PSIBLAST alignment of GI: 254780934 and protein with PDB id: 1ck4

>gi|7766811|pdb|1CK4|A Chain A, Crystal Structure Of Rat A1b1 Integrin I-Domain. Length = 198
>gi|7766812|pdb|1CK4|B Chain B, Crystal Structure Of Rat A1b1 Integrin I-Domain Length = 198
 Score = 54.1 bits (128), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 32/206 (15%), Positives = 66/206 (32%), Gaps = 29/206 (14%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           LD++IVLD S S+  +        D+  +      +    I      V            
Sbjct: 5   LDIVIVLDGSNSIYPWESVIAFLNDLLKRMDIGPKQTQVGIVQYGENVTHEFNLNKYSST 64

Query: 232 EFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKII 291
           E  L+       Q  ++ ++  G+ T        A                     KK++
Sbjct: 65  EEVLVAANKIGRQGGLQTMTALGIDTARKEAFTEA--------------RGARRGVKKVM 110

Query: 292 VFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFL---------RACA-- 340
           V +TDGE+    ++ +      + +      ++I I    +   L         ++ A  
Sbjct: 111 VIVTDGESH---DNYRLKQVIQDCEDENIQRFSIAILGHYNRGNLSTEKFVEEIKSIASE 167

Query: 341 -SPNSFYLVENPHSMYDAFSHIGKDI 365
            +   F+ V +  ++      +G+ I
Sbjct: 168 PTEKHFFNVSDELALVTIVKALGERI 193