PSIBLAST alignment of GI: 254780934 and protein with PDB id: 2odp

>gi|126031547|pdb|2ODP|A Chain A, Complement Component C2a, The Catalytic Fragment Of C3- And C5-Convertase Of Human Complement Length = 509
>gi|126031548|pdb|2ODQ|A Chain A, Complement Component C2a, The Catalytic Fragment Of C3- And C5-Convertase Of Human Complement Length = 509
 Score = 59.5 bits (142), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 32/216 (14%), Positives = 72/216 (33%), Gaps = 28/216 (12%)

Query: 163 KVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSG 222
           K+  Q    L++ ++LD S+S+         +              V  I      V   
Sbjct: 1   KIQIQRSGHLNLYLLLDASQSVSENDFLIFKESASL---------MVDRIFSFEINVSVA 51

Query: 223 LVTFSNKIEEFFLLEWGVS-HLQRKIKYLSK-------FGVSTNSTPGLKYAYNQIFDMQ 274
           ++TF+++ +    +    S  +   I  L          G  TN+   L   Y  + +  
Sbjct: 52  IITFASEPKVLMSVLNDNSRDMTEVISSLENANYKDHENGTGTNTYAALNSVYLMMNNQM 111

Query: 275 GMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEA------KKRGAIVYAIGIR 328
            +           +  I+ +TDG++      + ++ +  E       +     +YAIG+ 
Sbjct: 112 RLLGMETMAWQEIRHAIILLTDGKSNMGGSPKTAVDHIREILNINQKRNDYLDIYAIGVG 171

Query: 329 V-IRSHEFLRACASPN----SFYLVENPHSMYDAFS 359
                   L    S        +++++  +++  F 
Sbjct: 172 KLDVDWRELNELGSKKDGERHAFILQDTKALHQVFE 207