PSIBLAST alignment of GI: 254780934 and protein with PDB id: 1xdd

>gi|55670827|pdb|1XDD|A Chain A, X-Ray Structure Of Lfa-1 I-Domain In Complex With Lfa703 At 2.2a Resolution Length = 188
>gi|55670828|pdb|1XDD|B Chain B, X-Ray Structure Of Lfa-1 I-Domain In Complex With Lfa703 At 2.2a Resolution Length = 188
 Score = 50.2 bits (118), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 37/210 (17%), Positives = 68/210 (32%), Gaps = 37/210 (17%)

Query: 166 SQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVT 225
             +   +D++ + D   SM    D     +D     +  +                  V 
Sbjct: 1   MASKGNVDLVFLFD--GSMSLQPDEFQKILDFMKDVMKKLSNTSYQ---------FAAVQ 49

Query: 226 FSNKIEEFFLLEWGVSHLQR---KIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
           FS   +  F         +     +K++    + TN+   + Y   ++F      +    
Sbjct: 50  FSTSYKTEF-DFSDYVKWKDPDALLKHVKHMLLLTNTFGAINYVATEVF------REELG 102

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR----VIRSHEFLRA 338
              +  K+++ +TDGE   +          + AK    I Y IGI        S E L  
Sbjct: 103 ARPDATKVLIIITDGEATDSGN-------IDAAKD--IIRYIIGIGKHFQTKESQETLHK 153

Query: 339 CASPNSFYLV---ENPHSMYDAFSHIGKDI 365
            AS  +   V   +    + D F+ + K I
Sbjct: 154 FASKPASEFVKILDTFEKLKDLFTELQKKI 183