
           ++       +D     +  ++D S S+         +I + + S+      V + P   N
Sbjct: 453 QMELDKTGCVDTKEADIYFLIDGSSSIR---RKEFEQIQIFMSSV------VDMFPIGPN 503

Query: 218 VVQSGLVTFSNKIEEFFLLEWGVSHL--QRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQG 275
            V+ G+V +S++ E  F +      +  ++ +  + +    T +   L +    I   + 
Sbjct: 504 NVRVGVVQYSHRNEVEFPVSQYTKGIELRKAVWNIKQLKGGTFTGKALDFILPIIKKGKS 563

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF 335
            R H           ++ +TDG     K +   L   N  +     ++A+GI      + 
Sbjct: 564 ERIH------EVPCYLIVLTDG-----KSNDSVLEPANRLRAEHITIHAVGIGEANKTQL 612

Query: 336 LRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYDK 374
            +           +N    +D+  +I  +IV + I  DK
Sbjct: 613 QQIAGKDERVSFGQN----FDSLKYIKNEIVHR-ICSDK 646



 Score = 79.8 bits (195), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 46/281 (16%), Positives = 103/281 (36%), Gaps = 33/281 (11%)

Query: 97  ELRDNGFVNDIDDIVRSTSLDI--VVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRH- 153
           + + N  V +  + +R+  + I  V + +     +  I+     + F          ++ 
Sbjct: 578 DGKSNDSVLEPANRLRAEHITIHAVGIGEANKTQLQQIAGKDERVSFGQNFDSLKYIKNE 637

Query: 154 IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
           IV  I S        D + D+M ++D S S+     ++  K+   +K++         I 
Sbjct: 638 IVHRICSD---KGCEDMKADIMFLVDSSGSIG---LTNFEKMKTFMKNLVG------KIE 685

Query: 214 DVNNVVQSGLVTFSNKIEEFFLL-EWGV-SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIF 271
              +  Q G+V FS+  +E F L ++     +   I  +S    +T +   L +  N+ F
Sbjct: 686 IGADRSQVGVVQFSDYNKEEFQLNKYSTREEVYAAIDGMSPINRNTLTGSALTF-VNEYF 744

Query: 272 DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR 331
           D+              +K ++ +TDGE        +        + +   ++++G+    
Sbjct: 745 DIS------KGGRPQVRKFLILLTDGE-----AQDEVGGPAMALRSKSVTIFSVGVYGAN 793

Query: 332 SHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIWY 372
             +        +  + VEN    +D    I   ++ +    
Sbjct: 794 RTQLEEISGEGSLVFHVEN----FDHLKTIESKLIFRVCAL 830



 Score = 79.8 bits (195), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 41/189 (21%), Positives = 77/189 (40%), Gaps = 19/189 (10%)

Query: 172  LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
            LD++ VLD S S+      S+         IN  +  V+      + VQ G + +SN  E
Sbjct: 839  LDIVFVLDHSGSIGPREQESM---------INLTIHLVEKADVGRDRVQFGALMYSNNPE 889

Query: 232  EFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
              F L      S +   +K        T +   L++A N +F    M +H +    N ++
Sbjct: 890  ILFYLNTYSSRSAITEHLKRPRDTRGDTYTAKALQHA-NILF----MEEHGSRLKQNVRQ 944

Query: 290  IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVE 349
            +++ +TDGE+    +  +      E + +G  ++A+G+      E         +   V+
Sbjct: 945  LMIVITDGES---HDRDKLNDTARELRDKGITIFAVGVGRANQDELETMAGKKENTIHVD 1001

Query: 350  NPHSMYDAF 358
            N   + D +
Sbjct: 1002 NFDKLRDIY 1010



 Score = 51.3 bits (121), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 27/206 (13%), Positives = 70/206 (33%), Gaps = 25/206 (12%)

Query: 154 IVMPITSSVKVNSQTDARL-DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLI 212
           +++   +    +     +  D++ ++D S  +       I         +N ++  +   
Sbjct: 10  LILWTETLSDQSPGPGPKYADVVFLVDSSDYLG------IKSFPFVRTFLNKIISSL--- 60

Query: 213 PDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKF----GVSTNSTPGLKYAYN 268
           P   N  +  L  +S+ +   F L    +     + +L K     G S      L+ A+ 
Sbjct: 61  PVEANKYRVALAQYSDALHNEFHLGAFKNR-NPMLNHLKKNFGFIGGSLKIGNALQEAHR 119

Query: 269 QIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR 328
             F      +        +  I+V +      S + +          ++ G  + ++G++
Sbjct: 120 TYFSAPTNGRDKK----QFPPILVVL-----ASAESEDDVEEASKALREDGVKIISVGVQ 170

Query: 329 VIRSHEFLRACASPNSFYLVENPHSM 354
                + L+A A+P   + +     +
Sbjct: 171 KASEED-LKAMATPQFHFNLRTARDL 195



 Score = 45.5 bits (106), Expect = 0.014,   Method: Composition-based stats.
 Identities = 37/292 (12%), Positives = 98/292 (33%), Gaps = 31/292 (10%)

Query: 50  LHSMIDRSLVHAATQIMNEG----NGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVN 105
           L S      V  A++ + E          +K    D+       ++ + R     + F  
Sbjct: 141 LASAESEDDVEEASKALREDGVKIISVGVQKASEEDLKAMATPQFHFNLRTARDLSLFAP 200

Query: 106 DIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVN 165
           D+  I++    D+    +    ++        P    T     T + ++   +      +
Sbjct: 201 DMAQIIQ----DVTQYREGTTVAVVTDVAPTTPEPLITPAALTTPANNVDETVPFLA--S 254

Query: 166 SQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVT 225
            Q D+  D++ ++D S         +   +      +  +   V +  +    ++ GL++
Sbjct: 255 CQKDSLADLIFLVDES-------VGTTQNLRDLQNFLENVTSSVDVKDNC---MRLGLMS 304

Query: 226 FSN--KIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           FS+  +           S  Q++I+ LS    ++N    +++    +          + +
Sbjct: 305 FSDKARTVSSLKSSTSQSDFQQQIQKLSLRTGASNVGAAIEH----MRTEGFSESSGSRK 360

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF 335
                +I V +T         D        + + +G  ++A+ ++   + + 
Sbjct: 361 AQGVPQIAVLVT-----HRASDDAVREAALDLRLQGVTMFAMSVQGANNTQL 407


>gi|189066649|dbj|BAG36196.1| unnamed protein product [Homo sapiens]
          Length = 957

 Score = 86.0 bits (211), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 42/214 (19%), Positives = 82/214 (38%), Gaps = 33/214 (15%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           +S   A  D++ +LD S S+           ++  K +  + +   + P     +Q G+V
Sbjct: 29  SSCRTAPTDLVFILDGSYSVGP------ENFEIVKKWLVNITKNFDIGP---KFIQVGVV 79

Query: 225 TFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S+       L       HL   ++ +   G +T +   +++A + +F           
Sbjct: 80  QYSDYPVLEIPLGSYDSGEHLTAAVESILYLGGNTKTGKAIQFALDYLF---------AK 130

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA-- 340
                 KI V +TDG     K           A+     ++AIG+        LRA A  
Sbjct: 131 SSRFLTKIAVVLTDG-----KSQDDVKDAAQAARDSKITLFAIGVGSETEDAELRAIANK 185

Query: 341 -SPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
            S    + VE+    Y A S I ++++ +++  +
Sbjct: 186 PSSTYVFYVED----YIAISKI-REVMKQKLCEE 214


>gi|119624855|gb|EAX04450.1| collagen, type XXI, alpha 1, isoform CRA_c [Homo sapiens]
          Length = 552

 Score = 86.0 bits (211), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 42/214 (19%), Positives = 82/214 (38%), Gaps = 33/214 (15%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           +S   A  D++ +LD S S+           ++  K +  + +   + P     +Q G+V
Sbjct: 29  SSCRTAPTDLVFILDGSYSVGP------ENFEIVKKWLVNITKNFDIGP---KFIQVGVV 79

Query: 225 TFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S+       L       HL   ++ +   G +T +   +++A + +F           
Sbjct: 80  QYSDYPVLEIPLGSYDSGEHLTAAVESILYLGGNTKTGKAIQFALDYLF---------AK 130

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA-- 340
                 KI V +TDG     K           A+     ++AIG+        LRA A  
Sbjct: 131 SSRFLTKIAVVLTDG-----KSQDDVKDAAQAARDSKITLFAIGVGSETEDAELRAIANK 185

Query: 341 -SPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
            S    + VE+    Y A S I ++++ +++  +
Sbjct: 186 PSSTYVFYVED----YIAISKI-REVMKQKLCEE 214


>gi|119624854|gb|EAX04449.1| collagen, type XXI, alpha 1, isoform CRA_b [Homo sapiens]
          Length = 567

 Score = 86.0 bits (211), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 42/214 (19%), Positives = 82/214 (38%), Gaps = 33/214 (15%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           +S   A  D++ +LD S S+           ++  K +  + +   + P     +Q G+V
Sbjct: 29  SSCRTAPTDLVFILDGSYSVGP------ENFEIVKKWLVNITKNFDIGP---KFIQVGVV 79

Query: 225 TFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S+       L       HL   ++ +   G +T +   +++A + +F           
Sbjct: 80  QYSDYPVLEIPLGSYDSGEHLTAAVESILYLGGNTKTGKAIQFALDYLF---------AK 130

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA-- 340
                 KI V +TDG     K           A+     ++AIG+        LRA A  
Sbjct: 131 SSRFLTKIAVVLTDG-----KSQDDVKDAAQAARDSKITLFAIGVGSETEDAELRAIANK 185

Query: 341 -SPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
            S    + VE+    Y A S I ++++ +++  +
Sbjct: 186 PSSTYVFYVED----YIAISKI-REVMKQKLCEE 214


>gi|114607957|ref|XP_001157649.1| PREDICTED: collagen alpha-1(XXI) chain isoform 3 [Pan troglodytes]
          Length = 957

 Score = 86.0 bits (211), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 42/214 (19%), Positives = 82/214 (38%), Gaps = 33/214 (15%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           +S   A  D++ +LD S S+           ++  K +  + +   + P     +Q G+V
Sbjct: 29  SSCRTAPTDLVFILDGSYSVGP------ENFEIVKKWLVNITKNFDIGP---KFIQVGVV 79

Query: 225 TFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S+       L       HL   ++ +   G +T +   +++A + +F           
Sbjct: 80  QYSDYPVLEIPLGSYDSGEHLTAAVESILYLGGNTKTGKAIQFALDYLF---------AK 130

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA-- 340
                 KI V +TDG     K           A+     ++AIG+        LRA A  
Sbjct: 131 SSRFLTKIAVVLTDG-----KSQDDVKDAAQAARDSKITLFAIGVGSETEDAELRAIANK 185

Query: 341 -SPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
            S    + VE+    Y A S I ++++ +++  +
Sbjct: 186 PSSTYVFYVED----YIAISKI-REVMKQKLCEE 214


>gi|114607959|ref|XP_001157475.1| PREDICTED: collagen, type XXI, alpha 1 isoform 1 [Pan troglodytes]
 gi|114607961|ref|XP_518554.2| PREDICTED: collagen, type XXI, alpha 1 isoform 4 [Pan troglodytes]
 gi|114607963|ref|XP_001157591.1| PREDICTED: collagen, type XXI, alpha 1 isoform 2 [Pan troglodytes]
          Length = 954

 Score = 86.0 bits (211), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 42/214 (19%), Positives = 82/214 (38%), Gaps = 33/214 (15%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           +S   A  D++ +LD S S+           ++  K +  + +   + P     +Q G+V
Sbjct: 29  SSCRTAPTDLVFILDGSYSVGP------ENFEIVKKWLVNITKNFDIGP---KFIQVGVV 79

Query: 225 TFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S+       L       HL   ++ +   G +T +   +++A + +F           
Sbjct: 80  QYSDYPVLEIPLGSYDSGEHLTAAVESILYLGGNTKTGKAIQFALDYLF---------AK 130

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA-- 340
                 KI V +TDG     K           A+     ++AIG+        LRA A  
Sbjct: 131 SSRFLTKIAVVLTDG-----KSQDDVKDAAQAARDSKITLFAIGVGSETEDAELRAIANK 185

Query: 341 -SPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
            S    + VE+    Y A S I ++++ +++  +
Sbjct: 186 PSSTYVFYVED----YIAISKI-REVMKQKLCEE 214


>gi|18780273|ref|NP_110447.2| collagen alpha-1(XXI) chain precursor [Homo sapiens]
 gi|74752071|sp|Q96P44|COLA1_HUMAN RecName: Full=Collagen alpha-1(XXI) chain; Flags: Precursor
 gi|15593270|gb|AAL02227.1|AF414088_1 collagen XXI [Homo sapiens]
 gi|19310967|gb|AAL86699.1|AF438327_1 alpha 1 type XXI collagen precursor [Homo sapiens]
 gi|55665071|emb|CAH73913.1| collagen type XXI alpha 1 [Homo sapiens]
 gi|56202573|emb|CAI22496.1| collagen type XXI alpha 1 [Homo sapiens]
 gi|56202937|emb|CAI22395.1| collagen type XXI alpha 1 [Homo sapiens]
 gi|116496597|gb|AAI26109.1| Collagen, type XXI, alpha 1 [Homo sapiens]
 gi|215434893|gb|ACJ66843.1| alpha 1 type XXI collagen precursor [Homo sapiens]
          Length = 957

 Score = 86.0 bits (211), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 42/214 (19%), Positives = 82/214 (38%), Gaps = 33/214 (15%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           +S   A  D++ +LD S S+           ++  K +  + +   + P     +Q G+V
Sbjct: 29  SSCRTAPTDLVFILDGSYSVGP------ENFEIVKKWLVNITKNFDIGP---KFIQVGVV 79

Query: 225 TFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S+       L       HL   ++ +   G +T +   +++A + +F           
Sbjct: 80  QYSDYPVLEIPLGSYDSGEHLTAAVESILYLGGNTKTGKAIQFALDYLF---------AK 130

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA-- 340
                 KI V +TDG     K           A+     ++AIG+        LRA A  
Sbjct: 131 SSRFLTKIAVVLTDG-----KSQDDVKDAAQAARDSKITLFAIGVGSETEDAELRAIANK 185

Query: 341 -SPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
            S    + VE+    Y A S I ++++ +++  +
Sbjct: 186 PSSTYVFYVED----YIAISKI-REVMKQKLCEE 214


>gi|17974510|gb|AAL50033.1|AF330693_1 alpha 1 chain-like collagen COLA1L precursor [Homo sapiens]
 gi|55665070|emb|CAH73912.1| collagen type XXI alpha 1 [Homo sapiens]
 gi|56202574|emb|CAI22497.1| collagen type XXI alpha 1 [Homo sapiens]
 gi|56202938|emb|CAI22396.1| collagen type XXI alpha 1 [Homo sapiens]
          Length = 954

 Score = 86.0 bits (211), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 42/214 (19%), Positives = 82/214 (38%), Gaps = 33/214 (15%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           +S   A  D++ +LD S S+           ++  K +  + +   + P     +Q G+V
Sbjct: 29  SSCRTAPTDLVFILDGSYSVGP------ENFEIVKKWLVNITKNFDIGP---KFIQVGVV 79

Query: 225 TFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S+       L       HL   ++ +   G +T +   +++A + +F           
Sbjct: 80  QYSDYPVLEIPLGSYDSGEHLTAAVESILYLGGNTKTGKAIQFALDYLF---------AK 130

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA-- 340
                 KI V +TDG     K           A+     ++AIG+        LRA A  
Sbjct: 131 SSRFLTKIAVVLTDG-----KSQDDVKDAAQAARDSKITLFAIGVGSETEDAELRAIANK 185

Query: 341 -SPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
            S    + VE+    Y A S I ++++ +++  +
Sbjct: 186 PSSTYVFYVED----YIAISKI-REVMKQKLCEE 214


>gi|212720733|ref|NP_001132911.1| collagen, type XXII, alpha 1 [Gallus gallus]
          Length = 1599

 Score = 86.0 bits (211), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 34/218 (15%), Positives = 85/218 (38%), Gaps = 21/218 (9%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           +  +     +   D++ +LD S S+           +   + ++ ++E  ++ PD     
Sbjct: 25  TEAQRAGCKNVHYDLVFILDASSSVGK------EDFEKVRQWVSNLVETFEIGPDK---T 75

Query: 220 QSGLVTFSNKIEEFFLL-EWGV-SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + G+V +S++    F L ++     ++   + +  +G +TN+   L+Y     F  +   
Sbjct: 76  RVGVVRYSDRPTTEFDLGKYKTCEEIKEAARKIRYYGGNTNTGDALRYINTYSFSKE--- 132

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                 D   KK+ + +TDG           L   N A++ G  ++A+G+      E   
Sbjct: 133 AGGRLSDRTVKKVAILLTDGR-----SQDYVLDPANAARQAGIRIFAVGVGEALKEELDE 187

Query: 338 ACASPN--SFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
             + P     + V + +++      + + +    +  +
Sbjct: 188 IASEPKSAHVFHVSDYNAIDKIRGKLRRRLCENVLCPN 225


>gi|219520386|gb|AAI43866.1| COL21A1 protein [Homo sapiens]
          Length = 957

 Score = 86.0 bits (211), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 41/214 (19%), Positives = 82/214 (38%), Gaps = 33/214 (15%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           +S   A  D++ +LD S S+           ++  K +  + +   + P     +Q G+V
Sbjct: 29  SSCRTAPTDLVFILDGSYSVGP------ENFEIVKKWLVNITKNFDIGP---KFIQVGVV 79

Query: 225 TFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S+       L       HL   ++ +   G +T +   +++A + +F           
Sbjct: 80  QYSDYPVLEIPLGSYDSGEHLTAAVESILYLGGNTKTGKAIQFALDYLF---------AK 130

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA-- 340
                 KI V +TDG     K           A+     ++AIG+        L+A A  
Sbjct: 131 SSRFLTKIAVVLTDG-----KSQDDVKDAAQAARDSKITLFAIGVGSETEDAELKAIANK 185

Query: 341 -SPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
            S    + VE+    Y A S I ++++ +++  +
Sbjct: 186 PSSTYVFYVED----YIAISKI-REVMKQKLCEE 214


>gi|224048537|ref|XP_002190467.1| PREDICTED: similar to collagen, type XII, alpha 1 [Taeniopygia
           guttata]
          Length = 3122

 Score = 86.0 bits (211), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 57/338 (16%), Positives = 112/338 (33%), Gaps = 41/338 (12%)

Query: 46  MKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCR--IKNTWNM--------SFR 95
           MKT L S +  + + AAT + +     N        I+    ++ +W             
Sbjct: 1   MKTALCSAV--AALCAATLLSSIEAEVNPPSDLNFTIIDEHNVQMSWKRPPDAIVGYRIT 58

Query: 96  NELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYK---IPLKFCTFIPWYTNSR 152
               ++G   +      +T   I  +  +  Y +S I+ Y      L     +   T   
Sbjct: 59  VVPTNDGPTKEFTLSPSTTQTVISDLIPDVEYIVS-IASYDDREESLPVFGQLTIQTGGP 117

Query: 153 HIVMPITSSVKVNSQTDARL-DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKL 211
            I        ++   + + + D++ ++D S S+       I         ++ M+  V  
Sbjct: 118 GIPEEKKVEAQLQRCSISAMTDLVFLVDGSWSVGRNNFGYI---------LDFMVALVSA 168

Query: 212 IPDVNNVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQ 269
                   + G+V +S+     F L   +  S L   IK +   G +T +   + Y    
Sbjct: 169 FDIGEEKTRVGVVQYSSDTRTEFNLNQYFRRSDLIDAIKRIPYKGGNTMTGEAIDYLVQN 228

Query: 270 IFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV 329
            F               + K+ + +TDG     K          E +  G  V+++GI+ 
Sbjct: 229 TFTES------AGARKGFPKVAIVITDG-----KAQDDVEIPARELRNIGVEVFSLGIKA 277

Query: 330 IRSHEFLRACASP--NSFYLVENPHSMYDAFSHIGKDI 365
             + E     + P     + V N   + D  + I   +
Sbjct: 278 ADAKELKLIASQPSLKHVFNVANFDGIVDIQNEIILQV 315



 Score = 83.3 bits (204), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 51/268 (19%), Positives = 106/268 (39%), Gaps = 39/268 (14%)

Query: 111 VRSTSLDIVVVPQNEGYSISAISRYKI-PLKFCTFIPWYTNSRHIVMPITSSVKVNSQTD 169
            ++T+L++  +  +  Y I+  +   + P +  T +     ++ + + +  S  V+ +  
Sbjct: 383 PQTTALNVKDLSPDTEYQINVYAMKGLTPSEPITIME---KTQQVKVQVECSRGVDVKA- 438

Query: 170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229
              D++ ++D S S+     ++  K+   ++ +      VK        VQ  LV +S  
Sbjct: 439 ---DVVFLVDGSYSIG---IANFVKVRAFLEVL------VKSFEISPRKVQISLVQYSRD 486

Query: 230 IEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287
               F L     V  + + I      G STN+   + Y   ++F              N 
Sbjct: 487 PHMEFSLNRYNRVEDIIQAINTFPYRGGSTNTGKAMTYVREKVFVTS------KGSRPNV 540

Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NS 344
            ++++ +TDG     K          + +     ++A+G++     E L A ASP     
Sbjct: 541 PRVMILITDG-----KSSDAFKEPAIKLRDADVEIFAVGVKDAVRTE-LEAIASPPADTH 594

Query: 345 FYLVENPHSMYDAFSHIGKDIVTKRIWY 372
            Y VE+    +DAF  I  ++ T+ +  
Sbjct: 595 VYTVED----FDAFQRISFEL-TQSVCL 617



 Score = 67.1 bits (162), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 46/272 (16%), Positives = 94/272 (34%), Gaps = 34/272 (12%)

Query: 99   RDNGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKI-PLKFCTFIPWYTNSRHIVMP 157
             D+G + ++      +++ +  +     Y ++    ++             T S     P
Sbjct: 1123 EDDGSLGELIVGPYDSTVVLEELRAGTTYKVNVFGMFEGGESNPLVGQEMTTLSDTTTEP 1182

Query: 158  ITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNN 217
              S   +  +T A  D+++++D S S+                 I  ++E   + PD   
Sbjct: 1183 FLSR-GLECRTRAEADIVLLVDGSWSIG------RPNFKTIRNFIARIVEVFDIGPD--- 1232

Query: 218  VVQSGLVTFSNKIEEFFLLEWGVSHLQ------RKIKYLSKFGVSTNSTPGLKYAYNQIF 271
             VQ GL  +S         EW ++  +        +  L   G +T +   L       F
Sbjct: 1233 RVQIGLAQYSGDPRT----EWNLNAYRTKQSLLEAVANLPYKGGNTLTGMALD------F 1282

Query: 272  DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR 331
             ++   +         +KI V +TDG     K     +    + +  G  +YAIGI+   
Sbjct: 1283 ILRNNFKPVAGLRPRARKIGVLITDG-----KSQDDVVAPSRKLRDEGVELYAIGIKNAD 1337

Query: 332  SHEFLRACASPN--SFYLVENPHSMYDAFSHI 361
             +E  +    P+    Y V +   +     ++
Sbjct: 1338 ENELKQIATDPDDIHAYNVADFSFLATIVDNV 1369


>gi|147899676|ref|NP_001087858.1| collagen alpha-1(XXI) chain precursor [Xenopus laevis]
 gi|82234134|sp|Q641F3|COLA1_XENLA RecName: Full=Collagen alpha-1(XXI) chain; Flags: Precursor
 gi|51950065|gb|AAH82384.1| MGC81791 protein [Xenopus laevis]
          Length = 957

 Score = 86.0 bits (211), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 44/214 (20%), Positives = 84/214 (39%), Gaps = 33/214 (15%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           +S   A  D++ +LD S S+           ++  K +  +     + P      Q G+V
Sbjct: 29  SSCRTAPNDLVFILDGSWSVGP------ENFEILKKWVVNITSNFNIGP---KFTQVGVV 79

Query: 225 TFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S+       L     +  L R+ + +   G +T +   +++A + +F           
Sbjct: 80  QYSDYPILEIPLGSYESIDDLSRRTQSIQYLGGNTQTGNAIQFAIDNLFARSL------- 132

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA-- 340
                 KI + +TDG     K      +   EA+K    ++AIG+        LRA A  
Sbjct: 133 --RPLTKIAIVLTDG-----KSQDDVKHIAEEARKNKITLFAIGVGSEIEESELRAIANK 185

Query: 341 -SPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
            S    + VE+    Y A S I ++I+ +++  +
Sbjct: 186 PSSTYVFYVED----YIAISRI-REIMKQKLCEE 214


>gi|291396486|ref|XP_002714579.1| PREDICTED: collagen, type XII, alpha 1 [Oryctolagus cuniculus]
          Length = 3117

 Score = 86.0 bits (211), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 53/267 (19%), Positives = 102/267 (38%), Gaps = 37/267 (13%)

Query: 111 VRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDA 170
            ++T+L I  +  +  Y IS  +   +       I   T    + +  +  V + +    
Sbjct: 384 PQTTTLSIRDLSADTEYQISVSAMKGLTSSEPISIMEKTQPMKVQVECSRGVDIKA---- 439

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
             D++ ++D S S+     ++  K+   ++ +       K      N VQ  LV +S   
Sbjct: 440 --DIVFLVDGSYSIG---IANFVKVRAFLEVL------AKSFEISPNRVQISLVQYSRDP 488

Query: 231 EEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
              F L+       +   I      G STN+   + Y   +IF             +N  
Sbjct: 489 HTEFTLKKFTKVEDIIEAINTFPYRGGSTNTGKAMTYVREKIF------VPSKGSRSNVP 542

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NSF 345
           K+++ +TDG++     D        + +     ++A+G++     E L A ASP      
Sbjct: 543 KVMILITDGKSSDAFRD-----PAIKLRNSDVEIFAVGVKDAVRSE-LEAIASPPAETHV 596

Query: 346 YLVENPHSMYDAFSHIGKDIVTKRIWY 372
           + VE+    +DAF  I  ++ T+ I  
Sbjct: 597 FTVED----FDAFQRISFEL-TQSICL 618



 Score = 82.1 bits (201), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 40/203 (19%), Positives = 78/203 (38%), Gaps = 30/203 (14%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D++ ++D S S+      +   I   I ++      V          + G+V +S+    
Sbjct: 140 DLVFLVDGSWSVGRN---NFKYILDFIAAL------VSAFDIGEEKTRVGVVQYSSDTRT 190

Query: 233 FFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKY-AYNQIFDMQGMRQHCNTEDANYKK 289
            F L   +    L   IK +   G +T +   + Y   N   +  G R         + K
Sbjct: 191 EFNLNQYYQRDELLAAIKRIPYKGGNTMTGDAIDYLVKNTFLESAGARVG-------FPK 243

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP--NSFYL 347
           + + +TDG     K   +      E +  G  V+++GI+   + E  +  ++P  N  + 
Sbjct: 244 VAIIITDG-----KSQDEVEIPARELRNIGVEVFSLGIKAADAKELKQIASTPSLNHVFN 298

Query: 348 VENPHSMYDAFSHIGKDIVTKRI 370
           V N    +DA   I  +I+++  
Sbjct: 299 VAN----FDAIVDIQNEIISQVC 317



 Score = 62.5 bits (150), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 51/250 (20%), Positives = 82/250 (32%), Gaps = 26/250 (10%)

Query: 124  NEGYSISAISRYKI-PLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSR 182
               Y ++    +              T S   VMPI SS  +   T A  D+++++D S 
Sbjct: 1150 GTTYKVNVFGMFDGGESSPLVGQEMTTLSDTTVMPILSS-GMECLTRAEADIVLLVDGSW 1208

Query: 183  SMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLE--WGV 240
            S+                 I+ ++E   + P     VQ  L  +S      + L      
Sbjct: 1209 SIG------RANFRTVRSFISRIVEVFDIGP---KRVQIALAQYSGDPRTEWQLNAHRDK 1259

Query: 241  SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENL 300
              L + +  L   G +T +   L +   Q F  Q             +KI V +TDG   
Sbjct: 1260 KSLLQAVANLPYKGGNTLTGMALNFIRQQNFKTQ------AGMRPRARKIGVLITDG--- 1310

Query: 301  STKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSH 360
              K          + K  G  ++AIGI+     E       P+      N    +D+ S 
Sbjct: 1311 --KSQDDVEAPSKKLKDEGVELFAIGIKNADEVELKMIATDPDDT-HAYNVAD-FDSLSK 1366

Query: 361  IGKDIVTKRI 370
            I  D+     
Sbjct: 1367 IVDDLTINLC 1376


>gi|311260227|ref|XP_003128387.1| PREDICTED: collagen alpha-1(XXI) chain-like [Sus scrofa]
          Length = 957

 Score = 86.0 bits (211), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 41/214 (19%), Positives = 82/214 (38%), Gaps = 33/214 (15%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           +S   A  D++ +LD S S+           ++  K +  + +   + P     +Q G+V
Sbjct: 29  SSCRTAPTDLVFILDGSYSVGP------ENFEIVKKWLVNITKNFDIGP---KFIQVGVV 79

Query: 225 TFSNKIEEFFLLEWGVSHLQ--RKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S+       L    S  +    +  +   G +T +   +++A + +F           
Sbjct: 80  QYSDYPVLEIPLGRHESGEKLLAAVGSIHYLGGNTRTGKAIQFALDYLF---------AK 130

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA-- 340
                 KI V +TDG     K   +       A+     ++AIG+        LRA A  
Sbjct: 131 SSRFLTKIAVVLTDG-----KSQDEVKDAAEAARDSKITLFAIGVGSETEDAELRAIANK 185

Query: 341 -SPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
            S    + VE+    Y A S I ++++ +++  +
Sbjct: 186 PSSTYVFHVED----YIAISKI-REVMKQKLCEE 214


>gi|293339632|gb|ADE44108.1| collagen type XXI alpha 1 [Sus scrofa]
          Length = 895

 Score = 86.0 bits (211), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 41/214 (19%), Positives = 82/214 (38%), Gaps = 33/214 (15%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           +S   A  D++ +LD S S+           ++  K +  + +   + P     +Q G+V
Sbjct: 29  SSCRTAPTDLVFILDGSYSVGP------ENFEIVKKWLVNITKNFDIGP---KFIQVGVV 79

Query: 225 TFSNKIEEFFLLEWGVSHLQ--RKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S+       L    S  +    +  +   G +T +   +++A + +F           
Sbjct: 80  QYSDYPVLEIPLGRHESGEKLLAAVGSIHYLGGNTRTGKAIQFALDYLF---------AK 130

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA-- 340
                 KI V +TDG     K   +       A+     ++AIG+        LRA A  
Sbjct: 131 SSRFLTKIAVVLTDG-----KSQDEVKDAAEAARDSKITLFAIGVGSETEDAELRAIANK 185

Query: 341 -SPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
            S    + VE+    Y A S I ++++ +++  +
Sbjct: 186 PSSTYVFHVED----YIAISKI-REVMKQKLCEE 214


>gi|156396520|ref|XP_001637441.1| predicted protein [Nematostella vectensis]
 gi|156224553|gb|EDO45378.1| predicted protein [Nematostella vectensis]
          Length = 177

 Score = 86.0 bits (211), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 36/191 (18%), Positives = 67/191 (35%), Gaps = 24/191 (12%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D+  VLD S S+ +       +  M +  IN ++    + P      + G+V +S +   
Sbjct: 1   DIGFVLDASGSVRAN------RFKMCLNFINKLVNSFHIGPHN---TRIGIVRYSTRPSG 51

Query: 233 FFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKI 290
            F           + ++  +   G  T +   + YA   ++     R          +K+
Sbjct: 52  IFRFTSYRNKHSTKHRVNRIRYTGGWTRTGAAINYARRYLYQHNRRRG--------VRKV 103

Query: 291 IVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVEN 350
           ++ MTDG     K     +      K+ G  V+AIGI        L   A+  +  L   
Sbjct: 104 LIVMTDG-----KSQDSVVGASRSVKRMGIEVFAIGIGRGYRRSELNQMATDRNHVLTAR 158

Query: 351 PHSMYDAFSHI 361
              ++     I
Sbjct: 159 FRDLHKIIGKI 169


>gi|32471725|ref|NP_864718.1| hypothetical protein RB2055 [Rhodopirellula baltica SH 1]
 gi|32397096|emb|CAD72400.1| conserved hypothetical protein [Rhodopirellula baltica SH 1]
          Length = 402

 Score = 86.0 bits (211), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 57/399 (14%), Positives = 127/399 (31%), Gaps = 72/399 (18%)

Query: 8   IRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMN 67
           ++N      G + +L  I LP++ ++   +I V+++  +      + D ++  A    + 
Sbjct: 29  LKNQPKQRSGAVIVLLVIMLPVLLILAAYVINVAYVEAVTADSQVVTDAAVCAAGRVYIQ 88

Query: 68  EGNGNNRKKLKGGDILCR-----------IKNTWNMSFRNELRDNG---FVNDIDDIVRS 113
            G+ N                            + +S R  L +      ++D D+   +
Sbjct: 89  TGDKNAALAAARDAAERNPVAGKVVPINMSDLEFGISLRESLDEGYSFQPLSDDDEFGNA 148

Query: 114 TSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLD 173
             L  + +  +     S       PL            + + +   S++          D
Sbjct: 149 VRLTTLSLSNSPQPVFS-------PLFPTMGTNLEIRPQRVAVSTQSTM----------D 191

Query: 174 MMIVLDVSRSM----ESFFDSSITKIDM------------------AIKSINAMLEEVKL 211
           + +V+D S SM    +   D  +                        + S+NA    +  
Sbjct: 192 VALVIDRSGSMAYANDEAPDPYVNPAAAPPGWTYGDPVPPNSRWLDLVASVNAFNGFLAD 251

Query: 212 IPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSK--FGVSTNSTPGLKYAYNQ 269
            P      +  L T+S+       L    + +  ++  +S    G  T+   GL++    
Sbjct: 252 SP---QYEKLCLATYSDNASRDCDLTHTYAEISNQLDAISYQFNGGGTSVGYGLEHGLAV 308

Query: 270 IFDMQGMRQHCNTEDANYKKIIVFMTDG-ENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR 328
           + D    R+          +++V MTDG  N     +  + +     +  G  ++ I   
Sbjct: 309 LTDATHARKFAV-------RVMVLMTDGHHNTGKSPESMTYHL----QNHGVTLFTITFS 357

Query: 329 VIRSHEFLRACAS--PNSFYLVENPHSMYDAFSHIGKDI 365
                  +   A+      +   +   + +AF  I K +
Sbjct: 358 DDADQSRMSNLANACGGENFHATDASQLQNAFQKIAKKL 396


>gi|288956977|ref|YP_003447318.1| hypothetical protein AZL_001360 [Azospirillum sp. B510]
 gi|288909285|dbj|BAI70774.1| hypothetical protein AZL_001360 [Azospirillum sp. B510]
          Length = 456

 Score = 86.0 bits (211), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 66/449 (14%), Positives = 138/449 (30%), Gaps = 108/449 (24%)

Query: 13  YNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGN 72
            + +G + I+ A+   ++  +LG+ I+ +   F+ + ++   D + +      ++  N  
Sbjct: 23  ADRRGSVAIMVALSFLVLLGMLGVAIDFARAQFVSSRIYYAADAATLA-----VSRENF- 76

Query: 73  NRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSISAI 132
                          +      ++    N     +      +       P  +G++++  
Sbjct: 77  ----------QVSTNDQLKALAQSYFDANFPPGTMGATTSLSVATSGTPPTVQGFTVTVT 126

Query: 133 SRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQT--DARLDMMIVLDVS----RSMES 186
           +   +                + +   S     +QT     ++++IVLD S     S E 
Sbjct: 127 ATLPLVFAPLVETLGGPTIGSVGISKASGAVFTTQTSNQGGMELVIVLDNSASMKGSQED 186

Query: 187 FFDSSITKIDMA-----------------IKSINAMLEEVKLIPDVNNVVQSGL------ 223
                   +DM                    ++N +   +K   D+   V  G+      
Sbjct: 187 LRGGVKALLDMLYGNADTRKNLYVGIVHYSGAVNVLQSALKNKADIVAPVVGGMANCPMA 246

Query: 224 -----------------------------VTF--SNKIEEFFLLEWGVSHLQRKIKYLSK 252
                                        + +  ++ +     L        + IK    
Sbjct: 247 TVNGKLNGSRLSNAPPKTFKFDSTTDGVEIQYCGASTLGTSSALSPNRGDADKAIKSYVA 306

Query: 253 FGVSTNSTPGLKYAYNQIF----------DMQGMRQHCNTEDANYKKIIVFMTDGEN--- 299
            G  T    GL + +  +           D  G     + +    KK++V MTDG N   
Sbjct: 307 -GGDTLIGEGLVWGWRMLTPSWRGLWNTKDQPGASLPLDYDLPYMKKVLVLMTDGVNHIA 365

Query: 300 ----------------LSTKEDQQSLYYCNEAKKR-GAIVYAIGIRVIRSHEFLRACAS- 341
                            ++K D   +  CN AKK    ++Y I        + +  CAS 
Sbjct: 366 GRNYTAYYSDPYQTVADASKADADLMTICNAAKKDHNVVLYTITYGSDTDEQQMSDCASD 425

Query: 342 PNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           P+  Y    P  +  AF+ +G D+ T ++
Sbjct: 426 PSKHYHAALPQDLAKAFTQVGTDLTTMKL 454


>gi|194216197|ref|XP_001914777.1| PREDICTED: collagen, type XII, alpha 1 [Equus caballus]
          Length = 3120

 Score = 86.0 bits (211), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 53/267 (19%), Positives = 102/267 (38%), Gaps = 37/267 (13%)

Query: 111 VRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDA 170
            ++T L +  +  +  Y IS  +   +       I   T    + +  +  V + +    
Sbjct: 384 PQTTMLSVRDLSADTEYQISVSAMKGLTSSEPVSIMEKTQPMKVQVECSRGVDIKA---- 439

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
             D++ ++D S S+     ++  K+   ++ +      VK      N VQ  LV +S   
Sbjct: 440 --DIVFLVDGSYSIG---IANFVKVRAFLEVL------VKSFEISPNRVQISLVQYSRDP 488

Query: 231 EEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
              F L+       +   I      G STN+   + Y   +IF             +N  
Sbjct: 489 HTEFTLKKFTKVEDIIEAINTFPYRGGSTNTGKAMTYVREKIF------VPSKGSRSNVP 542

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NSF 345
           K+++ +TDG++     D        + +     ++A+G++     E L A ASP      
Sbjct: 543 KVMILITDGKSSDAFRD-----PAIKLRNSDVEIFAVGVKDAVRSE-LEAIASPPAETHV 596

Query: 346 YLVENPHSMYDAFSHIGKDIVTKRIWY 372
           + VE+    +DAF  I  ++ T+ I  
Sbjct: 597 FTVED----FDAFQRISFEL-TQSICL 618



 Score = 81.0 bits (198), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 40/203 (19%), Positives = 78/203 (38%), Gaps = 30/203 (14%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D++ ++D S S+      +   I   I ++      V          + G+V +S+    
Sbjct: 140 DLVFLVDGSWSVGRN---NFKYILDFIAAL------VSAFDIGEEKTRVGVVQYSSDPRT 190

Query: 233 FFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKY-AYNQIFDMQGMRQHCNTEDANYKK 289
            F L   +    L   IK +   G +T +   + Y   N   +  G R         + K
Sbjct: 191 EFNLNQYYQRDELLAAIKKIPYKGGNTMTGDAIDYLIKNTFMESAGARVG-------FPK 243

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP--NSFYL 347
           + + +TDG     K   +      E +  G  V+++GI+   + E  +  ++P  N  + 
Sbjct: 244 VAIIITDG-----KSQDEVEIPARELRSIGVEVFSLGIKAADAKELKQIASTPSLNHVFN 298

Query: 348 VENPHSMYDAFSHIGKDIVTKRI 370
           V N    +DA   I  +I+++  
Sbjct: 299 VAN----FDAIVDIQNEIISQVC 317



 Score = 60.9 bits (146), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 49/250 (19%), Positives = 82/250 (32%), Gaps = 26/250 (10%)

Query: 124  NEGYSISAISRYKI-PLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSR 182
               Y ++    +              T S   VMPI SS  +   T A  D+++++D S 
Sbjct: 1150 GTTYKVNVFGMFDGGESSPLVGQEMTTLSDTTVMPILSS-GMECLTRAEADIVLLVDGSW 1208

Query: 183  SMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEW--GV 240
            S+                 I+ ++E  ++ P     VQ  L  +S      + L      
Sbjct: 1209 SIG------RANFRTVRSFISRIVEVFEIGP---KRVQIALAQYSGDPRTEWQLNAHKDK 1259

Query: 241  SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENL 300
              L   +  L   G +T +   L +   Q F  Q             +KI V +TDG   
Sbjct: 1260 QSLLEAVANLPYKGGNTLTGMALNFIRQQSFKTQ------AGMRPRARKIGVLITDG--- 1310

Query: 301  STKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSH 360
              K          + K  G  ++A+GI+     E       P+      N    +++ S 
Sbjct: 1311 --KSQDDVEAPSKKLKDEGVELFAVGIKNADEVELKMIATDPDDT-HAYNVAD-FESLSR 1366

Query: 361  IGKDIVTKRI 370
            I  D+     
Sbjct: 1367 IVDDLTINLC 1376


>gi|56797853|emb|CAG26904.1| matrilin-1 [Danio rerio]
          Length = 277

 Score = 86.0 bits (211), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 31/216 (14%), Positives = 82/216 (37%), Gaps = 27/216 (12%)

Query: 153 HIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLI 212
            + +   +++          D++ ++D SRS+        ++ +     +  +++ + + 
Sbjct: 18  TVDLRQAAAMAAGLCNTKPTDVVFIVDSSRSVRP------SEFEQVKVFLAKVIDGLSVG 71

Query: 213 PDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQ--RKIKYLSKFGVSTNSTPGLKYAYNQI 270
           PD     + G+V ++++++    L+   +     + +  +      T +   +++A N  
Sbjct: 72  PDA---TRVGVVNYASRVKNEVSLKSHKTKAALVKAVSKIEPLSTGTMTGLAIQFAMNVA 128

Query: 271 FDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI 330
           F      +    +  +  K+ + +TDG       D         A++ G  ++AIG+  +
Sbjct: 129 FSEAEGGR----KSPDISKVAIIVTDGRPQDNIRD-----IAARAREAGIEIFAIGVGRV 179

Query: 331 RSHEFLRACAS---PNSFYLVEN---PHSMYDAFSH 360
                LR  AS    +    VE+      +   F  
Sbjct: 180 D-MTTLRQMASEPLEDHVDYVESYSLIEKLTKKFQE 214


>gi|296228120|ref|XP_002759672.1| PREDICTED: collagen alpha-5(VI) chain [Callithrix jacchus]
          Length = 2614

 Score = 86.0 bits (211), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 57/336 (16%), Positives = 126/336 (37%), Gaps = 29/336 (8%)

Query: 41  SHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRD 100
            + +F +  +   IDR  +     +M +      +              + +   + +  
Sbjct: 682 LNTYFTQQEISDAIDRMSLIDKGTLMGKALNFVDQYFTHSKGARFGAKKFLILITDGVAQ 741

Query: 101 NGFVNDIDDIVRSTSLDIVVVP-----QNEGYSISAISRYKIPLKFCTFIPWYTNSRHIV 155
           +  V D   I+R   + I  V      +++   IS        ++    +      + +V
Sbjct: 742 DD-VRDPARILRGKDVTIFSVGVYGADRSQLEEISGDGSLVFYVENFDHL--QALEKKLV 798

Query: 156 MPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDV 215
             + +          +LD++ VLD S S+       +         IN  +  VK     
Sbjct: 799 FRVCALHDCKRIK--QLDVVFVLDHSGSIAEQSQDHM---------INLTMHLVKKADVG 847

Query: 216 NNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM 273
            + VQ G + +S+  E  F L      S +   ++     G +T +   LK+A N +F  
Sbjct: 848 RDRVQFGALKYSDNPEILFYLNTYSNRSAIIENLRMRRDTGGNTYTAKALKHA-NALFT- 905

Query: 274 QGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSH 333
               +H +  + N K++++ +TDGE+    E   +     + + +G  ++A+G+      
Sbjct: 906 ---EEHGSRINQNVKQMLIVITDGESDDRVELNDTAA---KLRDKGITIFAVGVGKADQK 959

Query: 334 EFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKR 369
           E      + N+   V+N   + D ++ + + + T+ 
Sbjct: 960 ELEGMAGNKNNTIYVDNFDKLKDIYAPVQESMCTES 995



 Score = 80.6 bits (197), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 51/349 (14%), Positives = 117/349 (33%), Gaps = 40/349 (11%)

Query: 37  IIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRN 96
           +++ S    ++  +    +   +  A   + +  G+         IL RIKN        
Sbjct: 483 VVQFSDKMRVEFSITDYSNDIDLRKAILNIQQLTGDTHTGEALDFILPRIKNGIKERMSQ 542

Query: 97  ---------ELRDNGFVNDIDDIVRSTSLDI--VVVPQNEGYSISAISRYKIPLKFCTFI 145
                    + +    V +    VR+  + +  + + +     +  I+  +  + F    
Sbjct: 543 VPCYLIVLTDGKSQYSVVEPAKRVRAEQITVHAIGIGEANKKELQEIAGKEERVSFGQNF 602

Query: 146 PWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAM 205
               + ++ V  +          D + D+M ++D S S+    + +  K+ + +K++   
Sbjct: 603 DALKSIKNEV--VHGICTEKGCEDMKADIMFLVDSSGSIG---NENFGKMKIFMKNL--- 654

Query: 206 LEEVKLIPDVNNVVQSGLVTFSNKIEEFFLL-EWGVS-HLQRKIKYLSKFGVSTNSTPGL 263
              +  I    +  Q G+V FS+  EE F L  +     +   I  +S     T     L
Sbjct: 655 ---LTKIQIGADKTQIGVVQFSDDPEEEFQLNTYFTQQEISDAIDRMSLIDKGTLMGKAL 711

Query: 264 KYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVY 323
            +        +G R          KK ++ +TDG                  + +   ++
Sbjct: 712 NFVDQYFTHSKGARFGA-------KKFLILITDG-----VAQDDVRDPARILRGKDVTIF 759

Query: 324 AIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIWY 372
           ++G+      +        +  + VEN    +D    + K +V +    
Sbjct: 760 SVGVYGADRSQLEEISGDGSLVFYVEN----FDHLQALEKKLVFRVCAL 804



 Score = 71.0 bits (172), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 34/202 (16%), Positives = 70/202 (34%), Gaps = 26/202 (12%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D+  ++D S S+       I K          MLE  ++     + V+ G+V FS+K+  
Sbjct: 442 DIHFLIDGSTSIREEQFEQIKKF---------MLEVTEMFSIGPDKVRVGVVQFSDKMRV 492

Query: 233 FFLLEWGVSHL--QRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKI 290
            F +    + +  ++ I  + +    T++   L       F +  ++       +     
Sbjct: 493 EFSITDYSNDIDLRKAILNIQQLTGDTHTGEALD------FILPRIKNGIKERMSQVPCY 546

Query: 291 IVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVEN 350
           ++ +TDG++         +      +     V+AIGI      E              +N
Sbjct: 547 LIVLTDGKSQY-----SVVEPAKRVRAEQITVHAIGIGEANKKELQEIAGKEERVSFGQN 601

Query: 351 PHSMYDAFSHIGKDIVTKRIWY 372
               +DA   I  ++V      
Sbjct: 602 ----FDALKSIKNEVVHGICTE 619



 Score = 52.5 bits (124), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 27/185 (14%), Positives = 64/185 (34%), Gaps = 22/185 (11%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D++ ++D S  +                 IN M+  +   P   +  +  L  +S+K+  
Sbjct: 30  DVVFLVDSSDHLG------TKSFPFVKTFINKMINSL---PIEADKYRVALAQYSDKLHS 80

Query: 233 FFLLEW--GVSHLQRKIKY-LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
            F L    G + +   +K      G S      L+ A+   F      +    +   +  
Sbjct: 81  EFHLSTFKGRNPMLNHLKKNFQFLGGSLQIGKALQEAHRTYFSAPTNGR----DRKQFPP 136

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVE 349
           I+V +      S + +          ++ G  + ++G++       L+A A+ +  + + 
Sbjct: 137 ILVVL-----ASAESEDDVEEASKALQEDGVKIISVGVQEASEEN-LKAMATSHFHFNLR 190

Query: 350 NPHSM 354
               +
Sbjct: 191 TVRDL 195



 Score = 42.8 bits (99), Expect = 0.078,   Method: Composition-based stats.
 Identities = 29/175 (16%), Positives = 64/175 (36%), Gaps = 23/175 (13%)

Query: 164 VNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEV-KLIPDVNNVVQSG 222
           ++ Q D+  D++ ++D S                  + + A LE +   +    N ++ G
Sbjct: 227 ISCQKDSLADLLFLVDESLGTRQNL-----------RHLQAFLENITSSMDVKENCMRLG 275

Query: 223 LVTFSNKIEEFFLLEWGV--SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHC 280
           L+++SN  +    L+     S  Q++I+ LS     +N+   +     Q+        H 
Sbjct: 276 LMSYSNSAKTISFLKSSTSQSEFQQQIQKLSIQVGKSNAGAAI----EQMRREGFSESHG 331

Query: 281 NTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF 335
           +       +I V +T         D +        +     V+A+ I+   + + 
Sbjct: 332 SRRAQGVPQIAVLVT-----HRPSDDEVHDAALNLRLEDVTVFALSIQGANNTQL 381


>gi|293361231|ref|XP_243912.5| PREDICTED: collagen alpha-1(XII) chain [Rattus norvegicus]
          Length = 3119

 Score = 85.6 bits (210), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 52/309 (16%), Positives = 102/309 (33%), Gaps = 45/309 (14%)

Query: 67  NEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEG 126
            +     R  +         + T   S    L  N  + +   +V  TS D V   ++  
Sbjct: 49  ADPIVGYRITVDSTTDGPTKEFTLAASTTETLLSN-LIPETQYVVTITSYDEVE--ESVP 105

Query: 127 YSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMES 186
                      P K     P  T  +   +   +            D++ ++D S S+  
Sbjct: 106 VIGQLTIETGDPAKPGEKKPGKTEIQKCSVSAWT------------DLVFLVDGSWSVGR 153

Query: 187 FFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLE--WGVSHLQ 244
                          ++ ++  V          + G+V +S+     F L   +    L 
Sbjct: 154 NN---------FKYILDFIVALVSAFDIGEEKTRVGVVQYSSDTRTEFNLNQYYRREDLL 204

Query: 245 RKIKYLSKFGVSTNSTPGLKY-AYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTK 303
             IK +   G +T +   + Y   N   +  G R         + K+ + +TDG     K
Sbjct: 205 AAIKKIPYKGGNTMTGDAIDYLVKNTFTESAGSRAG-------FPKVAIIITDG-----K 252

Query: 304 EDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP--NSFYLVENPHSMYDAFSHI 361
              +      E +  G  V+++GI+   + E  +  ++P  N  + V N    +DA   I
Sbjct: 253 SQDEVEIPARELRNIGVEVFSLGIKAADAKELKQIASTPSLNHVFNVAN----FDAIVDI 308

Query: 362 GKDIVTKRI 370
             +I+++  
Sbjct: 309 QNEIISQVC 317



 Score = 85.6 bits (210), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 52/267 (19%), Positives = 105/267 (39%), Gaps = 37/267 (13%)

Query: 111 VRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDA 170
            ++T+L++  +  +  Y IS  +   +       +   T    + +  +  V + +    
Sbjct: 384 PQTTTLNVRDLSADTEYQISVFAMKGLTSSEPVSVMEKTQPMKVQVECSRGVDIKA---- 439

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
             D++ ++D S S+     ++  K+   ++ +       K      N VQ  LV +S   
Sbjct: 440 --DIVFLVDGSYSIG---IANFVKVRAFLEVL------AKSFEISPNRVQISLVQYSRDP 488

Query: 231 EEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
              F L+    V  + + I      G STN+   + Y   +IF             +N  
Sbjct: 489 HTEFTLKEFNRVEDIIKAINNFPYRGGSTNTGKAMTYVREKIFVPN------KGSRSNVP 542

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NSF 345
           K+++ +TDG++     D        + +     ++A+G++     E L A ASP      
Sbjct: 543 KVMILITDGKSSDAFRD-----PAIKLRNSDVEIFAVGVKDAVRSE-LEAIASPPAETHV 596

Query: 346 YLVENPHSMYDAFSHIGKDIVTKRIWY 372
           + VE+    +DAF  I  ++ T+ I  
Sbjct: 597 FTVED----FDAFQRISFEL-TQSICL 618



 Score = 61.3 bits (147), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 43/251 (17%), Positives = 84/251 (33%), Gaps = 28/251 (11%)

Query: 124  NEGYSISAISRYK--IPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVS 181
               Y ++    +     L          +   +   ++S ++  ++ +A  D+++++D S
Sbjct: 1150 GTTYRVNVFGMFDGGESLPLVGQEMTTLSDTTVTPFLSSGMECLTRAEA--DIVLLVDGS 1207

Query: 182  RSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLE--WG 239
             S+                 I+ ++E  ++ P     VQ  L  +S      + L     
Sbjct: 1208 WSIG------RANFRTVRSFISRIVEVFEIGP---KRVQIALAQYSGDPRTEWHLNAHRD 1258

Query: 240  VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGEN 299
               L + +  L   G +T +   L +   Q F  Q             +KI V +TDG  
Sbjct: 1259 KKSLLQAVANLPYKGGNTLTGMALNFIRQQSFKTQ------AGMRPRARKIGVLITDG-- 1310

Query: 300  LSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFS 359
               K          + K  G  ++AIGI+     E       P+      N    +++ S
Sbjct: 1311 ---KSQDDVEAPSKKLKDEGVELFAIGIKNADEVELKMIATDPDDI-HAYNVAD-FESLS 1365

Query: 360  HIGKDIVTKRI 370
             I  D+     
Sbjct: 1366 KIVDDLTINLC 1376


>gi|260823583|ref|XP_002606160.1| hypothetical protein BRAFLDRAFT_126487 [Branchiostoma floridae]
 gi|229291499|gb|EEN62170.1| hypothetical protein BRAFLDRAFT_126487 [Branchiostoma floridae]
          Length = 515

 Score = 85.6 bits (210), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 36/210 (17%), Positives = 77/210 (36%), Gaps = 25/210 (11%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           +      +DM+ VLD S S+           +     + ++++  ++        + G+V
Sbjct: 169 SECKIPGMDMVFVLDGSGSVG------ADNFETVKDFVVSVVDGFEIGQS---RTRIGVV 219

Query: 225 TFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S++++  F L      + +Q  I  ++     T +   L+Y  +  F  +        
Sbjct: 220 QYSDEVQNEFNLTEYGNKADVQSAISNITYLQGRTYTGAALRYMTDVSFSEE---AGARP 276

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                 K+ + +TDGE              + A + G  V+AIGI      E  +    P
Sbjct: 277 PYQAIPKVGIVVTDGE-----ATDNVQGPASSAHEAGVNVFAIGIGGYDVRELRQIATDP 331

Query: 343 N--SFYLVENPHSMYDAFSHIGKDIVTKRI 370
           +    + V+N    + A  +I   +  +  
Sbjct: 332 DATHVFAVDN----FAATDYIKDALEGRTC 357


>gi|330417948|ref|NP_001193426.1| collagen alpha-1(XII) chain [Bos taurus]
          Length = 3065

 Score = 85.6 bits (210), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 53/267 (19%), Positives = 103/267 (38%), Gaps = 37/267 (13%)

Query: 111 VRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDA 170
            ++T+L +  +  +  Y IS  +   +       I   T    + +  +  V + +    
Sbjct: 384 PQTTTLSVRDLSADTEYQISVSAMKGLTSSEPVSIMEKTQPMKVQVECSRGVDIKA---- 439

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
             D++ ++D S S+     ++  K+   ++ +      VK      N VQ  LV +S   
Sbjct: 440 --DIVFLVDGSYSIG---IANFVKVRAFLEVL------VKSFEISPNRVQISLVQYSRDP 488

Query: 231 EEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
              F L+       +   I      G STN+   + Y   +IF             +N  
Sbjct: 489 HTEFTLKKFTKVEDIIEAINTFPYRGGSTNTGKAMTYVREKIF------VPSKGSRSNVP 542

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NSF 345
           K+++ +TDG++     D        + +     ++A+G++     E L A ASP      
Sbjct: 543 KVMILITDGKSSDAFRD-----PAIKLRNSDVEIFAVGVKDAVRSE-LEAIASPPAETHV 596

Query: 346 YLVENPHSMYDAFSHIGKDIVTKRIWY 372
           + VE+    +DAF  I  ++ T+ I  
Sbjct: 597 FTVED----FDAFQRISFEL-TQSICL 618



 Score = 81.4 bits (199), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 45/279 (16%), Positives = 98/279 (35%), Gaps = 34/279 (12%)

Query: 101 NGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIP--LKFCTFIPWYTNSRHIVMPI 158
           +G   +      +T   +  +     Y ++  S  ++   +     +   T         
Sbjct: 64  DGPTKEFTLSASTTETLLTELIPEIEYVVTITSYDEVEESVPVIGQLTIQTGGPTKPGEK 123

Query: 159 -TSSVKVNSQTDAR-LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVN 216
                ++   + +   D++ ++D S S+      +   I   I ++      V       
Sbjct: 124 KPGKTEIQKCSVSAWTDLVFLVDGSWSVGRN---NFKYILDFIAAL------VSAFDIGE 174

Query: 217 NVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKY-AYNQIFDM 273
              + G+V +S+     F L   +    L   IK +   G +T +   + Y   N   + 
Sbjct: 175 EKTRVGVVQYSSDTRTEFNLNQYYQQEELLAAIKKIPYKGGNTMTGEAIDYLIKNTFTES 234

Query: 274 QGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSH 333
            G R         + K+ + +TDG     K   +      E +  G  V+++GI+   + 
Sbjct: 235 AGARVG-------FPKVAIIITDG-----KSQDEVEIPARELRNIGVEVFSLGIKAADAK 282

Query: 334 EFLRACASP--NSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           E  +  ++P  N  + V N    +DA   I  +I+++  
Sbjct: 283 ELKQIASTPSLNHVFNVAN----FDAIVDIQNEIISQVC 317



 Score = 63.6 bits (153), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 50/250 (20%), Positives = 82/250 (32%), Gaps = 26/250 (10%)

Query: 124  NEGYSISAISRYKI-PLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSR 182
               Y ++    +              T S   VMPI SS  +   T A  D+++++D S 
Sbjct: 1150 GTTYKVNVFGMFDGGESSPLVGQEMTTLSDTTVMPILSS-GMECLTRAEADIVLLVDGSW 1208

Query: 183  SMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSH 242
            S+                 I+ ++E  ++ P     VQ  L  +S      + L      
Sbjct: 1209 SIG------RANFRTVRSFISRIVEVFEIGP---KRVQIALAQYSGDPRTEWQLNAHKDK 1259

Query: 243  LQ--RKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENL 300
                + +  L   G +T +   L +   Q F  Q             +KI V +TDG   
Sbjct: 1260 KSLLQAVANLPYKGGNTLTGMALNFIRQQSFKTQ------AGMRPRARKIGVLITDG--- 1310

Query: 301  STKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSH 360
              K          + K  G  ++AIGI+     E       P+      N    +D+ S 
Sbjct: 1311 --KSQDDVEAPSKKLKDEGVELFAIGIKNADEVELKMIATDPDDI-HAYNVAD-FDSLSR 1366

Query: 361  IGKDIVTKRI 370
            I  D+     
Sbjct: 1367 IVDDLTNNLC 1376


>gi|301613500|ref|XP_002936246.1| PREDICTED: collagen alpha-1(XII) chain-like [Xenopus (Silurana)
           tropicalis]
          Length = 3127

 Score = 85.6 bits (210), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 48/277 (17%), Positives = 108/277 (38%), Gaps = 31/277 (11%)

Query: 98  LRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMP 157
           +      + ++   ++TS+++  +  +  Y I+  +   +           T +  I + 
Sbjct: 371 MLAGSKQHSLNLGPQTTSINVKDLSPDTEYQINLYAMKGLTASEPISTLEKTQAVKIKVE 430

Query: 158 ITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNN 217
            +  V + +      D+++++D S S+     ++  K+   ++ +      VK      +
Sbjct: 431 CSGGVDIKA------DVVLLVDGSYSIG---VANFAKVRAFLEVL------VKSFDISPS 475

Query: 218 VVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQG 275
            VQ  LV +S      F L     +  + + +      G STN+   + Y   ++F    
Sbjct: 476 KVQISLVQYSRDPFTEFTLNRYDSIEDILKAVNTFPYRGGSTNTGKAMTYVREKVF---- 531

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF 335
                     N  ++++ +TDG++    +D        + +     ++A+G++     E 
Sbjct: 532 --VEIKGARPNVPRVMILITDGKSSDAFKD-----PAIKLRNSDVEIFAVGVKDAVRSE- 583

Query: 336 LRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIWY 372
           L A ASP S   V      +DAF  I  ++ T+ I  
Sbjct: 584 LEAIASPPSDTHVYTVED-FDAFQRISFEL-TQSICL 618



 Score = 85.6 bits (210), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 47/274 (17%), Positives = 101/274 (36%), Gaps = 30/274 (10%)

Query: 101 NGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIP--LKFCTFIPWYTNSR-HIVMP 157
           +G   ++D    +T   +  +  +  Y ++AIS  ++   +     +   T  R  +  P
Sbjct: 64  DGPEKELDLPASATQTILTELVPDVEYVVTAISYDELEESVPVFGQLTIQTGGRVTLEEP 123

Query: 158 ITSSVKVNSQTDARL-DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVN 216
              + K    + + + D++ ++D S S+                 ++ M+  V       
Sbjct: 124 KLETSKSPRCSISSVADVVFLVDGSWSVGRNN---------FKYILDFMVSLVSAFDIGE 174

Query: 217 NVVQSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKY-AYNQIFDM 273
           +  + G+V +S+     F L   +    L   IK +   G +T +   L +   N     
Sbjct: 175 DKTRVGVVQYSSDTRTEFNLNSYYKKEELVSAIKRIPYKGGNTMTGDALDFLIKNSFVKT 234

Query: 274 QGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSH 333
            G R+        + +I + +TDG     K   +      E +  G  V+++GI+   + 
Sbjct: 235 AGSRKG-------FPRIAIIITDG-----KSQDEVEIPARELRSLGVEVFSLGIKAADAK 282

Query: 334 EFLRACASP--NSFYLVENPHSMYDAFSHIGKDI 365
           E  +  + P     + V N  S+ +    I   +
Sbjct: 283 ELKQIASLPSLKHVFNVANFDSIVEVQDEIITQV 316



 Score = 65.6 bits (158), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 42/250 (16%), Positives = 84/250 (33%), Gaps = 26/250 (10%)

Query: 124  NEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRS 183
               Y ++    ++            T           S  +  +T A  D+++++D S S
Sbjct: 1150 GTSYKVNVFGVFEKGESVPLIGQEMTTLSDAPEVRIDSSGLECKTKAAADIVLLVDGSWS 1209

Query: 184  M-ESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSH 242
            +    F +  + I             V++    ++ VQ  L  +S      + L    + 
Sbjct: 1210 IGRPNFRTVRSFIARL----------VEVFDIGSDRVQIALAQYSGDPRSEWQLNAHSTK 1259

Query: 243  LQ--RKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENL 300
                  +  L   G +T +   L +     F  +          A  KKI V +TDG   
Sbjct: 1260 KSLMDAVANLPYKGGNTLTGMALNFILQNNFKAE------AGMRAKSKKIGVLITDG--- 1310

Query: 301  STKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSH 360
              K     +    + + +G  ++AIGI+    +E  +  + P+  Y+       +    +
Sbjct: 1311 --KSQDDIVAPSKKLRDQGIDLFAIGIKNADENELRQIGSDPDETYVFNVAD--FSLLVN 1366

Query: 361  IGKDIVTKRI 370
            I  D+ T   
Sbjct: 1367 IVDDLTTNLC 1376


>gi|296198464|ref|XP_002746714.1| PREDICTED: collagen alpha-1(XXI) chain isoform 2 [Callithrix
           jacchus]
          Length = 954

 Score = 85.6 bits (210), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 42/214 (19%), Positives = 83/214 (38%), Gaps = 33/214 (15%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           +S   A  D++ +LD S S+           ++  K +  + +   + P     +Q G+V
Sbjct: 29  SSCRTAPTDLVFILDGSYSVGP------ENFEIVKKWLINITKNFDIGP---KFIQVGVV 79

Query: 225 TFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S+       L       HL   ++ +   G +T +   +++A + +F           
Sbjct: 80  QYSDYPVLEIPLGSYDSGEHLMAAVESILYLGGNTRTGKAIQFALDYLF---------AK 130

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA-- 340
                 KI V +TDG     K   +       A+     ++AIG+        LRA A  
Sbjct: 131 SSRFLTKIAVVLTDG-----KSQDEVKDAAEAARDSKITLFAIGVGSETEDAELRAIANK 185

Query: 341 -SPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
            S    + VE+    Y A S I ++++ +++  +
Sbjct: 186 PSSTYVFYVED----YIAISKI-REVMKQKLCEE 214


>gi|296198462|ref|XP_002746713.1| PREDICTED: collagen alpha-1(XXI) chain isoform 1 [Callithrix
           jacchus]
          Length = 957

 Score = 85.6 bits (210), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 42/214 (19%), Positives = 83/214 (38%), Gaps = 33/214 (15%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           +S   A  D++ +LD S S+           ++  K +  + +   + P     +Q G+V
Sbjct: 29  SSCRTAPTDLVFILDGSYSVGP------ENFEIVKKWLINITKNFDIGP---KFIQVGVV 79

Query: 225 TFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S+       L       HL   ++ +   G +T +   +++A + +F           
Sbjct: 80  QYSDYPVLEIPLGSYDSGEHLMAAVESILYLGGNTRTGKAIQFALDYLF---------AK 130

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA-- 340
                 KI V +TDG     K   +       A+     ++AIG+        LRA A  
Sbjct: 131 SSRFLTKIAVVLTDG-----KSQDEVKDAAEAARDSKITLFAIGVGSETEDAELRAIANK 185

Query: 341 -SPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
            S    + VE+    Y A S I ++++ +++  +
Sbjct: 186 PSSTYVFYVED----YIAISKI-REVMKQKLCEE 214


>gi|114798549|ref|YP_759188.1| hypothetical protein HNE_0458 [Hyphomonas neptunium ATCC 15444]
 gi|114738723|gb|ABI76848.1| conserved domain protein [Hyphomonas neptunium ATCC 15444]
          Length = 460

 Score = 85.6 bits (210), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 30/156 (19%), Positives = 58/156 (37%), Gaps = 18/156 (11%)

Query: 230 IEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAY-------NQIFDMQGMRQHCNT 282
                 L +  + L   I  ++    +T    G  + +       N ++         + 
Sbjct: 306 DNTPIPLTYNRNKLHDFIDDMTPR-RNTAGHIGQAWGWYLVSPEWNSVWPAGSKALPYDE 364

Query: 283 EDANYKKIIVFMTDGE-------NLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF 335
            DA   K+++ M+DG+       N       Q+   C++ K++  ++Y +G       + 
Sbjct: 365 PDAT--KVVIMMSDGQYNETRHNNAYPSSVTQAEAICDKMKEKEVVIYTVGFDAGYGQDV 422

Query: 336 LRACAS-PNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           L  CAS P   Y   N   + +A+  I + I   RI
Sbjct: 423 LNYCASNPAFAYKPTNGQELTEAYKSIARSISDLRI 458



 Score = 76.0 bits (185), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 38/224 (16%), Positives = 82/224 (36%), Gaps = 28/224 (12%)

Query: 9   RNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNE 68
           RNFF N  G + ++ A+ +  I  + G  I+       K  +   +D +++  AT+ M +
Sbjct: 6   RNFFRNESGNVAMIAALTIIPIVGIAGFAIDFQVTTTQKARVQQAVDSAVLA-ATKSMQD 64

Query: 69  GNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYS 128
           G                    +++   N+          +  +  T++D+V + + E   
Sbjct: 65  GK----------------DRAYSLKEANDYFKGILNQSNNSGLNCTNIDLVYIDETEELE 108

Query: 129 ISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFF 188
                     L            RH+   ++S+         +L++  V DVS SM +  
Sbjct: 109 GHVECSQNTTLSKV------AGIRHLDFNVSSAATYGI---GKLEIAFVFDVSGSMAN-- 157

Query: 189 DSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D+ +  + +A +     L  V+        V+  +V++   +  
Sbjct: 158 DNRMGNLKVAAREAVNTLLPVEGYAGDPEDVRLAMVSYDTMVNA 201


>gi|83859216|ref|ZP_00952737.1| hypothetical protein OA2633_12465 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83852663|gb|EAP90516.1| hypothetical protein OA2633_12465 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 441

 Score = 85.6 bits (210), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 71/449 (15%), Positives = 147/449 (32%), Gaps = 119/449 (26%)

Query: 8   IRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMN 67
           +R+F  + +G + ++ A+ L  + + +G  ++ S  F +   + S +D   + AA    +
Sbjct: 24  LRHFTQDVRGNVAMMFAMLLGPLVVSVGGALDYSRTFTIGAEIQSAMDAGTLAAA----S 79

Query: 68  EGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGY 127
              G + + +    I   +                     + ++   ++ +         
Sbjct: 80  LSQGEDPETIVRNYITAALSEH------------------NGVLERLNVQVSSDLAINSR 121

Query: 128 SISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESF 187
            ++A +   +P    T +        + +   S      +    L++ +VLD+S SM   
Sbjct: 122 EVTADAVISVP----TLMLGIIGYDALTLNRVSEANERVRN---LEISLVLDISGSMS-- 172

Query: 188 FDSSITKI-DMAIKSINAM-------LEEVKLIP--------------------DVNNVV 219
             S IT + D A + +  M       L  + +IP                    + +  +
Sbjct: 173 -GSKITALRDAAEEFVGVMMDPDLEGLTSLSVIPYNGGVRLPQTVTNDLVPGTPNDSGCL 231

Query: 220 QSGL---VTFSNKIEEFFLLEWGVSHLQRK-----------------------IKYLSKF 253
           + G+   VT       +  L+W     +                         +  +   
Sbjct: 232 ELGVSDPVTMDLAANGYDWLDWQDRDQRGWRSSAFCPEENEATVFLEQTPSVLVNLIRDL 291

Query: 254 GVSTNSTP---------GLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDG------- 297
               N+            L  A+          +    +D +  K++V MTDG       
Sbjct: 292 DAGGNTGLDVATAWGARALDPAWRGRLGGDFASRPAAYDDPSTMKVLVVMTDGAATAQIR 351

Query: 298 --ENLSTKEDQQSLYYCNEAKKR-----------GAIVYAIGIRVIRS--HEFLRACAS- 341
             +N         +Y  ++A+             G  +Y I  +V  S     +R CAS 
Sbjct: 352 RAQNWYGDWYSYEIYSASQARDNMADACDAAEAEGVHIYTIAFQVSGSTNRNLMRDCASR 411

Query: 342 PNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           P ++Y VEN   +  AF+ I  D+   R+
Sbjct: 412 PENYYAVENL-DISAAFNSIAADLNNLRL 439


>gi|332232505|ref|XP_003265445.1| PREDICTED: collagen alpha-5(VI) chain [Nomascus leucogenys]
          Length = 2526

 Score = 85.6 bits (210), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 64/342 (18%), Positives = 129/342 (37%), Gaps = 49/342 (14%)

Query: 41  SHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRD 100
            + +F +  +   IDR  +      +NEG          G  L  +   +  S    L  
Sbjct: 682 LNRYFTQQEISDAIDRMSL------INEGTLT-------GKALNFVGQYFTHSKGARLGA 728

Query: 101 NGFVNDIDDIVRSTSL-DIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNS-------- 151
             F+  I D V    + D   + + +  +I ++  Y         I    +         
Sbjct: 729 KKFLILITDGVARDDVRDPARILRGKDVTIFSVGVYNANRSQLEEISGDGSLVFHVENFD 788

Query: 152 ------RHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAM 205
                 R +V  + +       T   LD++ VLD S S++  +   +         IN  
Sbjct: 789 HLKALERKLVFRVCALHDCKRITL--LDVVFVLDHSGSIKKQYQDHM---------INLT 837

Query: 206 LEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGL 263
           +  VK      + VQ G + +S++    F L      S +   ++     G +T +   L
Sbjct: 838 IHLVKKADVGRDRVQFGALKYSDQPNILFYLNTYSNRSAIIENLRMRRDTGGNTYTAKAL 897

Query: 264 KYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVY 323
           K+A N +F      +H +  + N K++++ +TDG++    +  Q     +E + +G  ++
Sbjct: 898 KHA-NALFT----EEHGSRINQNVKQMLIVITDGKS---HDHDQLNDTASELRDKGITIF 949

Query: 324 AIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDI 365
           A+G+      E      + N+   V+N   + D F+ + + +
Sbjct: 950 AVGVGKANQKELEGMAGNKNNAIYVDNFDKLKDVFTLVQESM 991



 Score = 77.9 bits (190), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 35/210 (16%), Positives = 76/210 (36%), Gaps = 27/210 (12%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
               D + D+M ++D S S+    + +  K+ + +K++      +  I    +  Q G+V
Sbjct: 620 KGCEDMKADIMFLVDSSWSIG---NENFRKMKIFMKNL------LTKIQIGADKTQIGVV 670

Query: 225 TFSNKIEEFFLL-EWGVS-HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            FS+K +E F L  +     +   I  +S     T +   L +        +G R     
Sbjct: 671 QFSDKTKEEFQLNRYFTQQEISDAIDRMSLINEGTLTGKALNFVGQYFTHSKGARLGA-- 728

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                KK ++ +TDG                  + +   ++++G+      +        
Sbjct: 729 -----KKFLILITDG-----VARDDVRDPARILRGKDVTIFSVGVYNANRSQLEEISGDG 778

Query: 343 NSFYLVENPHSMYDAFSHIGKDIVTKRIWY 372
           +  + VEN    +D    + + +V +    
Sbjct: 779 SLVFHVEN----FDHLKALERKLVFRVCAL 804



 Score = 72.9 bits (177), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 32/202 (15%), Positives = 68/202 (33%), Gaps = 26/202 (12%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D+  ++D S S++      I +          MLE  ++     + V+ G+V +S+  E 
Sbjct: 442 DIHFLIDGSSSIQEKQFEQIKRF---------MLEVTEMFSIGPDKVRVGVVQYSDDTEV 492

Query: 233 FFLLEWGVSHL--QRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKI 290
            F +    + +  ++ I  + +    T +   L Y    I +    R             
Sbjct: 493 EFYITDYSNDIDLRKAILNIKQITGGTYTGRALDYILQIIKNGMKDRMSK------VPCY 546

Query: 291 IVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVEN 350
           ++ +TDG         + +      +     ++A+GI      E              +N
Sbjct: 547 LIVLTDG-----MSADRVVEPAKRLRAEQITIHAVGIGAANKIELQEIAGKEERVSFGQN 601

Query: 351 PHSMYDAFSHIGKDIVTKRIWY 372
               +DA   I  ++V +    
Sbjct: 602 ----FDALKSIKNEVVREICTE 619



 Score = 52.5 bits (124), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 30/185 (16%), Positives = 63/185 (34%), Gaps = 22/185 (11%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D++ ++D S  +                 IN M+  +   P   N  +  L  +S++   
Sbjct: 30  DVVFLVDSSDHLGP------KSFPFVKTFINKMINSL---PIEANKYRVALAQYSDEFHS 80

Query: 233 FFLLEW--GVSHLQRKIKY-LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
            F L    G S +   +K      G S      L+ A+   F      +        +  
Sbjct: 81  EFHLSTFKGRSPMLNHLKKNFQFIGGSLQIGKALREAHRTYFSAHTNGRDKK----QFPP 136

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVE 349
           I+V +      S + + +        KK G  + ++G++       L+A A+ +  + + 
Sbjct: 137 ILVVL-----ASAESEDEVEEASKALKKDGVKIISVGVQEASEEN-LKAMATSHFHFNLR 190

Query: 350 NPHSM 354
               +
Sbjct: 191 TIRDL 195


>gi|83859217|ref|ZP_00952738.1| hypothetical protein OA2633_12470 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83852664|gb|EAP90517.1| hypothetical protein OA2633_12470 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 436

 Score = 85.6 bits (210), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 73/464 (15%), Positives = 143/464 (30%), Gaps = 136/464 (29%)

Query: 8   IRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMN 67
              +  + +G + I+ A+   ++   +G  ++ S    + + L S +D   + AA+ +  
Sbjct: 8   FSRWSDDRRGNVAIIMALCSGVLVTAVGGALDYSRSTTVSSELQSALDSGALAAAS-LTQ 66

Query: 68  EGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGY 127
           + N  +  +      L                             S  LD+V        
Sbjct: 67  DRNPEDVVRAYVEAALADHPQLLA---------------------SLQLDVVADISLNSR 105

Query: 128 SISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESF 187
            ++A +   +P    T +        + +   S      +    +++ +VLDVS SM   
Sbjct: 106 VVNATASVAMP----TTMLGLVGINTLTLEHASEAIEQVRD---VEISLVLDVSGSMGG- 157

Query: 188 FDSSITKIDMAIKSINAMLE-----------EVKLIP------------------DVNNV 218
                +KI+    +    +E            + +IP                  + N+ 
Sbjct: 158 -----SKINALQDAAIEFVEIVLAADAAERTSISVIPYNGGVRTPREVNQDIVSGNNNHR 212

Query: 219 VQSGLV---------------------TFSNKIEEFFL-------------LEWGVSHLQ 244
            QSG V                      + ++                   L      ++
Sbjct: 213 RQSGCVDMGTDYPVEMTLPYREMEFTEYYGSEQTGNSSSAFCPRSNMESEFLSQNEGRMR 272

Query: 245 RKIKYLSKFGVS-----TNSTP-GLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGE 298
             I  L   G +     T      L  A+          +  + +D +  KI+V MTDGE
Sbjct: 273 GLINSLRAEGNTGLDVATMWGARALDPAWRGNLGGSFSDRPASYDDRDTIKILVVMTDGE 332

Query: 299 NLST----------------------------KEDQQSLYYCNEAKKRGAIVYAIGIRV- 329
             +                             +  +     C+ A+  G  +Y I  ++ 
Sbjct: 333 ATAQIRSEEYTYYDWWGRERTGTRSYELYSARQARENMAEACDIAEGNGVQIYTIAFQLS 392

Query: 330 -IRSHEFLRACAS-PNSFYLVENPHSMYDAFSHIGKDIVTKRIW 371
              + + +R CA+ P ++Y VEN   + +AFS I  DI   R+ 
Sbjct: 393 GQTNRDLMRNCANKPQNYYQVENL-DIAEAFSSIAADINRLRLT 435


>gi|20089145|ref|NP_615220.1| hypothetical protein MA0247 [Methanosarcina acetivorans C2A]
 gi|19914014|gb|AAM03700.1| hypothetical protein (multi-domain) [Methanosarcina acetivorans
           C2A]
          Length = 589

 Score = 85.2 bits (209), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 52/284 (18%), Positives = 104/284 (36%), Gaps = 30/284 (10%)

Query: 90  WNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYT 149
           WN   +  L  + F   +  +V       V        ++S  +    P           
Sbjct: 3   WNKKIKENLLRSIFFASVLGVVAIVLTGAVSAQAIAEPAVSKTAS---PALINIAGSGVN 59

Query: 150 NSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEV 209
               + + +T      S +   +D++  +D S SM+S   S + K      +  + ++++
Sbjct: 60  EETTVTIEVTG-AGSTSTSAVPMDVVFAIDSSGSMQSNDPSGLRK-----TAAKSFVDKM 113

Query: 210 KLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQ 269
               D       G+V++ + I+    L      ++  I  +   G STN   GL+ A + 
Sbjct: 114 DSSRDTA-----GVVSWDDSIDFSLPLTNDFPLVKTNIDSVDSSG-STNLNVGLEEAIDI 167

Query: 270 IFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV 329
           +          N    N  ++I+F+TDG+               EA  +G ++Y+IG+  
Sbjct: 168 L--------DANPRTENSVEVIIFLTDGQGTYLHS------TAQEAADKGYVIYSIGLGG 213

Query: 330 IRSHEFL-RACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIWY 372
           +        A  +  ++Y   +  S+   F  I  ++ T  I Y
Sbjct: 214 VNPTPLQDMATTTGGAYYSSPDATSLQAIFDDIFSEVTTSTIPY 257


>gi|73950493|ref|XP_544451.2| PREDICTED: similar to Cartilage matrix protein precursor
           (Matrilin-1) [Canis familiaris]
          Length = 562

 Score = 85.2 bits (209), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 40/220 (18%), Positives = 83/220 (37%), Gaps = 30/220 (13%)

Query: 159 TSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNV 218
           T +V       +  D++ ++D S+S+           ++  K IN +++ + +      +
Sbjct: 216 TCNVCSGGGGSSATDLVFLIDGSKSVRP------ENFELVKKFINQIVDTLDVSD---KL 266

Query: 219 VQSGLVTFSNKIEEFFLLEWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAY-NQIFDMQG 275
            Q GLV +S+ + + F L        ++  ++ +S     T +   LKY   N      G
Sbjct: 267 AQVGLVQYSSSVRQEFPLGRFHTKKDIKAAVRNMSYMEKGTMTGAALKYLIDNSFTVSSG 326

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF 335
            R          +K+ +  TDG +     D        +AK  G  ++A+G+      E 
Sbjct: 327 ARPGA-------QKVGIVFTDGRSQDYINDA-----AKKAKDLGFKMFAVGVGNAVEDEL 374

Query: 336 LRACASP--NSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
               + P    ++   +    +   + IGK +  K    +
Sbjct: 375 REIASEPVAEHYFYTAD----FKTINQIGKRLQKKICVEE 410



 Score = 59.4 bits (142), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 16/115 (13%), Positives = 49/115 (42%), Gaps = 11/115 (9%)

Query: 163 KVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSG 222
           + +       D++ V+D SRS+         + +     ++ ++E + + P+     + G
Sbjct: 31  RGHLCRTRPTDLVFVVDSSRSVRP------VEFEKVKVFLSQVIESLDVGPNA---TRVG 81

Query: 223 LVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQG 275
           +V +++ +++ F L      + L + ++ +      T +   +++A  + F    
Sbjct: 82  VVNYASAVKQEFPLRAHGSKAALLQAVRRIQPLSTGTMTGLAIQFAITKAFGDAE 136


>gi|152990340|ref|YP_001356062.1| von Willebrand factor type A domain-containing protein
           [Nitratiruptor sp. SB155-2]
 gi|151422201|dbj|BAF69705.1| von Willebrand factor type A domain protein [Nitratiruptor sp.
           SB155-2]
          Length = 289

 Score = 85.2 bits (209), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 40/202 (19%), Positives = 68/202 (33%), Gaps = 19/202 (9%)

Query: 163 KVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSG 222
            +        D+++ LD S SME       +K ++            K   D       G
Sbjct: 68  SIKLDDRKGRDLVLALDASGSMEESLYDEKSKFEVVKSMAQNFFH--KRFDDN-----IG 120

Query: 223 LVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
           +V F +       L +    L   I YL       N+  G       ++      Q    
Sbjct: 121 IVIFGSFAYIAAPLTYDTKALDFLINYLEPSIAGNNTAIG-----EGLWQGIKALQ---- 171

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRAC-AS 341
            D   +K+++ +TDG + S            +AKK G  +Y IG+     H   +    S
Sbjct: 172 ADTAKQKVLILITDGHHNSGS--ISPRQAVEKAKKLGIKIYTIGLGDADKHLLEQIAKES 229

Query: 342 PNSFYLVENPHSMYDAFSHIGK 363
              F+  ++   +   FS + K
Sbjct: 230 GGKFFYAKSEEDLQSIFSELNK 251


>gi|311244457|ref|XP_001927071.2| PREDICTED: collagen alpha-1(XII) chain [Sus scrofa]
          Length = 1894

 Score = 85.2 bits (209), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 53/267 (19%), Positives = 102/267 (38%), Gaps = 37/267 (13%)

Query: 111 VRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDA 170
            ++T L +  +  +  Y IS  +   +       I   T    + +  +  V + +    
Sbjct: 364 PQTTMLSVRDLSADTEYQISVSAMKGLTASEPISIMEKTQPMKVQVECSRGVDIKA---- 419

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
             D++ ++D S S+     ++  K+   ++ +      VK      N VQ  LV +S   
Sbjct: 420 --DIVFLVDGSYSIG---IANFVKVRAFLEVL------VKSFEISPNRVQISLVQYSRDP 468

Query: 231 EEFFLLEWGVS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
              F L+       +   I      G STN+   + Y   +IF             +N  
Sbjct: 469 HTEFTLKKFTKVEDIIEAINTFPYRGGSTNTGKAMTYVREKIF------VPSKGSRSNVP 522

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NSF 345
           K+++ +TDG++     D        + +     ++A+G++     E L A ASP      
Sbjct: 523 KVMILITDGKSSDAFRD-----PAIKLRNSDVEIFAVGVKDAVRSE-LEAIASPPAETHV 576

Query: 346 YLVENPHSMYDAFSHIGKDIVTKRIWY 372
           + VE+    +DAF  I  ++ T+ I  
Sbjct: 577 FTVED----FDAFQRISFEL-TQSICL 598



 Score = 81.4 bits (199), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 42/264 (15%), Positives = 99/264 (37%), Gaps = 34/264 (12%)

Query: 116 LDIVVVPQNEGYSISAISRYKIPLKFC---TFIPWYTNSRHIVMPITSSVKVNSQTDAR- 171
           +D       + ++++A +   +  +      ++   T+   +   +    ++   + +  
Sbjct: 59  VDPTTDGPTKEFTLAASTTETLLSELIPEVEYVVTITSYDEVEESVPVIGQLTKCSVSAW 118

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
            D++ ++D S S+      +   I   I ++      V          + G+V +S+   
Sbjct: 119 TDLVFLVDGSWSVGRN---NFKYILDFIAAL------VSAFDIGEEKTRVGVVQYSSDTR 169

Query: 232 EFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKY-AYNQIFDMQGMRQHCNTEDANYK 288
             F L   +    L   IK +   G +T +   + +   N   +  G R         + 
Sbjct: 170 TEFNLNQFYQRDELLAAIKKIPYKGGNTMTGDAIDFLIKNTFTESAGARVG-------FP 222

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP--NSFY 346
           K+ + +TDG     K   +      E +  G  V+++GI+   + E  +  ++P  N  +
Sbjct: 223 KVAIIITDG-----KSQDEVEIPARELRNIGVEVFSLGIKAADAKELKQIASTPSLNHVF 277

Query: 347 LVENPHSMYDAFSHIGKDIVTKRI 370
            V N    +DA   I  +I+++  
Sbjct: 278 NVAN----FDAIVDIQNEIISQVC 297


>gi|293349337|ref|XP_001060689.2| PREDICTED: collagen, type XII, alpha 1 [Rattus norvegicus]
          Length = 3064

 Score = 85.2 bits (209), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 52/267 (19%), Positives = 105/267 (39%), Gaps = 37/267 (13%)

Query: 111 VRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDA 170
            ++T+L++  +  +  Y IS  +   +       +   T    + +  +  V + +    
Sbjct: 384 PQTTTLNVRDLSADTEYQISVFAMKGLTSSEPVSVMEKTQPMKVQVECSRGVDIKA---- 439

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
             D++ ++D S S+     ++  K+   ++ +       K      N VQ  LV +S   
Sbjct: 440 --DIVFLVDGSYSIG---IANFVKVRAFLEVL------AKSFEISPNRVQISLVQYSRDP 488

Query: 231 EEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
              F L+    V  + + I      G STN+   + Y   +IF             +N  
Sbjct: 489 HTEFTLKEFNRVEDIIKAINNFPYRGGSTNTGKAMTYVREKIFVPN------KGSRSNVP 542

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP---NSF 345
           K+++ +TDG++     D        + +     ++A+G++     E L A ASP      
Sbjct: 543 KVMILITDGKSSDAFRD-----PAIKLRNSDVEIFAVGVKDAVRSE-LEAIASPPAETHV 596

Query: 346 YLVENPHSMYDAFSHIGKDIVTKRIWY 372
           + VE+    +DAF  I  ++ T+ I  
Sbjct: 597 FTVED----FDAFQRISFEL-TQSICL 618



 Score = 85.2 bits (209), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 52/309 (16%), Positives = 102/309 (33%), Gaps = 45/309 (14%)

Query: 67  NEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEG 126
            +     R  +         + T   S    L  N  + +   +V  TS D V   ++  
Sbjct: 49  ADPIVGYRITVDSTTDGPTKEFTLAASTTETLLSN-LIPETQYVVTITSYDEVE--ESVP 105

Query: 127 YSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMES 186
                      P K     P  T  +   +   +            D++ ++D S S+  
Sbjct: 106 VIGQLTIETGDPAKPGEKKPGKTEIQKCSVSAWT------------DLVFLVDGSWSVGR 153

Query: 187 FFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLE--WGVSHLQ 244
                          ++ ++  V          + G+V +S+     F L   +    L 
Sbjct: 154 NN---------FKYILDFIVALVSAFDIGEEKTRVGVVQYSSDTRTEFNLNQYYRREDLL 204

Query: 245 RKIKYLSKFGVSTNSTPGLKY-AYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTK 303
             IK +   G +T +   + Y   N   +  G R         + K+ + +TDG     K
Sbjct: 205 AAIKKIPYKGGNTMTGDAIDYLVKNTFTESAGSRAG-------FPKVAIIITDG-----K 252

Query: 304 EDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP--NSFYLVENPHSMYDAFSHI 361
              +      E +  G  V+++GI+   + E  +  ++P  N  + V N    +DA   I
Sbjct: 253 SQDEVEIPARELRNIGVEVFSLGIKAADAKELKQIASTPSLNHVFNVAN----FDAIVDI 308

Query: 362 GKDIVTKRI 370
             +I+++  
Sbjct: 309 QNEIISQVC 317



 Score = 60.9 bits (146), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 43/251 (17%), Positives = 84/251 (33%), Gaps = 28/251 (11%)

Query: 124  NEGYSISAISRYK--IPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVS 181
               Y ++    +     L          +   +   ++S ++  ++ +A  D+++++D S
Sbjct: 1150 GTTYRVNVFGMFDGGESLPLVGQEMTTLSDTTVTPFLSSGMECLTRAEA--DIVLLVDGS 1207

Query: 182  RSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLE--WG 239
             S+                 I+ ++E  ++ P     VQ  L  +S      + L     
Sbjct: 1208 WSIG------RANFRTVRSFISRIVEVFEIGP---KRVQIALAQYSGDPRTEWHLNAHRD 1258

Query: 240  VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGEN 299
               L + +  L   G +T +   L +   Q F  Q             +KI V +TDG  
Sbjct: 1259 KKSLLQAVANLPYKGGNTLTGMALNFIRQQSFKTQ------AGMRPRARKIGVLITDG-- 1310

Query: 300  LSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFS 359
               K          + K  G  ++AIGI+     E       P+      N    +++ S
Sbjct: 1311 ---KSQDDVEAPSKKLKDEGVELFAIGIKNADEVELKMIATDPDDI-HAYNVAD-FESLS 1365

Query: 360  HIGKDIVTKRI 370
             I  D+     
Sbjct: 1366 KIVDDLTINLC 1376


>gi|301610722|ref|XP_002934910.1| PREDICTED: collagen alpha-1(XXI) chain-like [Xenopus (Silurana)
           tropicalis]
          Length = 957

 Score = 85.2 bits (209), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 45/214 (21%), Positives = 85/214 (39%), Gaps = 33/214 (15%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           +S   A  D++ +LD S S+           ++  K +  +     + P      Q G+V
Sbjct: 29  SSCRTAPNDLVFILDGSWSVGP------ENFEILKKWVVNITSNFNIGP---KFTQVGVV 79

Query: 225 TFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +S+       L        L R+++ +   G +T +   +++A + +F           
Sbjct: 80  QYSDYPILEIPLGSYESSDDLSRRMQSIQYLGGNTQTGNAIRFAIDNLFARSL------- 132

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA-- 340
                 KI V +TDG     K   +  +   EA+K    ++AIG+        LRA A  
Sbjct: 133 --RPLTKIAVVLTDG-----KSQDEVKHVAEEARKNKITLFAIGVGSEIEESELRAIANK 185

Query: 341 -SPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
            S    + VE+    Y A S I ++I+ +++  +
Sbjct: 186 PSSTYVFYVED----YIAISKI-REIMKQKLCEE 214


>gi|332716075|ref|YP_004443541.1| hypothetical protein AGROH133_11102 [Agrobacterium sp. H13-3]
 gi|325062760|gb|ADY66450.1| hypothetical protein AGROH133_11102 [Agrobacterium sp. H13-3]
          Length = 429

 Score = 85.2 bits (209), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 70/415 (16%), Positives = 137/415 (33%), Gaps = 67/415 (16%)

Query: 8   IRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMID----------RS 57
           ++NF+    G   ILTA+ +  +    G+ ++++    +K  L    D           +
Sbjct: 1   MKNFWQEKSGNFGILTALLMVPLCGAAGVALDITRGMSVKADLQQAADSAALAAVADMSA 60

Query: 58  LVHAATQIMNEGNGNNRKKLKGGDILCRIKN----TWNMSFRNELRDNGFVNDIDDIVRS 113
            V AA ++  +G      +          +     T      + ++    V        S
Sbjct: 61  SVQAAKKMSGDGVIPVGNEEARAFFDGNQRGDADYTITSVDVSVIKHGNVVESSVSFKAS 120

Query: 114 TSLDIVVVPQNEGYSISAISRYKIPLK-FCTFIPWYTNSRHIVMPIT----SSVKVNSQT 168
            S  +  +   +  S++  +  K   + F  F     N+  + +  T    +++  N+  
Sbjct: 121 VSTTLSGLLGKDFVSVAGTATAKYETETFSDFYLLLDNTPSMGVGATPTDVATLVANTGD 180

Query: 169 DARLDMMIVLDVSRSMESFF-----DSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGL 223
                  IV D      S++         T+ID+  K+  ++++  K     +N  +  +
Sbjct: 181 KCAFACHIVKDGVADPNSYYFKAKKLGVTTRIDVVAKATASLMDTAKSTRKSSNQYRMAV 240

Query: 224 VTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
            TF  + E+  LLE  V  L   +    K     N        YN        R      
Sbjct: 241 YTFGERAEDTKLLE--VVSLTSDLDAAKKKAGEINLMSIPYQGYNNDQQTDFDRALIQIG 298

Query: 284 D-----------ANYKKIIVFMTDGENLSTKEDQQSLYY-------------CNEAKKRG 319
           D           AN  K+I F++DG   S K    +                C + K++G
Sbjct: 299 DKVGSSGTGASSANPDKVIFFVSDGVGDSYKPSSCTKKLTGGRCQEPIDIKDCTKLKEKG 358

Query: 320 AIV---YAIGIRVIRS--------------HEFLRACASPNSFYLVENPHSMYDA 357
             +   Y   + +  +                 +++CASP  ++ V     + DA
Sbjct: 359 FRIAVLYTTYLPLPTNDWYNSWIKPFQAEIGSRMQSCASPGLYFEVSPSQGISDA 413


>gi|327269503|ref|XP_003219533.1| PREDICTED: collagen alpha-1(XXII) chain-like [Anolis carolinensis]
          Length = 1601

 Score = 84.8 bits (208), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 40/221 (18%), Positives = 85/221 (38%), Gaps = 30/221 (13%)

Query: 159 TSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNV 218
            +  +     +   D++ +LD S S+           +   + +  +++  ++ PD    
Sbjct: 24  ETQAQRAGCKNVHYDLVFILDTSSSVGK------EDFEKVRQWVANLVDTFEIGPDK--- 74

Query: 219 VQSGLVTFSNKIEEFFLLEWGVSHLQRKIKY----LSKFGVSTNSTPGLKYAYNQIFDMQ 274
            + G+V +S++    F L  G    + +IK     +  +G +TN+   L+Y     F  +
Sbjct: 75  TRVGVVRYSDRPTTEFDL--GRYQTREQIKEAAKNIKYYGGNTNTGDALRYINTYSFSEE 132

Query: 275 GMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHE 334
                    D+  KK+ + +TDG           L     A K G  ++A+G+      E
Sbjct: 133 ---AGGRPTDSAIKKVAILLTDGR-----SQDHVLDPATAAHKAGIRIFAVGVGEALKEE 184

Query: 335 FLRACASPN--SFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
                + P     + V +    Y+A   I +  + +R+  +
Sbjct: 185 LDEIASEPKSAHVFHVSD----YNAIDKI-RGKLRRRLCEN 220


>gi|149732296|ref|XP_001503293.1| PREDICTED: collagen, type XXI, alpha 1 [Equus caballus]
          Length = 957

 Score = 84.8 bits (208), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 42/214 (19%), Positives = 84/214 (39%), Gaps = 33/214 (15%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           +S   A  D++ +LD S S+           ++  K +  +     + P     +Q G+V
Sbjct: 29  SSCRTAPTDLVFILDGS