PSIBLAST alignment of GI: 254780934 and protein with PDB id: 2xwb

>gi|317455060|pdb|2XWB|F Chain F, Crystal Structure Of Complement C3b In Complex With Factors B And D Length = 732
>gi|317455061|pdb|2XWB|H Chain H, Crystal Structure Of Complement C3b In Complex With Factors B And D Length = 732
 Score = 68.3 bits (165), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 29/220 (13%), Positives = 76/220 (34%), Gaps = 28/220 (12%)

Query: 170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN- 228
             +++ +VLD S S+ +   +          +   ++  ++ +       + GLVT++  
Sbjct: 233 GSMNIYLVLDGSGSIGASDFTG---------AKKCLVNLIEKVASYGVKPRYGLVTYATY 283

Query: 229 ---KIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDA 285
               ++           + +++  ++       S    K A   ++ M         E  
Sbjct: 284 PKIWVKVSEADSSNADWVTKQLNEINYEDHKLKSGTNTKKALQAVYSMMSWPDDVPPEGW 343

Query: 286 NYKKI-IVFMTDGENLSTKEDQQSLYYCNEA----------KKRGAIVYAIGIRVIRSHE 334
           N  +  I+ MTDG +    +    +    +           ++    VY  G+  + +  
Sbjct: 344 NRTRHVIILMTDGLHNMGGDPITVIDEIRDLLYIGKDRKNPREDYLDVYVFGVGPLVNQV 403

Query: 335 FLRACASPN----SFYLVENPHSMYDAFSHIGKDIVTKRI 370
            + A AS        + V++  ++ D F  +  +  +  +
Sbjct: 404 NINALASKKDNEQHVFKVKDMENLEDVFYQMIDESQSLSL 443