PSIBLAST alignment of GI: 254780934 and protein with PDB id: 1rrk

>gi|58176651|pdb|1RRK|A Chain A, Crystal Structure Analysis Of The Bb Segment Of Factor B Length = 497
>gi|58176654|pdb|1RS0|A Chain A, Crystal Structure Analysis Of The Bb Segment Of Factor B Complexed With Di-Isopropyl-Phosphate (Dip) Length = 497
 Score = 57.6 bits (137), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 29/219 (13%), Positives = 74/219 (33%), Gaps = 28/219 (12%)

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN-- 228
            +++ +VLD S S+ +   +          +   ++  ++ +       + GLVT++   
Sbjct: 1   SMNIYLVLDGSDSIGASNFTG---------AKKVLVNLIEKVASYGVKPRYGLVTYATYP 51

Query: 229 --KIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
              ++           + +++  ++       S    K A   ++ M         E  N
Sbjct: 52  KIWVKVSEADSSNADWVTKQLNEINYEDHKLKSGTNTKKALQAVYSMMSWPDDVPPEGWN 111

Query: 287 YKKI-IVFMTDGENLSTKEDQQSLYYCNEA----------KKRGAIVYAIGIRVIRSHEF 335
             +  I+ MTDG +    +    +    +           ++    VY  G+  + +   
Sbjct: 112 RTRHVIILMTDGLHNMGGDPITVIDEIRDLLYIGKDRKNPREDYLDVYVFGVGPLVNQVN 171

Query: 336 LRACASPN----SFYLVENPHSMYDAFSHIGKDIVTKRI 370
           + A AS          V++   + D F  +  +  +  +
Sbjct: 172 INALASKKDNEQHVCKVKDMECLEDVFYQMIDESQSLSL 210