PSIBLAST alignment of GI: 254780934 and protein with PDB id: 3ibs

>gi|256599878|pdb|3IBS|A Chain A, Crystal Structure Of Conserved Hypothetical Protein Batb From Bacteroides Thetaiotaomicron Length = 218
>gi|256599879|pdb|3IBS|B Chain B, Crystal Structure Of Conserved Hypothetical Protein Batb From Bacteroides Thetaiotaomicron Length = 218
 Score = 50.6 bits (119), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 31/237 (13%), Positives = 73/237 (30%), Gaps = 56/237 (23%)

Query: 161 SVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQ 220
           S   N+     ++++I LD+S S  +      ++++ A + I+ +++E+       +  +
Sbjct: 1   SNASNAVKRKGVEVIIALDISNSXLAQD-VQPSRLEKAKRLISRLVDEL-------DNDK 52

Query: 221 SGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKF---GVSTNSTPGLKYAYNQIFDMQGMR 277
            G + F+        +       +  ++ +S        T     +  A           
Sbjct: 53  VGXIVFAGDAFTQLPITSDYISAKXFLESISPSLISKQGTAIGEAINLATR--------- 103

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR------ 331
               T      + I+ +TDGEN      + +     +       V  +G+          
Sbjct: 104 --SFTPQEGVGRAIIVITDGENHEGGAVEAAKAAAEKG----IQVSVLGVGXPEGAPIPV 157

Query: 332 -------------------SHEFLRACASPNS--FYLVENPHSMYDAFSHIGKDIVT 367
                              +    +  A      +  V+N +S   A   I ++I  
Sbjct: 158 EGTNDYRRDREGNVIVTRLNEGXCQEIAKDGKGIYVRVDNSNSAQKA---ISQEISK 211