PSIBLAST alignment of GI: 254780934 and protein with PDB id: 1mf7

>gi|31615583|pdb|1MF7|A Chain A, Integrin Alpha M I Domain Length = 194
 Score = 66.4 bits (160), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 32/200 (16%), Positives = 72/200 (36%), Gaps = 24/200 (12%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D+  ++D S S+       + +    +       + +  +   +   +            
Sbjct: 7   DIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFRIHFT-------- 58

Query: 233 FFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIV 292
            F       + +  +K +++    T++  G++    ++F++       N    N  KI+V
Sbjct: 59  -FKEFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFNI------TNGARKNAFKILV 111

Query: 293 FMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV----IRSHEFLRACASP---NSF 345
            +TDGE     +         EA + G I Y IG+       +S + L   AS    +  
Sbjct: 112 VITDGEKFG--DPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQELNTIASKPPRDHV 169

Query: 346 YLVENPHSMYDAFSHIGKDI 365
           + V N  ++    + + + I
Sbjct: 170 FQVNNFEALKTIQNQLREKI 189