BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780934|ref|YP_003065347.1| hypothetical protein
CLIBASIA_04165 [Candidatus Liberibacter asiaticus str. psy62]
         (374 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780934|ref|YP_003065347.1| hypothetical protein CLIBASIA_04165 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040611|gb|ACT57407.1| hypothetical protein CLIBASIA_04165 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 374

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 374/374 (100%), Positives = 374/374 (100%)

Query: 1   MFSLNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVH 60
           MFSLNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVH
Sbjct: 1   MFSLNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVH 60

Query: 61  AATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVV 120
           AATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVV
Sbjct: 61  AATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVV 120

Query: 121 VPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDV 180
           VPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDV
Sbjct: 121 VPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDV 180

Query: 181 SRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGV 240
           SRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGV
Sbjct: 181 SRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGV 240

Query: 241 SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENL 300
           SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENL
Sbjct: 241 SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENL 300

Query: 301 STKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSH 360
           STKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSH
Sbjct: 301 STKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSH 360

Query: 361 IGKDIVTKRIWYDK 374
           IGKDIVTKRIWYDK
Sbjct: 361 IGKDIVTKRIWYDK 374


>gi|254780833|ref|YP_003065246.1| hypothetical protein CLIBASIA_03630 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040510|gb|ACT57306.1| hypothetical protein CLIBASIA_03630 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 371

 Score =  250 bits (637), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 204/371 (54%), Positives = 271/371 (73%), Gaps = 3/371 (0%)

Query: 5   NLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQ 64
            LNIRNFFYN KG ++ILTAI LP+IF+V+G++IE SH FF+K  LH ++D SL++ AT+
Sbjct: 3   FLNIRNFFYNCKGSISILTAILLPVIFIVMGLVIETSHKFFVKAKLHYILDHSLLYTATK 62

Query: 65  IMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQN 124
           I+N+ NGNN KK K       IKN W   FRNELR+NGF  DI++I RSTSL I++  Q+
Sbjct: 63  ILNQENGNNGKKQKNDFSYRIIKNIWQTDFRNELRENGFAQDINNIERSTSLSIIIDDQH 122

Query: 125 EGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSM 184
           + Y++SA+SRY++P  FCTF PW  NS H  + ITSSVK++S++D  LDMM+VLDVS SM
Sbjct: 123 KDYNLSAVSRYEMPFIFCTF-PWCANSSHAPLLITSSVKISSKSDIGLDMMMVLDVSLSM 181

Query: 185 ESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQ 244
              F   + K+ +A +SI  ML+ +K IPDVNNVV+SGLVTFS+KI + F L WGV H+Q
Sbjct: 182 NDHFGPGMDKLGVATRSIREMLDIIKSIPDVNNVVRSGLVTFSSKIVQTFPLAWGVQHIQ 241

Query: 245 RKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKE 304
            KI  L  FG +T STPGL+YAYN+IFD +   +H      +YKK I+F+TDGEN S   
Sbjct: 242 EKINRL-IFGSTTKSTPGLEYAYNKIFDAKEKLEHIAKGHDDYKKYIIFLTDGENSSPNI 300

Query: 305 DQ-QSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGK 363
           D  +SL+YCNEAK+RGAIVYAIG++   + +FL+ CASP+ FY V+N   ++DAF  IGK
Sbjct: 301 DNKESLFYCNEAKRRGAIVYAIGVQAEAADQFLKNCASPDRFYSVQNSRKLHDAFLRIGK 360

Query: 364 DIVTKRIWYDK 374
           ++V +RI Y+K
Sbjct: 361 EMVKQRILYNK 371


>gi|163760496|ref|ZP_02167578.1| hypothetical protein HPDFL43_04296 [Hoeflea phototrophica DFL-43]
 gi|162282447|gb|EDQ32736.1| hypothetical protein HPDFL43_04296 [Hoeflea phototrophica DFL-43]
          Length = 363

 Score =  214 bits (545), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 68/366 (18%), Positives = 145/366 (39%), Gaps = 19/366 (5%)

Query: 1   MFS--LNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSL 58
           M S  +   IR    N  G   ++ A  +P++F+   + ++ ++   MK  L + +D + 
Sbjct: 1   MMSTRITSKIRKLLRNENGNFALIAAAAVPVLFMAGSLAVDTTNAMSMKVRLQNAVDSAA 60

Query: 59  VHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDI 118
           +  A ++  E N              + +         +++++    +   +  + ++D 
Sbjct: 61  LATAARLSEEENLTAA----------QAQAFALKFVNGQVKEDFGAFNGFSVTPTVNIDP 110

Query: 119 VVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVL 178
           V       + ++         +  T +        + + +    +   +      M +VL
Sbjct: 111 VETGGRTVWKVAVSMEGS---QSLTPMARIMGKDKLTVSVVGKSESAGEAQGAFSMALVL 167

Query: 179 DVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEW 238
           D S SM+   +    KI++   ++  ++E+ +        V+ G  ++++K+     L W
Sbjct: 168 DRSGSMDWNLNGQ-KKINVLKTAVGGLIEQFEEADPERKYVRLGASSYNSKLTGSTKLRW 226

Query: 239 GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGE 298
                +  +  L   G  T+ST    +AY  +   +    H        KK IVFMTDG+
Sbjct: 227 NPGKTKEFVDALPASG-GTDSTDAFDWAYTAVTHKRENNTHDAKSGQVPKKFIVFMTDGD 285

Query: 299 NLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR-SHEFLRACA-SPNSFYLVENPHSMYD 356
           N  +  D  + + C++AK  G  VY +         + L  CA +   F+  +N   + +
Sbjct: 286 NNYSSADSSTKHLCDDAKDDGIEVYTVAFAAPNRGKQLLSYCASTEEHFFDAQNSAQLIE 345

Query: 357 AFSHIG 362
           AF +IG
Sbjct: 346 AFKNIG 351


>gi|307945905|ref|ZP_07661241.1| putative von Willebrand factor type A [Roseibium sp. TrichSKD4]
 gi|307771778|gb|EFO31003.1| putative von Willebrand factor type A [Roseibium sp. TrichSKD4]
          Length = 432

 Score =  208 bits (530), Expect = 8e-52,   Method: Composition-based stats.
 Identities = 68/365 (18%), Positives = 139/365 (38%), Gaps = 14/365 (3%)

Query: 12  FYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNG 71
                G +  L  I + ++  V+ + I++S  F  +T L +  D + V     ++ E   
Sbjct: 75  HKERDGSILPLFGILIMLLLAVVTIGIDMSQTFGERTRLQTAADMAAVQTGRALLAEEIT 134

Query: 72  NNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSISA 131
             +      D   RI +  + S   +      +     +  +  +   V      Y +  
Sbjct: 135 IAQANAYAKDAFNRIASGLSAS--GDGSSGTSIFGTMTVKPAVQITETVDGNTTNYVVKV 192

Query: 132 ISRYKIPLKFCTFIP--WYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFD 189
               KIP    +F+     T    I +   S     ++  A L M +VLD S SM     
Sbjct: 193 NGTAKIPASPLSFMFFDGETGKNTISLGFESETTAKAEAGASLSMALVLDRSGSMGWE-- 250

Query: 190 SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKY 249
              +++    K++ ++++E++ +   +   + G   +         L W  + ++  +  
Sbjct: 251 -RPSRMSELKKAVRSLIKELQTVDPDDQFTRLGAYAYHWYYAGKKELTWNKNSVRSWVNS 309

Query: 250 LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSL 309
           L   G  T + P ++ A N +     +  H N  +      I++MTDG +    +   + 
Sbjct: 310 LPASG-GTRAAPAIQKAKNDLLTNSELNAHINKNEQEPDLFILYMTDGID---GDPNWAK 365

Query: 310 YYCNEAKKRGAIVYAIGIRVIR-SHEFLRACASPN-SFYLVENPHSMYDAFSHIGKDIVT 367
             C  AK  G  +Y +  +        L+ACA+ +  +Y  +N + +   F  I ++  T
Sbjct: 366 RECTSAKNAGITIYTVAFKAPASGRNLLKACATSDAHYYDAKNANELNKVFKDIARE-TT 424

Query: 368 KRIWY 372
           K I +
Sbjct: 425 KSIPF 429


>gi|150397936|ref|YP_001328403.1| von Willebrand factor type A [Sinorhizobium medicae WSM419]
 gi|150029451|gb|ABR61568.1| von Willebrand factor type A [Sinorhizobium medicae WSM419]
          Length = 419

 Score =  175 bits (444), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 78/403 (19%), Positives = 151/403 (37%), Gaps = 46/403 (11%)

Query: 6   LNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQI 65
           L+      +  G   ++TA+  P++  V G+ ++V+++   K  L    D + + AA+ +
Sbjct: 9   LSFMRMLRDRGGNFGMMTALVAPLLLAVGGVSVDVANMLMTKNQLQDATDAAALAAASAL 68

Query: 66  MNEG--NGNNRKKLKGGDILCRIKNTWNMSFRNELRDNG-----------FVNDIDDIVR 112
           +++   +    K L    +  +          +E    G                 + V 
Sbjct: 69  VSDARPDIEEAKDLARKFLKTQAAAATASDLPDEGPSIGARGGGNADDEVPATPRWEDVN 128

Query: 113 STSLDIVVVPQN-EGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDAR 171
           +T +DI   P   +G S       K  L+F   +        I +   S+ +  +++   
Sbjct: 129 ATEIDITATPNGAKGKSFQVTVANKHLLQF-NAMTRLLGPESIEIETRSTAESATESKNA 187

Query: 172 LDMMIVLDVSRSMES----------------------------FFDSSITKIDMAIKSIN 203
           L M +VLD S SM                                   +TKID    ++ 
Sbjct: 188 LSMYLVLDRSGSMAWKTNTINTGKAKCPNYTEANWSKYPDLKATGPCYVTKIDALKTAVG 247

Query: 204 AMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGL 263
            +L ++      +  V++G +++++  +    L WG       +  L   G  T S    
Sbjct: 248 DLLAQLVTADPESAYVRTGAISYNSAQDAASSLSWGTRGAAGYVDALVAIG-GTASGNAF 306

Query: 264 KYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVY 323
           K A+ ++ +     +H         K IVFMTDGEN    +D  +  +C+ AK     +Y
Sbjct: 307 KTAFQKVTNAAEDSEHGAKNGQVPTKYIVFMTDGENNHANDDTVTRQWCDTAKASKVQIY 366

Query: 324 AIGIRVIR-SHEFLRACA-SPNSFYLVENPHSMYDAFSHIGKD 364
           ++         + L++CA S + ++  E    +  AF  IG+ 
Sbjct: 367 SVAFMAPDRGQKLLKSCASSSSHYFEAEEASDLVAAFKAIGER 409


>gi|315122347|ref|YP_004062836.1| hypothetical protein CKC_02995 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495749|gb|ADR52348.1| hypothetical protein CKC_02995 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 362

 Score =  170 bits (430), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 116/374 (31%), Positives = 211/374 (56%), Gaps = 20/374 (5%)

Query: 6   LNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQI 65
           + IRNFF N +G +TI +AI  P+I +++ ++ E+S+I+  K  L ++IDR+L+   T I
Sbjct: 4   IKIRNFFQNKRGIITITSAIIFPLIIILMAIVFEMSNIYLEKERLQAVIDRALLDTVTMI 63

Query: 66  MNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNE 125
             +   +  K +        +   W  + + EL  + F +D+ +++  TS+ +      +
Sbjct: 64  KLKNIEDVVKNVG------PVNTIWTKNLKYELEHSDFSSDVQNVIDDTSMKLESDSNFK 117

Query: 126 GYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSME 185
             SI+AIS+YK+P K C        ++++ +P+ SS+K+     + +D+MIVLDVS SM+
Sbjct: 118 TLSITAISQYKMPFKICNIHLLCPKNKYVTVPVLSSMKIGRNEGSDIDLMIVLDVSSSMD 177

Query: 186 SFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVS 241
             F        +++++A KSI  MLE+ + +P+  NV ++G V F++ ++    L+ G+ 
Sbjct: 178 DNFMKPEEAPCSRLEVAKKSIRKMLEDFRKVPNYANVFRTGSVGFNDMVQFPMPLKRGLK 237

Query: 242 HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLS 301
            +   IK    FG STNS  G+KYA+ Q++              + KKI++F+TDGEN+ 
Sbjct: 238 RIYNDIKKYRAFG-STNSYVGMKYAWEQLYGNPQDT-------KDRKKIVIFLTDGENMI 289

Query: 302 TKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHI 361
               ++++  CN+ KK+ A++Y+I + V  + E L+ C+S  + Y  ++  S+  A+S I
Sbjct: 290 INATRKTIELCNDMKKKKAVIYSIALAVD-NKEVLQGCSSSGNVYAADDAQSLVQAYSLI 348

Query: 362 GKD-IVTKRIWYDK 374
           GKD +  + I Y +
Sbjct: 349 GKDVMKDEYIKYVR 362


>gi|241206334|ref|YP_002977430.1| hypothetical protein Rleg_3648 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860224|gb|ACS57891.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 400

 Score =  167 bits (422), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 80/399 (20%), Positives = 144/399 (36%), Gaps = 53/399 (13%)

Query: 8   IRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMN 67
           +R    +  G   I+TAI LP++F   GM I+V  +   K  L             +  +
Sbjct: 11  LRRMLGDRGGNFGIMTAIVLPVLFGAAGMAIQVGDLLLSKQQLQ------------EAAD 58

Query: 68  EGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRS-TSLDIVVVPQNEG 126
                    L  G I       +   F      N   + ID    +   +      ++  
Sbjct: 59  SAALATATALANGTIQTSQAEAFARDFVAGQMANYLQSGIDIKSTTGVDVRTTTSGKSTS 118

Query: 127 YSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSM-- 184
           Y ++    Y I +        +T         T+S    +Q    + M +VLD S SM  
Sbjct: 119 YQVTVSPDYNIAVNPLMQTIGFTTQNISTSSTTTSGNSQTQ--GSVSMFLVLDRSGSMGE 176

Query: 185 ---------------------------------ESFFDSSITKIDMAIKSINAMLEEVKL 211
                                                    TKI+    ++  +  E+  
Sbjct: 177 DTATVNASDPTEEYNYDCSEKDRYGNVTKKKTCTDTRPHYYTKIEALKLAVGTLTGELDA 236

Query: 212 IPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIF 271
           +      V++G V+++ ++++   L+WG +H+ + +  L+     T+S    K AYN++ 
Sbjct: 237 VDPEKEYVRTGAVSYNIEMQKAKALDWGTAHVTKYVNKLTAT-DGTDSGEAFKTAYNKLA 295

Query: 272 DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR 331
           D    + H +       K IVFMTDG+N  T  D ++  +C++A+     VY I      
Sbjct: 296 DAAEDKAHVDKTGQVPTKYIVFMTDGDNNYTSADTETKTWCDKARDAKMQVYTIAFMAPA 355

Query: 332 -SHEFLRACAS-PNSFYLVENPHSMYDAFSHIGKDIVTK 368
                L  CA+ P +++   +  ++  AF  IG     +
Sbjct: 356 RGQALLSYCATAPGNYFPAGDMTALLKAFKEIGMKASNQ 394


>gi|327189644|gb|EGE56794.1| hypothetical protein RHECNPAF_570041 [Rhizobium etli CNPAF512]
          Length = 415

 Score =  165 bits (418), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 75/413 (18%), Positives = 129/413 (31%), Gaps = 65/413 (15%)

Query: 8   IRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMN 67
           +R  F +  G   I+TAI  P++    G+ I+V  +   K  L             +  +
Sbjct: 10  LRRMFSDRGGNFGIMTAILAPVLLGAAGLAIQVGDMLLSKQQLQ------------EAAD 57

Query: 68  EGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRS-TSLDIVVVPQNEG 126
                    L  G I       +  +F      N   N +D    +  ++      ++  
Sbjct: 58  SAALATATALGNGTIQTSQAEAFARNFVAGQMANYLQNGVDIKNATAVNVQTSNSGKSAS 117

Query: 127 YSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQ---TDARLDMMIVLDVSRS 183
           Y ++    Y + +        ++         T S    +    +   + M + LD S S
Sbjct: 118 YQVTVTPSYDLTVNPLMQAVGFSTQHLSTSSTTVSGPSQTPGSNSQGSVSMFLALDKSGS 177

Query: 184 M-----------------------------------ESFFDSSITKIDMAIKSINAMLEE 208
           M                                        +  TKI+    +   +  +
Sbjct: 178 MGDPTETVNKDQPTETFTYDCNPHLNKKGKWVYDTCTGSRTNYYTKIEALKMAAGNLFGQ 237

Query: 209 VKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAY- 267
           +         V++G V++         L WG S +   +  L   G  TNS+  +  AY 
Sbjct: 238 LTSADPDAQYVRTGAVSYDIDQYTPSTLAWGTSGVSSYVNALQA-GGGTNSSGAMGTAYS 296

Query: 268 -----NQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKE-----DQQSLYYCNEAKK 317
                N   +      H        KK IVFMTDG+N +        D  +   C+ AK 
Sbjct: 297 SLTAKNAAGNDAEDAAHKLKTGQIPKKYIVFMTDGDNNNDSSGGRSYDTLTKATCDTAKS 356

Query: 318 RGAIVYAIGIR-VIRSHEFLRACASP-NSFYLVENPHSMYDAFSHIGKDIVTK 368
           +G  +Y I           L+ CAS    ++  E    +  AF  IG     +
Sbjct: 357 KGIEIYTIAFMAPPGGQALLQYCASDAAHYFQAEQMEDLLAAFKAIGAKASAQ 409


>gi|190893432|ref|YP_001979974.1| hypothetical protein RHECIAT_CH0003859 [Rhizobium etli CIAT 652]
 gi|190698711|gb|ACE92796.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 410

 Score =  165 bits (417), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 76/410 (18%), Positives = 127/410 (30%), Gaps = 64/410 (15%)

Query: 8   IRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMN 67
           +R  F +  G   I+TAI  P++    GM I+V  +   K  L             +  +
Sbjct: 10  LRRMFSDRGGNFGIMTAILAPVLLGAAGMAIQVGDMLISKQQLQ------------EAAD 57

Query: 68  EGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRS-TSLDIVVVPQNEG 126
                    L  G I       +  +F      N   + +D    +  ++       +  
Sbjct: 58  SAALATATALANGTIQTSQAEAFARNFVAGQMANYLQSGVDIKSATGVTVQTNTSGNSTS 117

Query: 127 YSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSM-- 184
           Y ++    Y + +        +T         T      +Q    + M + LD S SM  
Sbjct: 118 YQVTVSPSYDLTVNPLMQAVGFTTQHLSTSGTTIGGHSQTQ--GSISMYLALDKSGSMGE 175

Query: 185 ---------------------------------ESFFDSSITKIDMAIKSINAMLEEVKL 211
                                                 +  TKI+    +   +  ++  
Sbjct: 176 DTATVNEEDPTESYTYDCNGHYNKKGKWIYDTCTGSRANYYTKIEALKMAAGNLFGQLSS 235

Query: 212 IPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAY---- 267
                  V++G V++         L WG S +   +  L   G  TNS+  +  AY    
Sbjct: 236 ADPNAQYVRTGAVSYDIVQYTPSALAWGTSGVSTYVNALQA-GGGTNSSGAMSTAYSSLT 294

Query: 268 --NQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKE-----DQQSLYYCNEAKKRGA 320
             N   +      H        KK IVFMTDG+N          D  +   C+ AK +G 
Sbjct: 295 AKNAAGNDAEDAAHKLKTGQTPKKYIVFMTDGDNNDDSSGGRSYDTLTKATCDTAKSKGI 354

Query: 321 IVYAIGIRVIR-SHEFLRACASPN-SFYLVENPHSMYDAFSHIGKDIVTK 368
            +Y I           L  CAS +  ++  E    +  AF  IG    ++
Sbjct: 355 EIYTIAFMAPEGGQALLHYCASDDSHYFQAEKMEDLLAAFKAIGAKASSQ 404


>gi|209550922|ref|YP_002282839.1| von Willebrand factor type A [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209536678|gb|ACI56613.1| von Willebrand factor type A [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 411

 Score =  162 bits (410), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 75/415 (18%), Positives = 128/415 (30%), Gaps = 65/415 (15%)

Query: 4   LNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAAT 63
           L   +R  F +  G   I+TAI  P++  V G+ I+V  +   K  L             
Sbjct: 6   LYPRLRRMFSDRGGNFGIMTAIMAPVLLGVAGVAIQVGDMMLSKQQLQ------------ 53

Query: 64  QIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRS-TSLDIVVVP 122
           +  +         L  G I       +  +F      N   + +D    +  ++      
Sbjct: 54  EAADSAALATATALANGTIQTSQAEAFAQNFVAGQMANYVQSGVDFKSGTSVNVQTSTSG 113

Query: 123 QNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSR 182
           ++  Y ++    Y + +        +          T      +Q    + M + LD S 
Sbjct: 114 KSTSYQVTVSPSYDLTVNPLMQAVGFKTQHLSTSGTTVGGHSQTQ--GSISMFLALDKSG 171

Query: 183 SM------------------------------------ESFFDSSITKIDMAIKSINAML 206
           SM                                         +  TKI+    +   + 
Sbjct: 172 SMGEATATVNADDPTESYTYDCNLHYNSKNNKWVYDKCTGSRTNYYTKIEALKIAAGNLF 231

Query: 207 EEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYA 266
            ++         V++G V++         L WG + +   +  L   G  TNS+  +  A
Sbjct: 232 GQLNSADPNAEYVRTGAVSYDINQYTPSNLAWGTAGVTSYVNALQANG-GTNSSGAMSTA 290

Query: 267 Y------NQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKE-----DQQSLYYCNEA 315
           Y      N   +      H        KK IVFMTDG+N          D  +   C+ A
Sbjct: 291 YSSLTAKNAAGNDAEDSAHKLKTGQTPKKYIVFMTDGDNNDDSSGGRSYDTLTKATCDTA 350

Query: 316 KKRGAIVYAIGIRVIR-SHEFLRACASPN-SFYLVENPHSMYDAFSHIGKDIVTK 368
           K +G  +Y I           L  CAS +  ++  E    +  AF  IG     +
Sbjct: 351 KSKGIEIYTIAFMAPAGGQTLLHYCASDDSHYFQAEKMEDLLAAFKAIGAKASAQ 405


>gi|86359182|ref|YP_471074.1| hypothetical protein RHE_CH03592 [Rhizobium etli CFN 42]
 gi|86283284|gb|ABC92347.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 411

 Score =  161 bits (406), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 75/411 (18%), Positives = 128/411 (31%), Gaps = 65/411 (15%)

Query: 8   IRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMN 67
           +R  F +  G   I+TAI  P++    GM I+V  +   K  L             +  +
Sbjct: 10  LRRMFSDRGGNFGIMTAILAPVLLGAAGMAIQVGDMLLSKQQLQ------------EAAD 57

Query: 68  EGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDID-DIVRSTSLDIVVVPQNEG 126
                    L  G I       +  +F      N   +  D     S ++      ++  
Sbjct: 58  SAALATATALANGTIQTTEAEAFARNFVAGQMANYLQSGTDIKSTTSVNVQTTTSGKSTS 117

Query: 127 YSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSM-- 184
           Y ++    Y + +        +T         T      +Q    + M + LD S SM  
Sbjct: 118 YQVTVSPAYVLTVNPLMQAVGFTTQHLSTSGTTIGGHSQTQ--GSISMFLALDKSGSMGE 175

Query: 185 ----------------------------------ESFFDSSITKIDMAIKSINAMLEEVK 210
                                                  +  TKI+    +   +  ++ 
Sbjct: 176 DTATVNEESPTESYTYDCNLHYNTKNNKWVYDKCTGSRTNYYTKIEALKMAAGNLFSQLN 235

Query: 211 LIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQI 270
                   V++G V++         L WG++ +   +  L   G  TNS+  +  AY  +
Sbjct: 236 SADPNAQYVRTGAVSYDINQYAPSSLAWGITGVSSYVNALQANG-GTNSSGAMNTAYTSL 294

Query: 271 FDMQ------GMRQHCNTEDANYKKIIVFMTDGENLSTKE-----DQQSLYYCNEAKKRG 319
                         H        KK IVFMTDG+N +        D  +   C++AK +G
Sbjct: 295 TAKNAAGNDVENSAHQQKTGQVPKKYIVFMTDGDNNNDPSGGRSYDTATKKTCDDAKSKG 354

Query: 320 AIVYAIGIRVIR-SHEFLRACASPN-SFYLVENPHSMYDAFSHIGKDIVTK 368
             +Y I           L  CAS +  ++  E    +  AF  IG     +
Sbjct: 355 IEIYTIAFMAPAGGQALLHYCASDDSHYFQAEKMEDLLAAFQAIGAKASAQ 405


>gi|254781110|ref|YP_003065523.1| von Willebrand factor type A [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040787|gb|ACT57583.1| von Willebrand factor type A [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 420

 Score =  155 bits (391), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 81/404 (20%), Positives = 165/404 (40%), Gaps = 43/404 (10%)

Query: 8   IRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMN 67
            +    + K   +I+ A+ +    L++G +I V    + K  + S  + +++  A+++++
Sbjct: 11  FKKGIASEKANFSIIFALSVMSFLLLIGFLIYVLDWHYKKNSMESANNAAILAGASKMVS 70

Query: 68  ---------EGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDI 118
                    E   N+ K+    D    IKN    S         +  +I +IV S+ + +
Sbjct: 71  NLSRLGDRFESISNHAKRALIDDAKRFIKNHIKESLSGY-SAVFYNTEIQNIVNSSRISM 129

Query: 119 V--------VVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDA 170
                           Y++  ++ Y   L+F   +     ++ IV  I + +++      
Sbjct: 130 THMANNRLDSSNNTIFYNMDVMTSYDYRLQFIEHLLNQRYNQKIVSFIPALLRIEMGERP 189

Query: 171 RLDMMIVLDVSRSMESFFDSSIT--------------KIDMAIKSINAMLEEVKLIPDVN 216
              + +V+D+S SM    +S                 K+     ++   L+ + L+  V 
Sbjct: 190 IFLIELVVDLSGSMHCAMNSDPEDVNSAPICQDKKRTKMAALKNALLLFLDSIDLLSHVK 249

Query: 217 NVVQSGLVTFSNKIEEFFLLEWGVSHLQRKI--KYLSKFGVSTNSTPGLKYAYN------ 268
             V  GL+ ++ ++E+     WG   +++ +     S     T+STP +K AY       
Sbjct: 250 EDVYMGLIGYTTRVEKNIEPSWGTEKVRQYVTRDMDSLILKPTDSTPAMKQAYQILTSDK 309

Query: 269 -QIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGI 327
            + F     RQ        ++K I+F+TDGEN + K +  ++  C++AK+    +  I I
Sbjct: 310 KRSFFTNFFRQGVKIPSLPFQKFIIFLTDGENNNFKSNVNTIKICDKAKENFIKIVTISI 369

Query: 328 R-VIRSHEFLRAC-ASPNSFYLVENPHSMYDAFSHIGKDIVTKR 369
                    L+ C +SP   Y V N  S+   F +I + +V ++
Sbjct: 370 NASPNGQRLLKTCVSSPEYHYNVVNADSLIHVFQNISQLMVHRK 413


>gi|15966595|ref|NP_386948.1| hypothetical protein SMc04059 [Sinorhizobium meliloti 1021]
 gi|307300370|ref|ZP_07580150.1| TadE family protein [Sinorhizobium meliloti BL225C]
 gi|307319653|ref|ZP_07599079.1| TadE family protein [Sinorhizobium meliloti AK83]
 gi|15075867|emb|CAC47421.1| Hypothetical protein SMc04059 [Sinorhizobium meliloti 1021]
 gi|306894775|gb|EFN25535.1| TadE family protein [Sinorhizobium meliloti AK83]
 gi|306904536|gb|EFN35120.1| TadE family protein [Sinorhizobium meliloti BL225C]
          Length = 410

 Score =  153 bits (387), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 73/402 (18%), Positives = 140/402 (34%), Gaps = 48/402 (11%)

Query: 9   RNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMID-------RSLVHA 61
                +  G   ++TA+  P++  V G+ ++V+++   K  L    D        +LV  
Sbjct: 1   MAMLRDRGGNFGMMTALIAPLLLAVGGVSVDVANMLMTKNQLQDATDAAALAAASALVSD 60

Query: 62  ATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVV 121
           A   + E     RK LK         +    +              DD+  S  + +   
Sbjct: 61  ARPDIEEAKAIARKFLKTQMAATSSADVPGEAVGTMAAAGSTAPSWDDVNTSEVVIVETP 120

Query: 122 PQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVS 181
              +G S       K  L+F   +        I +   S+    +++   + M +VLD S
Sbjct: 121 NGTKGKSFQVSVANKHLLQF-NAMTRLLGKESIELETRSTADSATESKNAISMYLVLDRS 179

Query: 182 RSMES---------------------------FFDSSITKIDMAIKSINAMLEEVKLIPD 214
            SM                                  + KI     +++ +   +  +  
Sbjct: 180 GSMAWKTDTVDTSRPRCINWTASNWGESNVRATSPCYVDKITTLKSAVDKLFTPLAKMDP 239

Query: 215 VNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQ 274
            N  +++G  +++++ +    L WG  +    ++ L   G  T+S+     A  ++    
Sbjct: 240 GNEYLRAGAASYNDRQDRASKLTWGTKNASAHVQGLDATG-GTDSSSAFAAAVEELLLDG 298

Query: 275 GMRQHCNTEDANYKKIIVFMTDGENLSTK----------EDQQSLYYCNEAKKRGAIVYA 324
               H        +K IVFMTDGEN S             D  +   C  AK  G  ++ 
Sbjct: 299 ENEAHLAKNGQTPEKYIVFMTDGENTSYNGKTSPRDLEKADSVTKAACTTAKNNGIAIFT 358

Query: 325 IGIRVI-RSHEFLRACAS-PNSFYLVENPHSMYDAFSHIGKD 364
           +      R  + L+ACA+ P+ +   ++  ++   F  IG+ 
Sbjct: 359 VAFMAPQRGKDLLKACATSPDHYKEADDAAALVSEFEKIGQK 400


>gi|87311197|ref|ZP_01093320.1| hypothetical protein DSM3645_16250 [Blastopirellula marina DSM
           3645]
 gi|87286105|gb|EAQ78016.1| hypothetical protein DSM3645_16250 [Blastopirellula marina DSM
           3645]
          Length = 373

 Score =  153 bits (385), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 54/386 (13%), Positives = 115/386 (29%), Gaps = 34/386 (8%)

Query: 1   MFSLNLNI-RNFFY--NYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRS 57
           M +++  + R        +G + IL A+ LP+I  +    ++V+++   +T L    D +
Sbjct: 1   MMAMSKPLNRKLGRISRRRGAVLILIAVLLPVILWMAAFCVDVAYMQLTRTELRIATDSA 60

Query: 58  LVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLD 117
               A  +  E + +   K               ++  +     G     DD+ R T   
Sbjct: 61  ARAGARTLSLEQDASLAHKSAIEYAAKNNVAGNTLTLADSDVQIGLSVRTDDVGRFTFSS 120

Query: 118 IVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIV 177
              +        S     +   +          +          V   + +    D+ +V
Sbjct: 121 GGKLLN------SVNVTGRRTQQAPDGAVRLYLTPIFGHEFFQPVADATASQIDRDIALV 174

Query: 178 LDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV-----------QSGLVTF 226
           +D S SM    + +  +                 + D  +                L T+
Sbjct: 175 VDRSGSMTFRINRNSYESGWRNNDPVPSRARWWALVDSVDGFLTELGSTPQLELVSLSTY 234

Query: 227 SNKIEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
           ++  +    L    S ++  +          STN T G+    + +       Q+     
Sbjct: 235 NSSAKIDEQLTDKYSRIEDALDDYSRRYPDGSTNITAGMDRGISTL-------QNKKYAR 287

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA--SP 342
               K +V MTDG +              +A     +V+ I      +   +R  A    
Sbjct: 288 PYASKTMVVMTDGNHNYGSSPTN---AAYDAASDDIVVHTITYSDGANQSLMREVARIGG 344

Query: 343 NSFYLVENPHSMYDAFSHIGKDIVTK 368
              +   +   + + F  I ++  T 
Sbjct: 345 GQHWHAPDGDELEEIFREIARNAPTL 370


>gi|218662625|ref|ZP_03518555.1| hypothetical protein RetlI_26027 [Rhizobium etli IE4771]
          Length = 389

 Score =  146 bits (369), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 71/396 (17%), Positives = 120/396 (30%), Gaps = 63/396 (15%)

Query: 23  TAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDI 82
           TAI  P++    GM + V  +   K  L             +  +         L  G I
Sbjct: 1   TAILAPVLLGAAGMAVHVGDMLLSKQQLQ------------EAADSAALATATALANGKI 48

Query: 83  LCRIKNTWNMSFRNELRDNGFVNDIDDIVRS-TSLDIVVVPQNEGYSISAISRYKIPLKF 141
                  +  +F      N   + +D    +  S+       +  Y ++    Y + +  
Sbjct: 49  QTSEAEAYARNFVAGQMANYLQSGVDIKSATGVSVQTNTSGNSTSYQVTVSPSYDLTVNP 108

Query: 142 CTFIPWYTNSRHIVMPIT-SSVKVNSQTDARLDMMIVLDVSRSM---------------- 184
                 +T         T       +Q    + M + LD S SM                
Sbjct: 109 LMQAVGFTTQHLSTSGTTIGGGHSQTQGQGSISMYLALDKSGSMGEDTATVNEEDPTESY 168

Query: 185 -------------------ESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVT 225
                                   +  TKI+    +   +  ++         V++G V+
Sbjct: 169 TYPCNPHYNRKGKEVWDTCTGSRANYYTKIEALKMAAGNLFAQLSGADPNAQYVRTGAVS 228

Query: 226 FSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAY------NQIFDMQGMRQH 279
           +         L WG   +   +  L   G  TNS+  +  AY      N   +      H
Sbjct: 229 YDIVQYAPSSLAWGAIGVSSYVNALQA-GGGTNSSGAMSTAYLSLTAKNAAGNDAEDSAH 287

Query: 280 CNTEDANYKKIIVFMTDGENLSTKE-----DQQSLYYCNEAKKRGAIVYAIGIR-VIRSH 333
                   +K IVFMTDG+N +        D  +   C+ AK +G  +Y I         
Sbjct: 288 KLKSGQIPQKYIVFMTDGDNNNDSSGGRSYDTLTKATCDTAKSKGIEIYTIAFMAPPGGQ 347

Query: 334 EFLRACASPN-SFYLVENPHSMYDAFSHIGKDIVTK 368
             L+ CAS    ++  E    ++ AF  IG    T+
Sbjct: 348 ALLQYCASDASHYFQAEKMEDLFAAFKAIGAKASTQ 383


>gi|227823417|ref|YP_002827390.1| hypothetical protein NGR_c28930 [Sinorhizobium fredii NGR234]
 gi|227342419|gb|ACP26637.1| hypothetical protein NGR_c28930 [Sinorhizobium fredii NGR234]
          Length = 413

 Score =  146 bits (368), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 72/404 (17%), Positives = 145/404 (35%), Gaps = 41/404 (10%)

Query: 1   MFSLNLNIRNFF---YNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRS 57
           M   ++  R+F     +  G   ++TA+  P++    G+ I+++++   K  L    D +
Sbjct: 1   MRRRSMIGRSFITMLKDRGGNFGMMTAVAAPLLLAAGGVSIDMANMLMTKNQLQDATDAA 60

Query: 58  LVHAATQIMNEGNGNNRKKL-------KGGDILCRIKNTWNMSFRNELRDNGFVNDIDDI 110
            + AA+ ++++   +            K         +    S               D 
Sbjct: 61  ALAAASALVSDEQPDIAAAKEIARKFLKTQAGGTTTPDAPADSGEGASSGAASSTPDWDD 120

Query: 111 VRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDA 170
           V +  ++I   P      I  ++     +     +     +  I +  +S+ +  +++  
Sbjct: 121 VNTLEVNITETPNGTKGKIFQVTVINKRVTEFNAMTRLLGTDSIELEASSTAESATESKN 180

Query: 171 RLDMMIVLDVSRSM----------------------------ESFFDSSITKIDMAIKSI 202
            L M +VLD S SM                             +     +TKID    ++
Sbjct: 181 ALSMYLVLDRSGSMAWKTNTINAAKKSCPNYTESNWSRYPNLWASSPCYVTKIDALKTAV 240

Query: 203 NAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPG 262
             +L ++ +       V++  +++++  +    L WG S     +  L   G  T S   
Sbjct: 241 TDLLAQLLVADPDQIYVRTAAISYNSVQDTAGTLAWGTSGAAAYVNALVATG-GTASAGA 299

Query: 263 LKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIV 322
            K AY ++        H         K +VFMTDGEN    +D  +  +C+ AK     +
Sbjct: 300 FKTAYQKVIAATENTAHAAKNGQVPSKYMVFMTDGENNYANDDTVTKQWCDTAKANKVEI 359

Query: 323 YAIGIRVIR-SHEFLRACA-SPNSFYLVENPHSMYDAFSHIGKD 364
           Y++           L+ CA S + ++  E    +  AF  IG+ 
Sbjct: 360 YSVAFMAPERGQALLKYCASSSSHYFEAEEVTDLVAAFKAIGER 403


>gi|15891094|ref|NP_356766.1| hypothetical protein Atu3868 [Agrobacterium tumefaciens str. C58]
 gi|15159433|gb|AAK89551.1| hypothetical protein Atu3868 [Agrobacterium tumefaciens str. C58]
          Length = 412

 Score =  141 bits (354), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 64/402 (15%), Positives = 141/402 (35%), Gaps = 56/402 (13%)

Query: 9   RNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNE 68
           R F  +  G   ++TAI LP++  V G  +E++++  +K  + +                
Sbjct: 11  RRFLADTSGNFGMMTAILLPVLLGVAGAGMELANVMQVKADMQN---------TADSAAL 61

Query: 69  GNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYS 128
                 +  +G     +IK         ++  N    +  ++ +++   +       G +
Sbjct: 62  AAATEARLREGKLSDEQIKEIAKNFIAAQMEKNLTAEEKIELEKNSPTRVTTTENARGKT 121

Query: 129 ISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSME--- 185
            +  +  K  ++    +  +  ++ + + +T + K      A + M + LD S SM    
Sbjct: 122 YAVETTIKHQIQ-LNPMLGFIGAKTLDLSVTGTAKSTINKGAPISMYLALDRSGSMSFKT 180

Query: 186 -------------------------SFFDSSITKIDMAIKSINAMLEEVKLIPDV----- 215
                                          + K      ++  ++  +           
Sbjct: 181 DTVDTTKTSCQNYTSDNWSKYPNLAKTSPCYVNKAASLKTAVGFLVATLNKADPTYTVNG 240

Query: 216 -NNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSK--FGVSTNSTPGLKYAYNQI-- 270
            + +V++G   ++++      + WG S +   +           T++   L  AYN +  
Sbjct: 241 GSELVRTGASVYTHETYVAQSIGWGTSGVTSYVDKQIPEFPSGGTDARSSLNAAYNALKK 300

Query: 271 FDMQGMRQHCNTEDANYKKIIVFMTDGENL------STKEDQQSLYYCNEAKKRGAIVYA 324
            +    R H      ++++ IV MTDGE        ++  DQ     C  AKK G  +++
Sbjct: 301 ANPDEARYHKEKGSESFERYIVLMTDGEMTGNSAAWNSSIDQSVRTTCETAKKDGIKIFS 360

Query: 325 IGIRVIR-SHEFLRACASP-NSFYLVENPHSMYDAFSHIGKD 364
           +           L+ CAS  +++Y  EN   +  AF  I + 
Sbjct: 361 VAFMAPDKGKSLLQYCASSADNYYAPENMEQIVTAFGEIARK 402


>gi|254780388|ref|YP_003064801.1| hypothetical protein CLIBASIA_01365 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040065|gb|ACT56861.1| hypothetical protein CLIBASIA_01365 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 458

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 90/449 (20%), Positives = 164/449 (36%), Gaps = 85/449 (18%)

Query: 9   RNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNE 68
           +    +  G   I+TA+ +P++  V GM+++V    + +  L      +++ A+  ++  
Sbjct: 12  KKLIKSCTGHFFIITALLMPVMLGVGGMLVDVVRWSYYEHALKQAAQTAIITASVPLIQS 71

Query: 69  -GNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGY 127
               ++R K        +I+     +F N L+ N    ++ DIVR T++++         
Sbjct: 72  LEEVSSRAKNSFTFPKQKIEEYLIRNFENNLKKNFTDREVRDIVRDTAVEMNPRKSAYQV 131

Query: 128 SISA------------------------------ISRYKIPLKFCTFIPWYTNSRH---- 153
            +S+                                      +    I W  +       
Sbjct: 132 VLSSRYDLLLNPLSLFLRSMGIKSWLIQTKAEAETVSRSYHKEHGVSIQWVIDFSRSMLD 191

Query: 154 ------------IVMPITSSVKVNSQTDAR-------LDMMIV--------------LDV 180
                          P   +VK  S  + +       L   +V              LD 
Sbjct: 192 YQRDSEGQPLNCFGQPADRTVKSYSSQNGKVGIRDEKLSPYMVSCNKSLYYMLYPGPLDP 251

Query: 181 SRS-----MESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFL 235
           S S       S     I K  +   ++ +++  +K I +VN+ V+ G   F++++     
Sbjct: 252 SLSEEHFVDSSSLRHVIKKKHLVRDALASVIRSIKKIDNVNDTVRMGATFFNDRVISDPS 311

Query: 236 LEWGVSHLQRKIKYLSK----FGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKII 291
             WGV  L R I            ST     ++ AY+ I        H    +   KK I
Sbjct: 312 FSWGVHKLIRTIVKTFAIDENEMGSTAINDAMQTAYDTIISSNEDEVHRMKNNLEAKKYI 371

Query: 292 VFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHE-----FLRACASPNSFY 346
           V +TDGEN   +++++ +  CN+AK +G  +  I   V ++ +     FL  CASPNSF+
Sbjct: 372 VLLTDGENT--QDNEEGIAICNKAKSQGIRIMTIAFSVNKTQQEKARYFLSNCASPNSFF 429

Query: 347 LVENPHSMYDAF-SHIGKDIVTKRIWYDK 374
              + H +   F   IG +I  + I   K
Sbjct: 430 EANSTHELNKIFRDRIGNEIFERVIRITK 458


>gi|254781108|ref|YP_003065521.1| von Willebrand factor type A [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040785|gb|ACT57581.1| von Willebrand factor type A [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 398

 Score =  138 bits (346), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 70/400 (17%), Positives = 153/400 (38%), Gaps = 59/400 (14%)

Query: 22  LTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGD 81
           +TAI + + FL +   I+++HI +++  + S +D +++     I+++    +    K   
Sbjct: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60

Query: 82  ILCRIKNTWNMSFRNELRDNGFVND-IDDIVRSTSLDIVVVPQNE-GYSISAISRYKIPL 139
                   +    +  L+   ++ +   DI +   ++I     N   Y   + ++Y+IP 
Sbjct: 61  ST-----IFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPT 115

Query: 140 KFCTFIPWYTNSRHIVMPITSSVKV-NSQTDARLDMMIVLDVSRSMESFFDSSIT----- 193
           +   F+     S    + + S+  +  S  +  + + +VLDVSRSME  +          
Sbjct: 116 ENL-FLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNM 174

Query: 194 ----------------------------------KIDMAIKSINAMLEEVKLIPDVNNVV 219
                                             KID+ I+S   ++  ++        +
Sbjct: 175 TSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNL 234

Query: 220 QSGLVTFSNKIEEFFLLE----WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQG 275
              + T +  I             ++ ++ ++  L+ +  +TN+ P + +AY +    + 
Sbjct: 235 SVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPY-ENTNTYPAMHHAY-RELYNEK 292

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSL---YYCNEAKKRGAIVYAIGIRVI-R 331
              H        KK ++F+TDGEN      Q +L     C   +  G  +Y++ +     
Sbjct: 293 ESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPE 352

Query: 332 SHEFLRACA-SPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
             + LR C  S   F+ V +   + ++F  I   I  + +
Sbjct: 353 GQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392


>gi|315122473|ref|YP_004062962.1| von Willebrand factor type A [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495875|gb|ADR52474.1| von Willebrand factor type A [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 403

 Score =  136 bits (343), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 73/395 (18%), Positives = 151/395 (38%), Gaps = 39/395 (9%)

Query: 8   IRN---FFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQ 64
           +R    F  N  G   I++A  + +  + +  +I+++H+  MK  + S +D +++   + 
Sbjct: 10  LRRIYFFSKNKSGVFHIMSASIIFVCLIFVSFVIDITHLLHMKNHIQSSLDNAIISGCSI 69

Query: 65  IMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQN 124
           ++++   N+    +      RI++    +    +  N        I+ + ++        
Sbjct: 70  VVSDPKINDLNPQEE-----RIRDVIKKNAYVNMVQNFPAEHAAYIIENANISFSKDL-T 123

Query: 125 EGYSISAISRYKIPLKFCTFIPWYTNSRHIV--MPITSSVKVNSQTDARLDMMIVLDVSR 182
             Y        K  L    FI  +     I     I++ +           + +VLD S 
Sbjct: 124 NKYEYKITMEAKHQLSGKNFILGFLMPNVITHISSISTGIIQKPSDKKAFSVEMVLDCSG 183

Query: 183 SMES--------------------FFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV--Q 220
           SM                        +   +KI     + +  +  ++        +  +
Sbjct: 184 SMLDSMQESCDLSSGRGGYYFYSKNNNKPKSKIYALKTASSDFVNLIQETVQTFPQISAR 243

Query: 221 SGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHC 280
            GL+TF++ I +   L    + +++ I  +   G  T++   +  AY  + ++    +  
Sbjct: 244 IGLITFNHYIMQDSKLSNNFNVIKKTISRMKPKG-GTDTFLPMNAAYEYLNNIPNETKAH 302

Query: 281 NTEDANY-KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAI---GIRVIRSHEFL 336
           N  D    K+ I+ MTDGEN     D +++  C+ A+K G I+Y+I          +E  
Sbjct: 303 NISDNVPLKRYIILMTDGENNHPSYDLKTINVCDNARKNGIIIYSIFLNYYEYTDGYELA 362

Query: 337 RACASPN-SFYLVENPHSMYDAFSHIGKDIVTKRI 370
           R CAS    F+   N  ++ D+F  I   I  K +
Sbjct: 363 RKCASSEKHFFYANNTKALLDSFKSIAHAIQDKAV 397


>gi|327190622|gb|EGE57710.1| hypothetical protein RHECNPAF_409007 [Rhizobium etli CNPAF512]
          Length = 427

 Score =  136 bits (343), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 59/418 (14%), Positives = 130/418 (31%), Gaps = 58/418 (13%)

Query: 11  FFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHS----------MIDRSLVH 60
           F  +  G   I+TA+ +  +    GM ++ +H   ++T L++                V 
Sbjct: 8   FISDRSGNFGIMTALLMVPLVGTAGMAVDFAHALSLRTQLYAAADAAAVGSIAEKSGAVA 67

Query: 61  AATQIMNEGNGNNRKKLKGGDILCRI----KNTWNMSFRNELRDNGFVNDIDDIVRSTSL 116
           AA  +   G  +  K       + ++             +  +    +N       +   
Sbjct: 68  AAMAMNGNGTISLGKTDARDIFMSQVSGELAEVHVDLGIDVTKTANKLNSQVSFTATVPT 127

Query: 117 DIVVVPQNEGYSISAISRYKIPL-KFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMM 175
             + +   +  +IS  +  +     F  F     N+  + +  T S     +        
Sbjct: 128 TFMRIFGRDSITISGTATAEYQTAAFMDFYILLDNTPSMGVGATPSDVSKLEAKVGCAFA 187

Query: 176 IV-LDVSRSME--SFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI-- 230
              +D S +    +       +ID+  ++  A+ +  K     ++  + G+ TF  K   
Sbjct: 188 CHQMDKSTNNYTIAKSLGVAMRIDVVRQATQALTDTAKTERVSSDQFRMGVYTFGTKAED 247

Query: 231 ---EEFFLLEWGVSHLQRKIKYLS----KFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
                   L   ++ ++     +      +    +       +     +         T 
Sbjct: 248 AKLTTISGLTSDLTKVKNYTDAVDLMTIPYQNYNSDQITNFDSAMTQMNTIIDLAGDGTS 307

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYY-------------CNEAKKRGAIV---YAIGI 327
           + + +KI+ F++DG   S K    +                C   K RG  +   Y   +
Sbjct: 308 NTSAEKILFFVSDGVGDSYKPSTCTKKTTGGRCQEPIDTSFCKPLKDRGVKIAVLYTTYL 367

Query: 328 RVIRSHEF--------------LRACASPNSFYLVENPHSMYDAFSHIG-KDIVTKRI 370
            +  +  +              ++ACASP  ++ V     + DA   +  K I   RI
Sbjct: 368 PLPSNSWYNTWIKPFQSEIPTKMQACASPGFYFEVSPTDGITDAMKALFLKVIRAPRI 425


>gi|190892054|ref|YP_001978596.1| hypothetical protein RHECIAT_CH0002466 [Rhizobium etli CIAT 652]
 gi|190697333|gb|ACE91418.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 427

 Score =  136 bits (342), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 59/418 (14%), Positives = 130/418 (31%), Gaps = 58/418 (13%)

Query: 11  FFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHS----------MIDRSLVH 60
           F  +  G   I+TA+ +  +    GM ++ +H   ++T L++                V 
Sbjct: 8   FISDRSGNFGIMTALLMVPLVGTAGMAVDFAHALSLRTQLYAAADAAAVGSIAEKSGAVA 67

Query: 61  AATQIMNEGNGNNRKKLKGGDILCRI----KNTWNMSFRNELRDNGFVNDIDDIVRSTSL 116
           AA  +   G  +  K       + ++             +  +    +N       +   
Sbjct: 68  AAMAMNGNGTISLGKTDARNIFMSQVSGELAEVHVDLGIDVTKTANKLNSQVSFTATVPT 127

Query: 117 DIVVVPQNEGYSISAISRYKIPL-KFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMM 175
             + +   +  +IS  +  +     F  F     N+  + +  T S     +        
Sbjct: 128 TFMQIFGRDSITISGTATAEYQTAAFMDFYILLDNTPSMGVGATPSDVSKLEAKVGCAFA 187

Query: 176 IV-LDVSRSME--SFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI-- 230
              +D S +    +       +ID+  ++  A+ +  K     ++  + G+ TF  K   
Sbjct: 188 CHQMDKSTNNYTIAKSLGVAMRIDVVRQATQALTDTAKTERVSSDQFRMGVYTFGTKAED 247

Query: 231 ---EEFFLLEWGVSHLQRKIKYLS----KFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
                   L   ++ ++     +      +    +       +     +         T 
Sbjct: 248 AKLTTISGLTSDLTKVKSYTDAVDLMTIPYQNYNSDQITNFDSAMTQMNTIIDPAGDGTS 307

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYY-------------CNEAKKRGAIV---YAIGI 327
           + + +KI+ F++DG   S K    +                C   K RG  +   Y   +
Sbjct: 308 NTSAEKILFFVSDGVGDSYKPSTCTKKTTGGRCQEPIDTSFCKPLKDRGVKIAVLYTTYL 367

Query: 328 RVIRSHEF--------------LRACASPNSFYLVENPHSMYDAFSHIG-KDIVTKRI 370
            +  +  +              ++ACASP  ++ V     + DA   +  K I   RI
Sbjct: 368 PLPSNSWYNTWIKPFQSEIPTKMQACASPGFYFEVSPTDGITDAMKALFLKVIRAPRI 425


>gi|327538644|gb|EGF25299.1| protein containing von Willebrand factor, type A domains
           [Rhodopirellula baltica WH47]
          Length = 388

 Score =  136 bits (342), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 53/389 (13%), Positives = 127/389 (32%), Gaps = 44/389 (11%)

Query: 2   FSLNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHA 61
           F+LN+  +    +  G   ++  I LP++  V    I V ++   +T L    D +   A
Sbjct: 19  FTLNVVDKARLRSRSGTTVVMLVILLPVMLAVAAYCINVVYMEMARTELQISTDLATRAA 78

Query: 62  ATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVV 121
              +   G+     +     +       +     +    +      +    +   +    
Sbjct: 79  GRVLAVTGDKAEAIEAAERLLEANP---YLDRTLSIGDADIIFGKSNRTEENRRYEFTPD 135

Query: 122 PQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVS 181
            +     + A     +P+ F T                  +K    T   LD+ IVLD S
Sbjct: 136 KKVNSVGLRAFGADDVPMLFPTMGVPIEFRP---------IKQAVATQVELDIAIVLDRS 186

Query: 182 RSME------------------SFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGL 223
            SM                        ++ K    + ++ A+   + ++ D ++  +  L
Sbjct: 187 GSMAFSHDEVAKNGSPSSAPPGWKMGHAVPKNARWLDTVAAVNGFLDIMEDSSHDERVSL 246

Query: 224 VTFSNKIEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCN 281
            T+S+K +    L    + ++  +     +  G +TN   G+      + D    R   +
Sbjct: 247 STYSDKSKADVKLTGDYTEIRAAMNAHSTNFKGGATNIGSGILEGGATLGDKNLARSWAS 306

Query: 282 TEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA- 340
                   +++ M+DG + +     + +    +      +++ +      + + +   A 
Sbjct: 307 R-------VLIVMSDGIHNTG---IEPIPAAQQVANEKIMIFTVTFSNEANVQEMEKVAV 356

Query: 341 -SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                 +  ++   + +AF  I K + T 
Sbjct: 357 SGGGQHFHAKDSQQLAEAFRKIAKSLPTL 385


>gi|32477945|ref|NP_870939.1| hypothetical protein RB13237 [Rhodopirellula baltica SH 1]
 gi|32448502|emb|CAD78017.1| conserved hypothetical protein [Rhodopirellula baltica SH 1]
          Length = 388

 Score =  136 bits (341), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 55/390 (14%), Positives = 132/390 (33%), Gaps = 46/390 (11%)

Query: 2   FSLNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHA 61
           F+LN+  +    +  G   ++  I LP++  V    I V ++   +T L    D +   A
Sbjct: 19  FTLNVVDKARLRSRSGTTVVMLVILLPVMLAVAAYCINVVYMEMARTELQISTDLATRAA 78

Query: 62  ATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVV 121
              +   G+     +     +       +     +    +      +    +   +    
Sbjct: 79  GRVLAVTGDKAEAIEAAERLLEANP---YLDRTLSIGDADIIFGKSNRTEENRRYEFTPD 135

Query: 122 PQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPIT-SSVKVNSQTDARLDMMIVLDV 180
            +    S+ A     +P+ F            + +PI    +K    T   LD+ IVLD 
Sbjct: 136 KKVNSVSLRAFGADDVPMLF----------PTMGVPIEFRPIKQAVATQVELDIAIVLDR 185

Query: 181 SRSME------------------SFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSG 222
           S SM                        ++ +    + ++ A+   + ++ D ++  +  
Sbjct: 186 SGSMAFSHDEVAKNGSPSSAPPGWKMGHAVPENARWLDTVAAVNGFLDIMEDSSHDERVS 245

Query: 223 LVTFSNKIEEFFLLEWGVSHLQRKIKYLSK--FGVSTNSTPGLKYAYNQIFDMQGMRQHC 280
           L T+S+K +    L    + ++  +   S    G +TN   G+      + D +  R   
Sbjct: 246 LSTYSDKSKADVKLTGDYTEIRAAMNAHSTKFKGGATNIGSGILEGGATLGDKKLARSWA 305

Query: 281 NTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA 340
           +        +++ M+DG + +     + +    +      +++ +      + + +   A
Sbjct: 306 SR-------VLIVMSDGIHNTG---IEPIPAAQQVANEKIMIFTVTFSDEANVQEMEKVA 355

Query: 341 --SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                  +  ++   + +AF  I K + T 
Sbjct: 356 VSGGGQHFHAKDSQQLTEAFRKIAKSLPTL 385


>gi|116252440|ref|YP_768278.1| hypothetical protein RL2693 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115257088|emb|CAK08182.1| conserved hypothetical exported protein [Rhizobium leguminosarum
           bv. viciae 3841]
          Length = 427

 Score =  135 bits (340), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 62/419 (14%), Positives = 134/419 (31%), Gaps = 60/419 (14%)

Query: 11  FFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHS----------MIDRSLVH 60
           F  +  G   I+TA+ +  +F   GM ++ +H   ++T L++                V 
Sbjct: 8   FISDRSGNFGIMTALLVVPLFGAAGMAVDFAHALSLRTQLYAAADAAAVGSIAEKSGAVA 67

Query: 61  AATQIMNEGNGNNRKKLKGGDILCRIKNTWN----MSFRNELRDNGFVNDIDDIVRSTSL 116
           AA  +   G  +  K       + ++             N  +    +N       +   
Sbjct: 68  AAMTMSGNGTISLGKDDARNIFMSQMSGELTDVHIDLGINVTKTANKLNSQVSFSATVPT 127

Query: 117 DIVVVPQNEGYSISAISRYKIPL-KFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMM 175
             + +   +  +IS  +  +     F  F     N+  + +  T++     Q        
Sbjct: 128 TFMRILGRDSITISGAATAEYQTAAFMDFYILLDNTPSMGVGATANDVSKLQAKTGCAFA 187

Query: 176 IV-LDVSRSME--SFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI-- 230
              +D S +    +       +ID+  ++  A+ +  K     ++  + G+ TF  K   
Sbjct: 188 CHQMDQSTNNYTIAKGLGVAMRIDVVRQATQALTDTAKTERVSSDQFRMGVYTFGTKAED 247

Query: 231 ---EEFFLLEWGVSHLQRKIK-----YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
                       ++ ++          +     + +       A  Q+  +        T
Sbjct: 248 AKLTTISSPTSDLTKVKNYTDTVDLMTIPYQNYNQDQLTSFDSALTQMNTII-DPAGDGT 306

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYY-------------CNEAKKRGAIV---YAIG 326
            + + +KI+ F++DG   S K    +                C   K RG  +   Y   
Sbjct: 307 SNISPEKILFFVSDGVGDSYKPSTCTKKTTGGRCQEPIDTSFCKPLKDRGVKIAVLYTTY 366

Query: 327 IRVIRSHEF--------------LRACASPNSFYLVENPHSMYDAFSHIG-KDIVTKRI 370
           + +  +  +              ++ACASP  ++ V     + DA   +  K I + RI
Sbjct: 367 LPLPSNDWYNKWISPFQSEIPTKMQACASPGFYFEVTPTEGITDAMKALFLKVIRSPRI 425


>gi|116253849|ref|YP_769687.1| hypothetical protein RL4112 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115258497|emb|CAK09601.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 398

 Score =  134 bits (338), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 73/393 (18%), Positives = 133/393 (33%), Gaps = 44/393 (11%)

Query: 8   IRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMN 67
           +R    +  G   I+TAI +P++    G+ I+ S++   K  L    D           +
Sbjct: 10  LRRMLGDRGGNFGIMTAIMMPVLLGAAGLAIDYSNMALSKRELQEATD-----------S 58

Query: 68  EGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVND-IDDIVRSTSLDIVVVPQNEG 126
                      G              F +    N    D I  I   TS+DI V      
Sbjct: 59  AALAAATALASGAASTTADAEAIAKDFVSGQMANYVDTDAISSIKAGTSVDIDVSATATS 118

Query: 127 YSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMES 186
            S          +    F+         +   TS+    S T   L M +VLD S SM  
Sbjct: 119 KSYKVTVATSYGIAATPFMSVLGYKTLNIGASTSTSSGTSDTKTALSMELVLDQSGSMGE 178

Query: 187 -----------FFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFS-------- 227
                         + +TKID   K+ +A+ + +      +++V++G  +++        
Sbjct: 179 KTTTCATYNGKNCKTYVTKIDALKKAADALFDALDTADPDHSLVRTGAYSYNNGLIYNSQ 238

Query: 228 -NKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLK----YAYNQIFDMQGMRQHCNT 282
             +I+    + WG +     +  ++  G +  + P  +     A          + H   
Sbjct: 239 KTQIKSMSGMAWGTATTATYVSGITASGGTDATEPMRQATLSIAKASDGSDVETQAHAVK 298

Query: 283 EDANYKKIIVFMTDGENLS------TKEDQQSLYYCNEAKKRGAIVYAIGIRVIR-SHEF 335
            +    + I+ MTDGE         +  DQ     C+  K  G  ++ +         + 
Sbjct: 299 GNTIVSRYIILMTDGEMTGNTGVWQSSFDQNVRNQCDATKTAGIKIFTVAFMAPDKGKQL 358

Query: 336 LRACAS-PNSFYLVENPHSMYDAFSHIGKDIVT 367
           L+ CAS   ++Y  E    +  +F+ I K+   
Sbjct: 359 LQYCASPGGNYYEAETMEKLVASFTSIAKEATK 391


>gi|86357991|ref|YP_469883.1| hypothetical protein RHE_CH02376 [Rhizobium etli CFN 42]
 gi|86282093|gb|ABC91156.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 427

 Score =  133 bits (334), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 65/419 (15%), Positives = 133/419 (31%), Gaps = 60/419 (14%)

Query: 11  FFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHS----------MIDRSLVH 60
           F  N  G   I+TA+ +  +    GM ++V+H   ++T L++                V 
Sbjct: 8   FISNRSGNFGIMTALLMVPLMGAAGMAVDVAHALSLRTQLYAAADAAAVGSIAEKSGAVA 67

Query: 61  AATQIMNEGNGNNRKKLKGGDILCRIK----NTWNMSFRNELRDNGFVNDIDDIVRSTSL 116
           AA  +   G  +  K       + +      +       +  +    +N       +   
Sbjct: 68  AAMTMNGNGTVSLGKTDARNIFMSQTSGELTDIHIDLGIDVTKTANKLNSQVSFTATVPT 127

Query: 117 DIVVVPQNEGYSISAISRYKIPL-KFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMM 175
             + +   +   IS  +  +     F  F     N+  + +  T+S     Q        
Sbjct: 128 TFMRIFGRDSIIISGTATAEYQTAAFMDFYILLDNTPSMGVGATASDVSKLQAKTGCAFA 187

Query: 176 IV-LDVSRSME--SFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI-- 230
              +D S +    +       +ID+  ++  A+ +  K     ++  + G+ TF  K   
Sbjct: 188 CHQMDQSTNNYTIAKSLGVTMRIDVVRQATQALTDTAKAERVSSDQFRMGVYTFGTKAED 247

Query: 231 ---EEFFLLEWGVSHLQRKIKY-----LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
                   L   ++ ++          +     +++       A  QI  +        T
Sbjct: 248 AKLTTISGLTSDLTKVKNYTNAVDLMTIPYQNYNSDQLTSFDSAMTQINTII-DPAGDGT 306

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYY-------------CNEAKKRGAIV---YAIG 326
            + + +KI+ F+ DG   S K    +                C   K RG  +   Y   
Sbjct: 307 SNISPEKILFFVADGVGDSYKPSTCTKKTTGGRCQEPIDTTFCKPLKDRGVKIAVLYTTY 366

Query: 327 IRVIRSHEF--------------LRACASPNSFYLVENPHSMYDAFSHIG-KDIVTKRI 370
           + +  +  +              ++ACASP  ++ V     + DA   +  K I   RI
Sbjct: 367 LPLPSNSWYNTWIKPFQNEIPTKMQACASPGLYFEVTPTDGIADAMKALFLKVIRAPRI 425


>gi|332716587|ref|YP_004444053.1| hypothetical protein AGROH133_12352 [Agrobacterium sp. H13-3]
 gi|325063272|gb|ADY66962.1| hypothetical protein AGROH133_12352 [Agrobacterium sp. H13-3]
          Length = 412

 Score =  132 bits (332), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 62/402 (15%), Positives = 143/402 (35%), Gaps = 56/402 (13%)

Query: 9   RNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNE 68
           R F  +  G   ++TAI LP++    G  +E++++  +K  L +                
Sbjct: 11  RRFLADTGGNFGMMTAILLPVLLGFAGAGMELANVMQVKADLQN---------TADSAAL 61

Query: 69  GNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYS 128
                 +  +G     +IK        +++       +   + +++ ++I       G +
Sbjct: 62  AAATEARLKEGALTDEQIKEIAKAFIASQMEKTLTEEEKKALEKNSPVNIGTTDDARGKT 121

Query: 129 ISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSM---- 184
            +  +     ++    +  +  ++ + +  T +        A + M +VLD S SM    
Sbjct: 122 YTIQTTINYQMQ-LNPLLGFFGAKTLDLAATGTAVSTVNKGAPISMYLVLDRSGSMSFKT 180

Query: 185 ------------------------ESFFDSSITKIDMAIKSINAMLEEVKLIPDV----- 215
                                   ++     + K      ++  ++  +           
Sbjct: 181 DTLNTKKTSCQNYTVDNWGSYPNLKNTSPCYVNKATSLKTAVGYLVATLNKADPTYTANG 240

Query: 216 -NNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSK--FGVSTNSTPGLKYAYNQIFD 272
            + +V++G   ++++      + WG S +   +           T++   L  AYN +  
Sbjct: 241 GSELVRTGASVYTHETYAAQPITWGTSSVATYVDKQIPEFPSGGTDARSSLNAAYNALKK 300

Query: 273 MQ--GMRQHCNTEDANYKKIIVFMTDGENLS------TKEDQQSLYYCNEAKKRGAIVYA 324
                 ++H + +  ++++ IV MTDGE         +  DQ     C+ AKK G  +++
Sbjct: 301 ANTVEAKEHKDKKSESFERYIVLMTDGEMTGNSSSWSSSIDQTVRNTCDTAKKDGIKIFS 360

Query: 325 IGIRVIR-SHEFLRACASP-NSFYLVENPHSMYDAFSHIGKD 364
           +           L+ CAS  +++Y  EN   +  AF  I + 
Sbjct: 361 VAFMAPDKGKSLLQHCASSLDNYYAPENMEQIVTAFGEIARK 402


>gi|241204947|ref|YP_002976043.1| hypothetical protein Rleg_2227 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240858837|gb|ACS56504.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 429

 Score =  132 bits (331), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 58/421 (13%), Positives = 132/421 (31%), Gaps = 62/421 (14%)

Query: 11  FFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHS----------MIDRSLVH 60
           F  +  G   I+TA+ +  +F   GM ++ +H   ++T L++                V 
Sbjct: 8   FISDRSGNFGIMTALLVVPLFGAAGMAVDFAHALSLRTQLYAAADAAAVGSIAEKSGAVA 67

Query: 61  AATQIMNEGNGNNRKKLKGGDILCRIKNTWN----MSFRNELRDNGFVNDIDDIVRSTSL 116
           AA  +   G  +  K       + +I             +  +    +N       +   
Sbjct: 68  AAMTMSGNGTISLGKDDARSIFMSQISGELTDVQVDLGIDVTKTANKLNSQVSFSATVPT 127

Query: 117 DIVVVPQNEGYSISAISRYKIPL-KFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMM 175
             + V   +  +IS  +  +     F  F     N+  + +  T++     + +      
Sbjct: 128 TFMRVLGRDSITISGTATAEYQTASFMDFYILLDNTPSMGVGATATDVSTMEKNTSDTCA 187

Query: 176 IVLDVSRSMESFFD-----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
                +++  ++++         +ID+  ++   +    K     +N  + G+ TF  K 
Sbjct: 188 FACHETQNNNNYYNLAKKLGVSMRIDVVRQATKELTVTAKSTRVSSNQFRMGVYTFGTKA 247

Query: 231 -----EEFFLLEWGVSHLQRKIKY-----LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHC 280
                         +  ++          +   G + +       A  Q+  +       
Sbjct: 248 EDAKLTTISDPTDDLDKVRSYTDAVDLMTIPFQGYNNDQQTSFDSALTQMKTII-TTPGD 306

Query: 281 NTEDANYKKIIVFMTDGENLSTKEDQQSLYY-------------CNEAKKRGAIV---YA 324
            +     +KI+ F++DG   S K    +                C   K +   +   Y 
Sbjct: 307 GSTATTPQKILFFVSDGVGDSEKPKGCTKKLTGNRCQEPIDTSFCQPLKDKSIRIAVLYT 366

Query: 325 IGIRVIRSHEF--------------LRACASPNSFYLVENPHSMYDAFSHIG-KDIVTKR 369
             + + ++  +              ++ACASP  ++ V     + DA   +  K I   R
Sbjct: 367 TYLPLPKNSWYNTWIKPFQGEIPTKMQACASPGLYFEVTPTEGIADAMKALFLKVIRAPR 426

Query: 370 I 370
           I
Sbjct: 427 I 427


>gi|146337718|ref|YP_001202766.1| hypothetical protein BRADO0587 [Bradyrhizobium sp. ORS278]
 gi|146190524|emb|CAL74523.1| conserved hypothetical protein; putative vWFA domain
           [Bradyrhizobium sp. ORS278]
          Length = 442

 Score =  131 bits (330), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 58/435 (13%), Positives = 128/435 (29%), Gaps = 69/435 (15%)

Query: 1   MFSLNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVH 60
           M SL+L +  F  N  G + +  AI    +   +G  ++ S    M+  L + +D + V 
Sbjct: 1   MRSLSLLLSRFRRNAGGNVAVTFAIVCVPVITAVGCGVDYSRTNQMRAKLQAAVDAASVG 60

Query: 61  AATQ-----IMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNEL---------RDNGFVND 106
           A ++     I       +     G D   +I N                   +    +  
Sbjct: 61  AVSRTSPAFIAAGAMTTDGVIAAGNDDARKIFNGNMSGTTGYTLDSLTPEVKKTGSVLTA 120

Query: 107 IDDIVRSTSLDIVVVPQNEGYSISAISRYKIPL-KFCTFIPWYTNSRHIVMPITSSVKVN 165
                 +     + +   +  S+   S  K  + K+  F     NS  + +  T +    
Sbjct: 121 TVSFSATVPTLFMSIVGYKTMSLQGSSTAKASMPKYIDFYLLLDNSPSMGVAATPADVTK 180

Query: 166 S--QTDARLDMMIVL---DVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQ 220
               T  +            +    +      T+ID+   +   +++  +     +N  +
Sbjct: 181 MVSATSDKCAFACHDYNDANNYYNLAKTLGVTTRIDVLRSATQQLMDTAQQTQTYSNQFR 240

Query: 221 SGLVTFSNKIEE-----FFLLEWGVSHLQRKIKYLSKFG--VSTNSTPGL---KYAYNQI 270
             +  F    +       F L   ++  +     +   G   + +S        Y     
Sbjct: 241 MAIYDFGASSKTIGLRALFALSSSLTSAKSAAGNIDLMGVYGNNDSFTADKDTPYTTALP 300

Query: 271 FDMQGMRQHCNTEDANYKKIIVFMTDGENLSTK-------------EDQQSLYYCNEAKK 317
                +    +    +  K + F++DG    +              +   +   C   K 
Sbjct: 301 AINNEIATPGDGTSGSPLKYLFFVSDGVADESNAACLKPKASGNRCQSPINPALCTALKN 360

Query: 318 RGAIV---YAIGIRVIRSH-----------------------EFLRACASPNSFYLVENP 351
           RG  +   Y   +++  +                        + ++ACAS   ++ V   
Sbjct: 361 RGIKIAVLYTTYLQLPTNSWYMSWIDPFNKGPFGPSPNSEIAQNMQACASDGFYFEVSPT 420

Query: 352 HSMYDAFSHIGKDIV 366
             + DA + + K  V
Sbjct: 421 QGIADAMNALFKKAV 435


>gi|148253748|ref|YP_001238333.1| hypothetical protein BBta_2249 [Bradyrhizobium sp. BTAi1]
 gi|146405921|gb|ABQ34427.1| putative exported protein of unknown function [Bradyrhizobium sp.
           BTAi1]
          Length = 432

 Score =  131 bits (329), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 51/413 (12%), Positives = 116/413 (28%), Gaps = 56/413 (13%)

Query: 8   IRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMN 67
           +  F  N  G + I+ A+ L  I   +G  I+ S     K  L + +D +++ A      
Sbjct: 11  LSRFRRNESGNIAIIFALALLPILTFVGSAIDYSMAVRAKAKLSASLDAAMLAATGYTAM 70

Query: 68  EGNGNNRKKLKGGDILCRI-KNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEG 126
            G   + K         ++  +    +  N    +           S  ++   +     
Sbjct: 71  RGTAADAKTSATNMYNGQMSSHKLTSNSLNITVTDSVTARTVTGTASVVVNTAFMYMFGF 130

Query: 127 YSISAISRYKIPLKF---CTFIPWYTNSRHIVMPITSSVKVNSQTDAR--LDMMIV---- 177
            +++  +       F     F     NS    +  T++     Q                
Sbjct: 131 PTMTVTASSSASASFPTYMDFYVLVDNSPSQGLGATTADMTTLQNATSDKCAFACHDTYT 190

Query: 178 -------LDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN-- 228
                     S    +       +ID+   +  ++ +       V+N  +  + +  +  
Sbjct: 191 SSTKKTLQTNSYYQIAKNKGVTMRIDVVRSATQSLTDTATSSQVVSNQYRMAVYSLGSDC 250

Query: 229 ------KIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
                  +         V      +  ++      N+     +          +    + 
Sbjct: 251 GSLGLTTVASLSSSMSSVKSSVGALDLMTIPYSGYNNDMCTDFDGAMSGMNGVIPAQGDG 310

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYY--------------CNEAKKRGAIV------ 322
              + +K + F++DG    +     S                 C+  K RG  +      
Sbjct: 311 SSTSPQKWLFFVSDGVADYSYPTTCSKTVLSGGRCQEPLNTTTCDTLKARGIKIAVLYTT 370

Query: 323 ---------YAIGIRVIRS--HEFLRACASPNSFYLVENPHSMYDAFSHIGKD 364
                    Y   I   R      +++CASP  +Y V++  S+  A + + + 
Sbjct: 371 YLAITNNSWYTTYIAPWRDSISGIMKSCASPGYYYEVDSSGSIGAALTALFQQ 423


>gi|209549601|ref|YP_002281518.1| hypothetical protein Rleg2_2008 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209535357|gb|ACI55292.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 429

 Score =  131 bits (329), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 59/421 (14%), Positives = 124/421 (29%), Gaps = 62/421 (14%)

Query: 11  FFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVL----------HSMIDRSLVH 60
           F  +  G   I+TA+ +  +    GM ++ +H   ++T L                  V 
Sbjct: 8   FISDRSGNFGIMTALLMVPLLGTAGMAVDFAHAMSLRTQLFAAADAAAVGSIAEKSGAVA 67

Query: 61  AATQIMNEGNGNNRKKLKGGDILCRI----KNTWNMSFRNELRDNGFVNDIDDIVRSTSL 116
           AA  +   G  +  K       L ++     +       +  +    +N           
Sbjct: 68  AAMTMTGNGTISLGKTDARSIFLSQVSGELADVNVDLGIDVTKTANKLNSQVSFTAVVPT 127

Query: 117 DIVVVPQNEGYSISAISRYKI-PLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDA--RLD 173
             + V   +  +IS  +  +     F  F     N+  + +  T+      + +      
Sbjct: 128 TFMRVLGKDSITISGTATAEYLTASFMDFYILLDNTPSMGVGATAKDVATMEKNTSDSCA 187

Query: 174 MMIVL---DVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
                     +    +       +ID+  ++   +    K      N  + G+ TF  K 
Sbjct: 188 FACHETENKNNYYNLAKTLGVSMRIDVVRQATKELTLTAKSTRVSTNQFRMGVYTFGTKA 247

Query: 231 -----EEFFLLEWGVSHLQRKIKY-----LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHC 280
                         +  ++          + K G + +       A  Q+ D+       
Sbjct: 248 EDANLTTISDPTDDLDKVRTYTDAVDLMTIPKQGYNNDQQTSFDNALTQMKDII-TTPGD 306

Query: 281 NTEDANYKKIIVFMTDGENLSTKEDQQSLYY-------------CNEAKKRGAIV---YA 324
            +     +KI+ F++DG   S K    +                C   K +G  +   Y 
Sbjct: 307 GSTATTPQKILFFVSDGVGDSEKPKGCTKKLTGNRCQEPIDTSFCKPLKDKGIRIAVLYT 366

Query: 325 IGIRVIRSHEF--------------LRACASPNSFYLVENPHSMYDAFSHIG-KDIVTKR 369
             + + ++  +              ++ CASP  ++ V     + DA   +  K I   R
Sbjct: 367 TYLPLPKNSWYNTWISPFQSQIPTKMQECASPGLYFEVTPTEGIADAMKALFLKAIRAPR 426

Query: 370 I 370
           I
Sbjct: 427 I 427


>gi|86747937|ref|YP_484433.1| hypothetical protein RPB_0811 [Rhodopseudomonas palustris HaA2]
 gi|86570965|gb|ABD05522.1| conserved hypothetical protein [Rhodopseudomonas palustris HaA2]
          Length = 435

 Score =  130 bits (327), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 59/417 (14%), Positives = 122/417 (29%), Gaps = 58/417 (13%)

Query: 9   RNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNE 68
           R F  +  G + ++ AI L  I   +G  I+ +    ++T L S  D +++ A +     
Sbjct: 15  RRFGRDRSGNIAVIFAIALLPILGFIGAAIDYATANRIRTKLQSAQDAAVLLAVSNSEIN 74

Query: 69  GNGNNRKKLKGGDILCRIKNTWNMSFRNELRD--NGFVNDIDDIVRSTSLDIVVVPQNEG 126
                 K          I      +         +G  +   D   + + + + +     
Sbjct: 75  RTTAQAKADAEQFFNATIGAYGLTATIKIEVTENDGKRSATADFTSTVTTNFLNLIGYPT 134

Query: 127 YSISAISRYKIP-LKFCTFIPWYTNSRHIVMPITSSVKVNSQTDAR--LDMMIVLDVSRS 183
            +I   S   +    +  F     NS  + +  T++       +           D+S S
Sbjct: 135 LAIGNRSTSTVSRPIYQDFYLLLDNSPSMGVAATTADIATMVGNTSDKCAFACH-DLSDS 193

Query: 184 MESFF----DSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN--------KIE 231
              +          +ID+  +++  +     L+  VNN  +  + T            I 
Sbjct: 194 NNYYNLAKKLGVKMRIDVVRQAVQQLTSTATLMTAVNNQFRMAVYTLGGSCASLGLTTIA 253

Query: 232 EFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKII 291
                   V      I  +S    + N+     +          +        A  +K +
Sbjct: 254 SLSSAMSSVQTAAGAIDLMSIPKQNYNNDQCTDFNSALAAMNTTIPSSGTGTAAQPQKWL 313

Query: 292 VFMTDGENLSTKED--------------QQSLYYCNEAKKRGAIV---YA---------- 324
            F++DG                        ++  C   K RG  +   Y           
Sbjct: 314 FFVSDGVADFNNPSGCTQPTVSGGRCQEPLTVTQCKAMKDRGIQIAVLYTTYLALPTNQW 373

Query: 325 ----IG------IRVIRSHEF---LRACASPNSFYLVENPHSMYDAFSHIGKDIVTK 368
               I            + +    +++CASP+ ++ V     + +A   + K  V K
Sbjct: 374 YNDHIAPFNAGPYGPSVNSQIAAKMKSCASPDFYFEVSPTQGISEAMDALFKKAVAK 430


>gi|329850249|ref|ZP_08265094.1| von Willebrand factor type A domain protein [Asticcacaulis
           biprosthecum C19]
 gi|328840564|gb|EGF90135.1| von Willebrand factor type A domain protein [Asticcacaulis
           biprosthecum C19]
          Length = 412

 Score =  130 bits (327), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 63/414 (15%), Positives = 130/414 (31%), Gaps = 48/414 (11%)

Query: 1   MFSLNLNIRNFF----------YNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVL 50
           M +L      F            +  G + ++ A+ + +IF  +G  I+ S + + +  L
Sbjct: 1   MTTLARRTHRFAGFRRRLGESCRDQSGNVIMIFALSVFVIFGFVGAAIDFSRVDYARRRL 60

Query: 51  HSMIDRSLV-HAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDD 109
               D +++   A +   + +          +                  +   ++    
Sbjct: 61  QDAADSAVLRAMALKSATDESRGVAADKAFAENFGHPGVYDLNGALKREVNENIISQTYT 120

Query: 110 IVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIV-------------- 155
           +  + S         + Y ++ +S+ K  L           +  +               
Sbjct: 121 VHATVSSYFGAFFGKDSYPVTVVSQAKTSLDVFEIAFVLDTTGSMAEANKMPNLKSSVDS 180

Query: 156 -----------MPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINA 204
                      +  +    V   T  RL    V  +S    S    +         + + 
Sbjct: 181 AMAGLLQNGKNLSGSKIAVVPFNTQVRLSDATVTTMSSQGLSSGWGNCVHDRDL--ATSH 238

Query: 205 MLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLK 264
            +            +          ++    L   +S  +  IK L   G  TN T G++
Sbjct: 239 DVSASAAQKGKAQTLYPLETCDEASLKPVQGLSDNISSARNFIKTLQP-GGYTNVTMGVQ 297

Query: 265 YAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENL-------STKEDQQSLYYCNEAKK 317
           +    +   Q             +K ++ +TDG+N        ++  D+++   C  AK 
Sbjct: 298 WGMEVLSPNQPFSDATEFGSTKARKFMIVVTDGDNTKSFTSWSASVIDKRTALACENAKA 357

Query: 318 RGAIVYAIGIRVIRSHEFLRACAS-PNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           +G  VY + I +  +   LR CAS P  FY + + + +  A S I K I   R+
Sbjct: 358 KGITVYTVKI-IQGNSNMLRKCASAPEYFYDLTSANQLNAAMSGIFKSINKTRL 410


>gi|332716075|ref|YP_004443541.1| hypothetical protein AGROH133_11102 [Agrobacterium sp. H13-3]
 gi|325062760|gb|ADY66450.1| hypothetical protein AGROH133_11102 [Agrobacterium sp. H13-3]
          Length = 429

 Score =  129 bits (324), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 63/424 (14%), Positives = 138/424 (32%), Gaps = 65/424 (15%)

Query: 8   IRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMID----------RS 57
           ++NF+    G   ILTA+ +  +    G+ ++++    +K  L    D           +
Sbjct: 1   MKNFWQEKSGNFGILTALLMVPLCGAAGVALDITRGMSVKADLQQAADSAALAAVADMSA 60

Query: 58  LVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRD----NGFVNDIDDIVRS 113
            V AA ++  +G      +          +   + +  +           V        S
Sbjct: 61  SVQAAKKMSGDGVIPVGNEEARAFFDGNQRGDADYTITSVDVSVIKHGNVVESSVSFKAS 120

Query: 114 TSLDIVVVPQNEGYSISAISRYKIPL-KFCTFIPWYTNSRHIVMPITSSVKVNSQTDAR- 171
            S  +  +   +  S++  +  K     F  F     N+  + +  T +       +   
Sbjct: 121 VSTTLSGLLGKDFVSVAGTATAKYETETFSDFYLLLDNTPSMGVGATPTDVATLVANTGD 180

Query: 172 -LDMMIVL-------DVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGL 223
                  +         S   ++      T+ID+  K+  ++++  K     +N  +  +
Sbjct: 181 KCAFACHIVKDGVADPNSYYFKAKKLGVTTRIDVVAKATASLMDTAKSTRKSSNQYRMAV 240

Query: 224 VTFSNKIEE-----FFLLEWGVSHLQR-----KIKYLSKFGVSTNSTPGLKYAYNQIFDM 273
            TF  + E+        L   +   ++      +  +   G + +       A  QI D 
Sbjct: 241 YTFGERAEDTKLLEVVSLTSDLDAAKKKAGEINLMSIPYQGYNNDQQTDFDRALIQIGDK 300

Query: 274 QGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYY-------------CNEAKKRGA 320
            G         AN  K+I F++DG   S K    +                C + K++G 
Sbjct: 301 VGSSGTGA-SSANPDKVIFFVSDGVGDSYKPSSCTKKLTGGRCQEPIDIKDCTKLKEKGF 359

Query: 321 IV---YAIGIRVIRSHEF--------------LRACASPNSFYLVENPHSMYDAFSHIGK 363
            +   Y   + +  +  +              +++CASP  ++ V     + DA + + K
Sbjct: 360 RIAVLYTTYLPLPTNDWYNSWIKPFQAEIGSRMQSCASPGLYFEVSPSQGISDAMTVLFK 419

Query: 364 DIVT 367
             +T
Sbjct: 420 KAIT 423


>gi|312878233|ref|ZP_07738157.1| von Willebrand factor type A [Caldicellulosiruptor lactoaceticus
           6A]
 gi|311794982|gb|EFR11387.1| von Willebrand factor type A [Caldicellulosiruptor lactoaceticus
           6A]
          Length = 1221

 Score =  129 bits (324), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 52/308 (16%), Positives = 102/308 (33%), Gaps = 32/308 (10%)

Query: 69  GNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRST-SLDIVVVPQNEGY 127
           G  +    ++             +        +     +  +     +   +     +  
Sbjct: 429 GIVSTPVDIEVYAPFKEATVFIPIDTSKIPNQDFQNVKMFYLDEDLMTFVPLDEQGVDPI 488

Query: 128 SISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESF 187
           +    ++      F  F    T      +PI    +  +Q    +D++ VLD S SM   
Sbjct: 489 NKVVWAKTDHFTTFVLFYIP-TWKAIWEVPINKGEREVNQQIKYIDLVFVLDSSGSMSWN 547

Query: 188 FDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKI 247
             +   KI  A   ++A+++            ++ +V F +       L      ++  I
Sbjct: 548 DPNGYRKI-AAKSFVDALIQ----------GDRAAVVDFDDYGYLLQPLTTDFQTVKNAI 596

Query: 248 KYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQ 307
             +  +G  TN   G++ A +Q+               +  K+I+ +TDGE         
Sbjct: 597 DRIDSWG-GTNIAEGIRIANHQLISQ---------SSDDRIKVIILLTDGEGYYDNN--- 643

Query: 308 SLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                 EAK  G  +Y IG+        LR  A  +   ++ V +   +   F  I  +I
Sbjct: 644 ---LTTEAKNNGITIYTIGLGTSVDENLLRNIATQTGGMYFPVSSASQLPQVFKRI-TEI 699

Query: 366 VTKRIWYD 373
           VT+ I  D
Sbjct: 700 VTEPIDTD 707


>gi|91975399|ref|YP_568058.1| hypothetical protein RPD_0919 [Rhodopseudomonas palustris BisB5]
 gi|91681855|gb|ABE38157.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB5]
          Length = 435

 Score =  129 bits (323), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 53/419 (12%), Positives = 123/419 (29%), Gaps = 58/419 (13%)

Query: 7   NIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIM 66
           ++  F  +  G + ++ AI L  I   +G  ++ ++   ++  L S  D +++ A +   
Sbjct: 13  SLGRFASDRSGNIAVIFAIALLPILGFIGAAVDYTNASRVRAKLESAQDAAVLLAVSNSA 72

Query: 67  NEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRD--NGFVNDIDDIVRSTSLDIVVVPQN 124
                 + +          +      +  +      +G  + +     S     + +   
Sbjct: 73  INKTVADAQADAVQFFNATLDGYGLSATIDLSVSENDGKRSAVSSFSSSVKTHFLDMIGY 132

Query: 125 EGYSISAISRYKIPL-KFCTFIPWYTNSRHIVMPITSSVKVNSQTDAR--LDMMIVLDVS 181
              +I   S   + L  +  F     NS  + +  T+S       +           D+S
Sbjct: 133 PTLAIGNRSTSTVSLPVYVDFYLLLDNSPSMGVAATTSDIATMVANTSDQCAFACH-DLS 191

Query: 182 RSMESFF----DSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE----- 232
            S   +          +ID+  +++  +      +  V N  + G+ TF +         
Sbjct: 192 TSNNYYNLAKKLGVTMRIDVVRQAVQRLTTTATAMSAVTNQFRMGVYTFGSSCTAIGLTT 251

Query: 233 ---FFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
                     V      I  ++      N+     +  +       +    +      +K
Sbjct: 252 VANLSSSMSSVQTSVGTIDLMTIPYQGYNNDQCTDFDGSLTAINSAIPSPGSGISTQPQK 311

Query: 290 IIVFMTDGENLSTKEDQQSL--------------YYCNEAKKRGAIV---YA-------- 324
            + F++DG   +      +                 C   K RG  +   Y         
Sbjct: 312 WLFFVSDGVADANYPSTCTKPTVSGGRCQEPLTVAQCTAIKSRGIQIAVLYTTYLALPTN 371

Query: 325 ------IG------IRVIRSHEF---LRACASPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                 I            + +    +++CASP  ++ V     + +A   + K  V K
Sbjct: 372 SWYNTYIAPFNPGPYGPSTNSQIAANMQSCASPGFYFEVSPTQGIAEAMDALFKKAVAK 430


>gi|192291928|ref|YP_001992533.1| hypothetical protein Rpal_3558 [Rhodopseudomonas palustris TIE-1]
 gi|192285677|gb|ACF02058.1| conserved hypothetical protein [Rhodopseudomonas palustris TIE-1]
          Length = 455

 Score =  128 bits (322), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 57/454 (12%), Positives = 127/454 (27%), Gaps = 87/454 (19%)

Query: 1   MFSLNLNI----RNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDR 56
           M SL   +    R F     G + ++ A+ L  +   +G+ ++ S     +T L + +D 
Sbjct: 3   MISLAAQLTRAARRFPQANGGNIAVIFALALVPLLGFIGVAVDYSRANNARTSLQNALDS 62

Query: 57  SLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSL 116
           + +  +  +       ++   K            N           +         + ++
Sbjct: 63  AALMLSRDLGVGTITPDQVSSKAQTY--FNSLYTNKETGAVTVTATYTAKDGSGSSTIAM 120

Query: 117 DIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSS--------------- 161
                 Q +   I       I     T          + + +T S               
Sbjct: 121 SGQGAVQTQFMKILGFQTMAIGSSTTTTWGGTRLRVAMALDVTGSMASAGKMSAMKTAAK 180

Query: 162 -------VKVNSQTDARLDMMIVL--------------------DVS-RSMESFFDSSIT 193
                      +  D  + ++                       D S  S  S++ S+ +
Sbjct: 181 NLVDSLRASAQTADDVYISVVPFAQMVNVGSSNRNANWVRWDLWDESNGSCSSWWYSTKS 240

Query: 194 KIDMAIKSINAMLEEVKLIPDVNNVV--------------QSGLVTFSNKIEEFFLLEW- 238
             + A ++  A           +                 +   V +    ++   +   
Sbjct: 241 SCEYAGRTWTATSHNQWAGCVTDRDQPADTTKDVPTSYATRFPAVDYDACPQQLLGMTSA 300

Query: 239 ----GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFM 294
                 + ++ KI  LS  G  TN   G+ +A+  +     +       +  Y   I+ +
Sbjct: 301 YSLSNATTIKNKIDALSPNG-GTNQAIGMHWAWMSLRTGDPLNTPAKDSNYKYTDAIILL 359

Query: 295 TDGENLSTKEDQQSLYY-----------CNEAKK-----RGAIVYAIGIRVIRSHE--FL 336
           +DG N   +       +           C+  +         ++Y I +      E   L
Sbjct: 360 SDGLNTVDRWYGNGRDWSPQVDARQRILCDNIRASATNTNPVVIYTIQVNTDGDPESTVL 419

Query: 337 RACASPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           + CA   +F+       +  AF+ IG  +   R+
Sbjct: 420 KYCADSGNFFATTTSSGIGTAFAQIGSSLSKLRV 453


>gi|39936212|ref|NP_948488.1| hypothetical protein RPA3149 [Rhodopseudomonas palustris CGA009]
 gi|39650067|emb|CAE28590.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009]
          Length = 455

 Score =  128 bits (321), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 57/454 (12%), Positives = 127/454 (27%), Gaps = 87/454 (19%)

Query: 1   MFSLNLNI----RNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDR 56
           M SL   +    R F     G + ++ A+ L  +   +G+ ++ S     +T L + +D 
Sbjct: 3   MISLAAQLTRAARRFPQANGGNIAVIFALALVPLLGFIGVAVDYSRANNARTSLQNALDS 62

Query: 57  SLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSL 116
           + +  +  +       ++   K            N           +         + ++
Sbjct: 63  AALMLSRDLGVGTITPDQVSSKAQTY--FNSLYTNKETGAVTVTATYTAKDGSGSSTIAM 120

Query: 117 DIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSS--------------- 161
                 Q +   I       I     T          + + +T S               
Sbjct: 121 SGQGAVQTQFMKILGFQTMAIGSSTTTTWGGTRLRVAMALDVTGSMASAGKMSAMKTAAK 180

Query: 162 -------VKVNSQTDARLDMMIVL--------------------DVS-RSMESFFDSSIT 193
                      +  D  + ++                       D S  S  S++ S+ +
Sbjct: 181 NLVDSLRASAQTVDDVYISVVPFAQMVNVGSSNRNASWVRWDLWDESNGSCSSWWYSTKS 240

Query: 194 KIDMAIKSINAMLEEVKLIPDVNNVV--------------QSGLVTFSNKIEEFFLLEW- 238
             + A ++  A           +                 +   V +    ++   +   
Sbjct: 241 SCEYAGRTWTATSHNQWAGCVTDRDQPADTTKDVPTSYATRFPAVDYDACPQQLLGMTSA 300

Query: 239 ----GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFM 294
                 + ++ KI  LS  G  TN   G+ +A+  +     +       +  Y   I+ +
Sbjct: 301 YSLSNATTIKNKIDALSPNG-GTNQAIGMHWAWMSLRTGDPLNTPAKDSNYKYTDAIILL 359

Query: 295 TDGENLSTKEDQQSLYY-----------CNEAKK-----RGAIVYAIGIRVIRSHE--FL 336
           +DG N   +       +           C+  +         ++Y I +      E   L
Sbjct: 360 SDGLNTVDRWYGNGRDWSPQVDARQRILCDNIRASATNTNPVVIYTIQVNTDGDPESAVL 419

Query: 337 RACASPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           + CA   +F+       +  AF+ IG  +   R+
Sbjct: 420 KYCADSGNFFATTTSSGIGTAFAQIGSSLSKLRV 453


>gi|222149754|ref|YP_002550711.1| hypothetical protein Avi_3756 [Agrobacterium vitis S4]
 gi|221736736|gb|ACM37699.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 437

 Score =  128 bits (321), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 73/400 (18%), Positives = 142/400 (35%), Gaps = 48/400 (12%)

Query: 10  NFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEG 69
               +  G   ++TA+ LP+   V G+ ++ + +   ++ L S +D + + AA+ + N  
Sbjct: 41  RLLRHSGGNFGMMTAVLLPVSIGVAGLAMDATEMVQSRSALQSSVDAAALAAASAMSNGM 100

Query: 70  NGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSI 129
           +  +   L    +  ++ NT          D     + D  V++T +       +  Y +
Sbjct: 101 SEADAIALAKSFLSSQLANTMARDENTSSVDQITQAEPDISVKTTQV----NSSSTSYDV 156

Query: 130 SAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDA-RLDMMIVLDVSRSMESFF 188
                Y I       +        + +      +  +      L M +VLD S SM    
Sbjct: 157 ELTGSYTIT---MNPLSRVLGWETVTLKAYGKAQAATTASESPLSMYLVLDRSGSMNDET 213

Query: 189 D-----------------------------SSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
                                          + TKI+    ++  +  ++K     +  V
Sbjct: 214 ATTYTGTCTKTTTSGYGWNKKTTTTSYSCTKNYTKIESLKLAVADLAAQLKKADPNSEYV 273

Query: 220 QSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYN--QIFDMQGMR 277
           ++G  +++   +    + WG +++   +  LS  G  T++   L  AY+  Q  +   + 
Sbjct: 274 RTGADSYNASADTAQAMSWGTANVVTYVNALSATG-GTDARGALSAAYSALQTSNKTEIT 332

Query: 278 QHCNTEDANYKKIIVFMTDGENLS------TKEDQQSLYYCNEAKKRGAIVYAIGIRVIR 331
            H  +  +   + IVFMTDGE         +  D      C   K  G  +Y +      
Sbjct: 333 AHNVSSVSKIGRYIVFMTDGEMTGNSSSWSSSIDSAVRSQCTSIKADGIQIYTVAFMAPA 392

Query: 332 S-HEFLRACASPN-SFYLVENPHSMYDAFSHIGKDIVTKR 369
           +    L ACAS    +Y   +  S+  AF  IGK   +  
Sbjct: 393 NGKSLLSACASDASHYYEATDAASLVAAFGEIGKKATSTS 432


>gi|192288907|ref|YP_001989512.1| hypothetical protein Rpal_0477 [Rhodopseudomonas palustris TIE-1]
 gi|192282656|gb|ACE99036.1| conserved hypothetical protein [Rhodopseudomonas palustris TIE-1]
          Length = 443

 Score =  128 bits (321), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 50/436 (11%), Positives = 121/436 (27%), Gaps = 71/436 (16%)

Query: 2   FSLNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHA 61
            + + +I  F  + +G + ++ A+ L  +   +G  ++ S    +++ L +  D + V A
Sbjct: 1   MAFSRSIARFSRDRRGNIAVIFALVLVPLISAVGCAVDYSRANALRSKLQAAADAASVGA 60

Query: 62  ATQ-----IMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDI-VRSTS 115
            ++     +       +     G D   RI N            +          V ++ 
Sbjct: 61  VSRTSPAYVAAGAMSGDGVISSGADDALRIFNGNLNGLTGYTLASSSATVTKASDVVTSQ 120

Query: 116 LDIVVVPQNEGYSISAISRYKIPLK---------FCTFIPWYTNSRHIVMPITSSVKVNS 166
           +            +  +S   +            +  F     NS  + +  T +     
Sbjct: 121 VTFSAQISTMFMKVVGMSAMTVGGTSTATASMPKYIDFYLLLDNSPSMGVGATPTDVSAM 180

Query: 167 -------QTDARLDMMIVLDVSRSMESFFD---SSITKIDMAIKSINAMLEEVKLIPDVN 216
                   +D           +++            T+ID+   +   +++        +
Sbjct: 181 IAATANKSSDDHCAFACHDVNNKNNYYNLAKALGITTRIDVLRSATQQLMDTASATATYS 240

Query: 217 NVVQSGLVTFSNKIEEF--------FLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYN 268
           N  +  +  F    +                       I  ++  G + N+     Y   
Sbjct: 241 NQFRMAIYDFGASAQTAGLRNLFSLSASLSSAKTAASAIDLMTVKGQNDNNDQDTSYTAI 300

Query: 269 QIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKE------------DQQSLYYCNEAK 316
                  +    +    + +K + F++DG                      +   C   K
Sbjct: 301 FPAINNEISSPGSGVSGSPQKYLFFVSDGVADEYNPSCLKPKTGNRCQSPINPALCKTLK 360

Query: 317 KRGAIV---YAIGIRVIRSH-----------------------EFLRACASPNSFYLVEN 350
            RG  +   Y   + +  +                        + + ACASP  ++ V  
Sbjct: 361 DRGIKIAVLYTTYLNLPSNDWYKKWIAPFNAGPYGPSPNSEIAQNMEACASPGFYFEVSP 420

Query: 351 PHSMYDAFSHIGKDIV 366
              + +A + + K  V
Sbjct: 421 TQGIAEAMNALFKKAV 436


>gi|32471725|ref|NP_864718.1| hypothetical protein RB2055 [Rhodopirellula baltica SH 1]
 gi|32397096|emb|CAD72400.1| conserved hypothetical protein [Rhodopirellula baltica SH 1]
          Length = 402

 Score =  128 bits (321), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 51/383 (13%), Positives = 118/383 (30%), Gaps = 40/383 (10%)

Query: 8   IRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMN 67
           ++N      G + +L  I LP++ ++   +I V+++  +      + D ++  A    + 
Sbjct: 29  LKNQPKQRSGAVIVLLVIMLPVLLILAAYVINVAYVEAVTADSQVVTDAAVCAAGRVYIQ 88

Query: 68  EGNGNNRKKLKGGDILCR--IKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNE 125
            G+ N                     ++  +          +D+      L       N 
Sbjct: 89  TGDKNAALAAARDAAERNPVAGKVVPINMSDLEFGISLRESLDEGYSFQPLSDDDEFGNA 148

Query: 126 GYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSME 185
               +          F    P    +  I        +V   T + +D+ +V+D S SM 
Sbjct: 149 VRLTTLSLSNSPQPVFSPLFPTMGTNLEI-----RPQRVAVSTQSTMDVALVIDRSGSMA 203

Query: 186 -------------------SFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
                                +   +      +  + ++      + D     +  L T+
Sbjct: 204 YANDEAPDPYVNPAAAPPGWTYGDPVPPNSRWLDLVASVNAFNGFLADSPQYEKLCLATY 263

Query: 227 SNKIEEFFLLEWGVSHLQRKIKYLSKF--GVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
           S+       L    + +  ++  +S    G  T+   GL++    + D            
Sbjct: 264 SDNASRDCDLTHTYAEISNQLDAISYQFNGGGTSVGYGLEHGLAVLTD-------ATHAR 316

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACAS--P 342
               +++V MTDG + + K  +   Y+    +  G  ++ I          +   A+   
Sbjct: 317 KFAVRVMVLMTDGHHNTGKSPESMTYH---LQNHGVTLFTITFSDDADQSRMSNLANACG 373

Query: 343 NSFYLVENPHSMYDAFSHIGKDI 365
              +   +   + +AF  I K +
Sbjct: 374 GENFHATDASQLQNAFQKIAKKL 396


>gi|315122479|ref|YP_004062968.1| von Willebrand factor type A [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495881|gb|ADR52480.1| von Willebrand factor type A [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 427

 Score =  128 bits (321), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 79/416 (18%), Positives = 165/416 (39%), Gaps = 50/416 (12%)

Query: 1   MFSLNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVH 60
           + +   N +    + K   +IL ++ L  I L +G++I V   +  K  + +    +++ 
Sbjct: 4   LRTFLFNFKKIILSPKANFSILFSVILISILLFIGILIYVLDYYHKKNAMENANTSAILS 63

Query: 61  AATQIMN------EGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRST 114
            A++I++      +   ++  +    D+   IK+    S   +      +++ + I +++
Sbjct: 64  GASKIISRISYFGDNMSSHTHRAIVDDVTRFIKSYIKESLLMD-SSVFDISEKNIISQNS 122

Query: 115 SLDIVVVP----------------QNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPI 158
            + I   P                +   Y IS  + Y   +KF   +     +  I+  +
Sbjct: 123 KVSITREPHPNVFHEFNNQSILQNKKTFYHISVETFYDYHIKFFDNLLNKKINSKIISFV 182

Query: 159 TSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSIT---------------KIDMAIKSIN 203
            + VK+++       + +V+D+S SM    +S                  K+D   K++ 
Sbjct: 183 PALVKIDTGEHPFFFVQLVVDLSASMSCLMNSDPEHATEFSVCGKSKKNSKMDALKKAVL 242

Query: 204 AMLEEVKL-IPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKI-KYLSKFGVS-TNST 260
             L+ V        +    GL  ++ ++E+     WG   +++ I + +    +  T+ST
Sbjct: 243 LFLDSVDRGSKTQKDTHYIGLTGYTTRVEKNIEPSWGTGKVRKYIVEEIDVNMLGQTDST 302

Query: 261 PGLKYAYNQIFDMQGMRQHCNTEDA-------NYKKIIVFMTDGENLSTKEDQQSLYYCN 313
           P +K AY  +   +      N            ++K ++F+TDGEN   K D +++  C 
Sbjct: 303 PAMKKAYQILTSDKKRNFIRNILHKRIKIPPLPFQKFLIFLTDGENNDPKSDVKTIKICE 362

Query: 314 EAKKRGAIVYAIGIRVIRS-HEFLRACAS-PNSFYLVENPHSMYDAFSHIGKDIVT 367
           +AKK    +  I I    +    L+ C S P  +Y V +  S+   F  I   I  
Sbjct: 363 KAKKNSIKILTISINASANGKRLLKKCVSAPEYYYNVVDTGSLLRVFQDISTLITH 418


>gi|39933553|ref|NP_945829.1| hypothetical protein RPA0476 [Rhodopseudomonas palustris CGA009]
 gi|39647399|emb|CAE25920.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009]
          Length = 443

 Score =  128 bits (320), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 51/437 (11%), Positives = 124/437 (28%), Gaps = 73/437 (16%)

Query: 2   FSLNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHA 61
            + + +I  F  + +G + ++ A+ L  +   +G  ++ S    +++ L +  D + V A
Sbjct: 1   MAFSRSIARFSRDRRGNIAVIFALVLVPLISAVGCAVDYSRANALRSKLQAAADAASVGA 60

Query: 62  ATQ-----IMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDI-VRSTS 115
            ++     +       +     G D   RI N            +          V ++ 
Sbjct: 61  VSRTSPAYVAAGAMSGDGVISSGADDALRIFNGNLNGLTGYTLASSSATVTKASDVVTSQ 120

Query: 116 LDIVVVPQNEGYSI----------SAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVN 165
           +            +          ++ +   +P K+  F     NS  + +  T +    
Sbjct: 121 VTFSAQISTMFMKVVGMSAMAVGGTSTATASMP-KYIDFYLLLDNSPSMGVGATPTDVSA 179

Query: 166 S-------QTDARLDMMIVLDVSRSMESFFD---SSITKIDMAIKSINAMLEEVKLIPDV 215
                    +D           +++            T+ID+   +   +++        
Sbjct: 180 MIAATANKSSDDHCAFACHDVNNKNNYYNLAKALGITTRIDVLRSATQQLMDTATATATY 239

Query: 216 NNVVQSGLVTFSNKIEEF--------FLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAY 267
           +N  +  +  F    +                       I  ++  G + N+     Y  
Sbjct: 240 SNQFRMAIYDFGASAQTAGLRNLFSLSASLSSAKTAASAIDLMTVKGQNDNNDQDTSYTA 299

Query: 268 NQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKE------------DQQSLYYCNEA 315
                   +    +    + +K + F++DG                      +   C   
Sbjct: 300 IFPAINNEISSPGSGVSGSPQKYLFFVSDGVADEYNPSCLKPKTGNRCQSPINPALCKTL 359

Query: 316 KKRGAIV---YAIGIRVIRSH-----------------------EFLRACASPNSFYLVE 349
           K RG  +   Y   + +  +                        + + ACASP  ++ V 
Sbjct: 360 KDRGIKIAVLYTTYLNLPSNDWYKKWIAPFNAGPYGPSPNSEIAQNMEACASPGFYFEVS 419

Query: 350 NPHSMYDAFSHIGKDIV 366
               + +A + + K  V
Sbjct: 420 PTQGIAEAMNALFKKAV 436


>gi|327193254|gb|EGE60160.1| hypothetical protein RHECNPAF_1700073 [Rhizobium etli CNPAF512]
          Length = 457

 Score =  127 bits (319), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 41/309 (13%), Positives = 107/309 (34%), Gaps = 14/309 (4%)

Query: 3   SLNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAA 62
            L    R+   +  G + I+ A+ L  + + +G   +    + ++  + S +D +L+ A 
Sbjct: 24  RLVRAFRSLGRDRTGNVAIVVALSLVPMLVAVGASFDYIRSYNVRQRMQSDLDAALIAAV 83

Query: 63  TQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVP 122
            QI N  + +  K+        +++N++ +        N  +        +     + + 
Sbjct: 84  KQINNSEDTDALKQKVYDWFHAQVENSYALGEIEIDTTNHNITATASG--TVPTTFMKIA 141

Query: 123 QNEGYSISAISRYKIP-LKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMI----- 176
             +   +S  S  K P   +         S  +++  T+S +    +             
Sbjct: 142 NIDTVPVSVGSAVKGPATSYLNVYIVIDRSPSMLLAATTSGQSTMYSGIGCQFACHTGDA 201

Query: 177 --VLDVSRSMESFF---DSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
             V   + +    +    +   + D+A  ++  +L+ +      +  ++ GL +  +  +
Sbjct: 202 HTVGKKTYANNYDYSTEKNIKLRADVAGDAVREVLDMIDESDSNHERIKVGLYSLGDTTK 261

Query: 232 EFFLLEWGVSHLQRKIKYLSKF-GVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKI 290
           E        S+ ++++   S     +T+                       T  AN  K+
Sbjct: 262 EVLAPTLDTSNARKRLSDDSYGLTSATSMNYTYFDVALAALQKIVGTGGDGTSSANPLKL 321

Query: 291 IVFMTDGEN 299
           ++ +TDG  
Sbjct: 322 VLLLTDGVQ 330


>gi|315122199|ref|YP_004062688.1| hypothetical protein CKC_02245 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495601|gb|ADR52200.1| hypothetical protein CKC_02245 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 463

 Score =  126 bits (317), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 77/452 (17%), Positives = 159/452 (35%), Gaps = 86/452 (19%)

Query: 3   SLNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAA 62
           SL  N +     Y G   +++A+ LP+IF+V+G++I++    +    L   ++ + + A+
Sbjct: 6   SLFFNFKRLKKCYNGSFFVISALLLPVIFMVIGLLIDLVRWGYYHNSLVQAVNTAALSAS 65

Query: 63  TQIMNEGNGNN---------RKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRS 113
            Q++N     +          +      +L  +K +   +F          +   +I   
Sbjct: 66  VQLLNSVEDKSKEKALSSVLGENNIKQYLLNNLKISLYNNFGEMDSQRIIQHTKVNIYNR 125

Query: 114 TSLDIVVVP------------------QNEGYSISAISRYKIPLK-------FCTFIPWY 148
               I+ V                     + + I+ +   ++  K         +     
Sbjct: 126 KGTHIINVYSHYNLPLNPFSLFFMNLINIKSWPITTVGEAEVTSKKNYHKEEGVSVQWLI 185

Query: 149 TNSRHIVMPIT----SSVKVNSQTDARLDMMIV----LDVSRSME--------------- 185
            +S  +   I      S ++ SQ +    + IV     D S S                 
Sbjct: 186 DDSGSMGSIIDRACFGSKQLKSQYNVGSKIGIVRNENADTSDSFYPIVGELVSCDRSLYY 245

Query: 186 -------------------SFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
                              +     I K  +   ++   ++ V+ I ++ + ++   + F
Sbjct: 246 VLNDKKILEDDDLEEKNLDNHSQYYIRKRYLVRDALATFIKRVRKIDNLKDKLRMSFMYF 305

Query: 227 SNKIEEFFLLEWGVSHLQRKIKYL---SKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           + +I+ +F + WG+   ++++           +T+  P L+ AYN++       +H    
Sbjct: 306 NERIDHYFPMTWGIKEFKQEVSSHYKRKHENTATDIHPILQEAYNKLHSKNEDDEHKKKN 365

Query: 284 DANYKKIIVFMTDGENLST-KEDQQSLYYCNEAKKRGAIVYAIGIRVIRSH-----EFLR 337
               KK IV +TDG            L  C+ AK+ G  ++ I   V  S      +FL 
Sbjct: 366 SVEVKKFIVLLTDGAQNEGVHSVDSVLKICDAAKEEGIKIFTISYSVDSSERKKANDFLS 425

Query: 338 ACASPNSFYLVENPHSMYDAFSH-IGKDIVTK 368
            CASP+ F+   +   +   F   IG  I  +
Sbjct: 426 RCASPDKFFEAYDADKLNMIFKEHIGDAIFER 457


>gi|222087111|ref|YP_002545646.1| hypothetical protein Arad_3867 [Agrobacterium radiobacter K84]
 gi|221724559|gb|ACM27715.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 401

 Score =  126 bits (317), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 68/400 (17%), Positives = 139/400 (34%), Gaps = 36/400 (9%)

Query: 5   NLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQ 64
             ++    ++  G   ILTAI +P++    G+ ++V+++    + L    D     A   
Sbjct: 8   FRSLIQLIHDRTGNFGILTAIAIPVVAATAGVAVDVTNMTVSNSQLQQATDA---AALAT 64

Query: 65  IMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQN 124
                NGN             +    +     +      +        +           
Sbjct: 65  ATALANGNATTSNAQQLATQFVTGQMSNYLSGDTNTADALKA---GTTANVTSATNSSGG 121

Query: 125 EGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSM 184
             Y+++  + Y + +   + +             ++S    +   A L M I LD S SM
Sbjct: 122 TSYTVAVNASYDMSVNGMSQLLGIKTMHVSAASTSTSGSAAAAKQAALSMEIALDKSGSM 181

Query: 185 ----------------------------ESFFDSSITKIDMAIKSINAMLEEVKLIPDVN 216
                                       ++     I KI     ++  +L+++      +
Sbjct: 182 LLNTDVIDTSQKSCTQYYTEGNYLYQYPKAKSPCYIKKIAALKTAVGTLLDQLDSADPKS 241

Query: 217 NVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGM 276
             V++  + +S++++    L WG +  +  +         T S+  +  AY  +      
Sbjct: 242 QYVRTAAIAWSSEVDSSSALAWGTTTTRSNVISGLNANGGTESSAPMALAYKNVSASSEA 301

Query: 277 RQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR-SHEF 335
                  +  ++KIIV MTDGEN +T  D ++L  C  AK  G ++Y++           
Sbjct: 302 TAQAAKGNTTFQKIIVLMTDGENNATSSDTKTLATCKAAKDAGVLIYSVAFMAPDRGQTL 361

Query: 336 LRACA-SPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYDK 374
           L+ CA SP++++  +    +  AF  IG     +     K
Sbjct: 362 LKNCASSPSNYFDAQQMSDLIAAFKTIGNQASKQITLLTK 401


>gi|222529355|ref|YP_002573237.1| von Willebrand factor type A [Caldicellulosiruptor bescii DSM 6725]
 gi|222456202|gb|ACM60464.1| von Willebrand factor type A [Caldicellulosiruptor bescii DSM 6725]
          Length = 1188

 Score =  125 bits (314), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 53/308 (17%), Positives = 102/308 (33%), Gaps = 32/308 (10%)

Query: 69  GNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRST-SLDIVVVPQNEGY 127
           G  +    ++             +        +     +  +     +   +     +  
Sbjct: 395 GIVSTPVDIEVYAPFKEATVFIPIDTSKIPNQDFQNVKMFYLDEDLMTFVPLDEQGVDPV 454

Query: 128 SISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESF 187
           +    ++      F  F    T      +PI    +  +Q    +D++ VLD S SM   
Sbjct: 455 NKVVWAKTNHFTTFVLFYIP-TWKAIWEVPINKGEREINQQVNYIDLVFVLDSSGSMSWN 513

Query: 188 FDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKI 247
             +   KI  A   ++A+++            ++ +V F N       L      ++  I
Sbjct: 514 DPNGYRKI-AAKSFVDALIQ----------GDRAAVVDFDNFGYLLQPLTTDFQAVKNAI 562

Query: 248 KYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQ 307
             +  +G  TN   G++ A          +Q  +    +  K+I+ +TDGE         
Sbjct: 563 DRIDSWG-GTNIAEGIRIA---------NQQLISRSSEDRIKVIILLTDGEGYYDNN--- 609

Query: 308 SLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                 EAK  G  +Y IG+        LR  A  +   ++ V +   +   F  I  +I
Sbjct: 610 ---LTTEAKNNGITIYTIGLGTSVDENLLRDIATQTGGMYFPVSSASQLPQVFKRI-TEI 665

Query: 366 VTKRIWYD 373
           VT+ I  D
Sbjct: 666 VTEPIDTD 673


>gi|190894968|ref|YP_001985261.1| hypothetical protein RHECIAT_PC0000634 [Rhizobium etli CIAT 652]
 gi|190700629|gb|ACE94711.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 444

 Score =  125 bits (314), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 41/309 (13%), Positives = 105/309 (33%), Gaps = 14/309 (4%)

Query: 3   SLNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAA 62
            L    R+   +  G + I+ A+ L  + + +G   +    + ++  + S +D +L+ A 
Sbjct: 11  RLVRAFRSLGRDRTGNVAIVVALSLVPMLVAVGASFDYIRSYNVRQRMQSDLDAALIAAV 70

Query: 63  TQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVP 122
            QI N  + +  K+        +++N++ +        N  +        +     + + 
Sbjct: 71  KQINNSEDTDALKQKVSDWFHAQVENSYALGEIEIDTTNHNITATASG--TVPTTFMKIA 128

Query: 123 QNEGYSISAISRYKIP-LKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVS 181
             +   +S  S  K P   +         S  +++  T+S +    +            +
Sbjct: 129 NIDTVPVSVGSAVKGPATSYLNVYIVIDRSPSMLLAATTSGQSTMYSGIGCQFACHTGDA 188

Query: 182 R----------SMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
                         S   +   + D+A  ++  +L+ +      +  ++ GL +  +  +
Sbjct: 189 HTVGKKTYANNYDYSTEKNIKLRADVAGDAVREVLDMIDESDSNHERIKVGLYSLGDTTK 248

Query: 232 EFFLLEWGVSHLQRKIKYLSKF-GVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKI 290
           E        S+ ++++   S     +T+                       T  AN  K+
Sbjct: 249 EVLAPTLDTSNARKRLSDDSYGLTSATSMNYTYFDVALAALQKIVGTGGDGTSSANPLKL 308

Query: 291 IVFMTDGEN 299
           ++ +TDG  
Sbjct: 309 VLLLTDGVQ 317


>gi|312622403|ref|YP_004024016.1| von willebrand factor type a [Caldicellulosiruptor kronotskyensis
           2002]
 gi|312202870|gb|ADQ46197.1| von Willebrand factor type A [Caldicellulosiruptor kronotskyensis
           2002]
          Length = 1166

 Score =  125 bits (314), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 52/308 (16%), Positives = 102/308 (33%), Gaps = 32/308 (10%)

Query: 69  GNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRST-SLDIVVVPQNEGY 127
           G  +    ++             +        +     +  +     +   +     +  
Sbjct: 395 GIVSTPVDIEVYAPFKEATVFIPIDTSKIPNQDFQNVKMFYLDEDLMTFVPLDEQGVDPV 454

Query: 128 SISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESF 187
           +    ++      F  F    T      +PI    +  +Q    +D++ VLD S SM   
Sbjct: 455 NKVVWAKTNHFTTFVLFYIP-TWKAIWEVPINKGEREINQQINYIDLVFVLDSSGSMSWN 513

Query: 188 FDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKI 247
             +   KI  A   ++A+++            ++ +V F +       L      ++  I
Sbjct: 514 DPNGYRKI-AAKSFVDALIQ----------GDRAAVVDFDDFGYLLQPLTTDFQAVKNAI 562

Query: 248 KYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQ 307
             +  +G  TN   G++ A          +Q  +    +  K+I+ +TDGE         
Sbjct: 563 DRIDSWG-GTNIAEGIRIA---------NQQLISLSSEDRIKVIILLTDGEGYYDNN--- 609

Query: 308 SLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                 EAK  G  +Y IG+        LR  A  +   ++ V +   +   F  I  +I
Sbjct: 610 ---LTTEAKNNGITIYTIGLGTSVDENLLRDIATQTGGMYFPVSSASQLPQVFKRI-TEI 665

Query: 366 VTKRIWYD 373
           VT+ I  D
Sbjct: 666 VTEPIDTD 673


>gi|325279872|ref|YP_004252414.1| von Willebrand factor type A [Odoribacter splanchnicus DSM 20712]
 gi|324311681|gb|ADY32234.1| von Willebrand factor type A [Odoribacter splanchnicus DSM 20712]
          Length = 330

 Score =  124 bits (312), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 40/234 (17%), Positives = 74/234 (31%), Gaps = 46/234 (19%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           SS    + T   +D+ + LDVS SM +    +  +++ A +     + E           
Sbjct: 79  SSNSWQTYTSEGIDIALALDVSTSMLARDF-TPDRLEAAKEVATKFILE-------RPQD 130

Query: 220 QSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFG--VSTNSTPGLKYAYNQIFDMQGMR 277
           + GLV F+ +      L    + L   ++ +        T    GL  A N         
Sbjct: 131 KIGLVVFAGESFTQCPLTTDQAVLVNLLREVKSGMIQDGTAIGLGLANAVN--------- 181

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV-------- 329
                +     K+++ +TDG N         +     AK  G  VY IG+          
Sbjct: 182 --RLKDSPGKSKVVILLTDGINNQGAI--APVTAAELAKAFGIRVYTIGVGTYGEAPYPV 237

Query: 330 -------------IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                              L+  A  +   ++   +   +   +S I +   +K
Sbjct: 238 PTPFGVQLQNMPVEIDEGVLQQIANVTGGKYFRATDNDKLQQIYSEIDQLEKSK 291


>gi|316931543|ref|YP_004106525.1| hypothetical protein Rpdx1_0148 [Rhodopseudomonas palustris DX-1]
 gi|315599257|gb|ADU41792.1| Protein of unknown function DUF2134, membrane [Rhodopseudomonas
           palustris DX-1]
          Length = 443

 Score =  124 bits (312), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 55/436 (12%), Positives = 120/436 (27%), Gaps = 71/436 (16%)

Query: 2   FSLNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHA 61
            +    I  F  + +G + ++ A+ L  +   +G  ++ S    ++T L +  D + V A
Sbjct: 1   MAFAEAIARFHRDRRGNIAVIFALVLIPLISAIGCAVDYSRANALRTKLQAAADAASVGA 60

Query: 62  ATQ-----IMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVR-STS 115
            ++     I       +     G D   RI N    +      D+            ++ 
Sbjct: 61  VSRTSPAYIAAGSMSTDGAITSGADDALRIFNGNLANLTGYTLDSVAATVSKSGEAVTSK 120

Query: 116 LDIVVVPQNEGYSISAISRYKIPL---------KFCTFIPWYTNSRHIVMPITSSVKVNS 166
           +              A+S   +           K+  F     NS  + +  T +     
Sbjct: 121 VTFSAQISTMFMKAVAVSSMTVGGVSTATASMPKYIDFYLLLDNSPSMGVGATPTDVAAM 180

Query: 167 -------QTDARLDMMIVLDVSRSMESFFD---SSITKIDMAIKSINAMLEEVKLIPDVN 216
                   +D           +++            T+ID+   +   +++         
Sbjct: 181 VAATANKSSDDHCAFACHDVNNKNNYYNLAKALGITTRIDVLRSATQQLMDTAAATATYT 240

Query: 217 NVVQSGLVTFSNKIEE--------FFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYN 268
           N  +  +  F    +                       I  ++  G + N+    +Y   
Sbjct: 241 NQFRMAIYDFGASAQTAGLRNLFALSASLSSAKTAAGAIDLMTVKGQNDNNDQDTQYTAI 300

Query: 269 QIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKE------------DQQSLYYCNEAK 316
                + +         +  K + F++DG                      +   C   K
Sbjct: 301 LPAIDKLIAAPGTGAAGSPLKYLFFVSDGVADEYNPACLKPKTGNRCQSPINPALCKTLK 360

Query: 317 KRGAIV---YAIGIRVIRSHEF-----------------------LRACASPNSFYLVEN 350
            RG  V   Y   + +  +  +                       + ACASP  ++ V  
Sbjct: 361 DRGVRVAVLYTTYLDLPSNDWYKKWIAPFNEGPYGPSPNSEIAKNMEACASPGFYFEVSP 420

Query: 351 PHSMYDAFSHIGKDIV 366
              + +A + + K  V
Sbjct: 421 TQGIAEAMNALFKRAV 436


>gi|86131264|ref|ZP_01049863.1| aerotolerance-related exported protein BatA [Dokdonia donghaensis
           MED134]
 gi|85818675|gb|EAQ39835.1| aerotolerance-related exported protein BatA [Dokdonia donghaensis
           MED134]
          Length = 334

 Score =  124 bits (311), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 43/242 (17%), Positives = 82/242 (33%), Gaps = 49/242 (20%)

Query: 154 IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
           +  P    V   ++T   +D++I +DVS SM +       +++   K  ++ +       
Sbjct: 74  LARPRNVEVSTKTKTTKGIDIVIAIDVSASMLAKDL-RPNRLEALKKVASSFI------- 125

Query: 214 DVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFG---VSTNSTPGLKYAYNQI 270
           +     + GLV ++ +      +    S +   +K +         T    GL    N+I
Sbjct: 126 NGRPNDRIGLVEYAGESFTKTPITSDKSIVLSALKGIQYNSIIEGGTAIGMGLATGVNRI 185

Query: 271 FDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI 330
                       +     K+I+ MTDGEN + + D +       A++ G  VY IG+   
Sbjct: 186 -----------KDSKALSKVIILMTDGENNAGQIDPRI--AAELAQEFGIKVYTIGMGTN 232

Query: 331 -----------------------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                                     E L   A  +   ++   N   + + +  I K  
Sbjct: 233 GTALSPYARNPNGTFVYENIQVTIDEELLEEIAETTGGQYFRATNNKKLQEIYDEIDKLE 292

Query: 366 VT 367
            T
Sbjct: 293 RT 294


>gi|325106974|ref|YP_004268042.1| von Willebrand factor A [Planctomyces brasiliensis DSM 5305]
 gi|324967242|gb|ADY58020.1| von Willebrand factor type A [Planctomyces brasiliensis DSM 5305]
          Length = 396

 Score =  124 bits (311), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 46/386 (11%), Positives = 118/386 (30%), Gaps = 46/386 (11%)

Query: 15  YKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNR 74
            +G M +L A  L ++ +++    +V+++  ++T LH   D +       +    +    
Sbjct: 16  RRGAMLVLIAALLSVMLILVVFTTDVAYMQLVRTQLHVSTDAAAKAGMEALARTESRGQA 75

Query: 75  KKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISR 134
           + +        +     +   N+  + G  +   D       +       +   IS    
Sbjct: 76  RVVAKDIFSKNLIGGRELKLHNKDIEFGRTDANPDGTWEFLPN---ERPFQAIRISVNLD 132

Query: 135 YKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSM---------- 184
                     +P       +     ++   +   +   ++++ LD S SM          
Sbjct: 133 DNRQKGRNGSVPLLFGKV-LGQSSFATNHSSVAANLVHEIVLCLDRSHSMCFDETGVDYA 191

Query: 185 ------------ESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
                        +  +   ++      +I   ++ +  +  V +    G+VT+ + I  
Sbjct: 192 YPPGTPSYPAGYITPPNPVGSRWAKLQGAIQVFVDTLDDLQIVPD---VGVVTWGSDITL 248

Query: 233 FFLLEWGVSHLQRKIKYLSKFGVSTN---------STPGLKYAYNQIFDMQGMRQHCNTE 283
            +            +      G + N             +    N    +          
Sbjct: 249 SWSWYPFQGRSFPAVMVDVPLGQNLNLVSPAIAAKLGDIMMGGTNMSSGIDRSVSLLTAN 308

Query: 284 DAN--YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA- 340
             +   +K I+ M+DG+  + +     L   N+A  +   ++ I   +      +R  A 
Sbjct: 309 GTHSLAQKTIILMSDGQWNAGR---NPLDAANDAADKNITIHTIAF-LNGDQSVMRQIAE 364

Query: 341 -SPNSFYLVENPHSMYDAFSHIGKDI 365
            +   F+   +  S+ D F  + K +
Sbjct: 365 RTGGKFFNAPDGESLEDTFKELAKML 390


>gi|86134839|ref|ZP_01053421.1| aerotolerance-related membrane protein [Polaribacter sp. MED152]
 gi|85821702|gb|EAQ42849.1| aerotolerance-related membrane protein [Polaribacter sp. MED152]
          Length = 336

 Score =  124 bits (310), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 41/236 (17%), Positives = 80/236 (33%), Gaps = 49/236 (20%)

Query: 161 SVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQ 220
           SV   ++T+  +D+++ +DVS SM +       +++   K     +       D     +
Sbjct: 83  SVSKRTKTNRGIDIVMAIDVSASMLARDLK-PNRLEALKKVAVDFV-------DRRPNDR 134

Query: 221 SGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFG--VSTNSTPGLKYAYNQIFDMQGMRQ 278
            G+V ++ +      +    + ++R I  L        T    G            G R 
Sbjct: 135 IGIVVYAGESFTQTPITSDKTIVKRTINRLQWGQLEGGTAIGMG-----------LGSRV 183

Query: 279 HCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI-------- 330
           +   +     K+I+ +TDG N +   D  +      AK+ G  VY IGI           
Sbjct: 184 NRLKDSKAKSKVIILLTDGVNNAGNIDPTT--ATELAKELGIKVYTIGIGTNGMADFPWS 241

Query: 331 ----------------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                              + L+  A  +   ++   +  S+ + +  I     TK
Sbjct: 242 KDPRTGMLNFRKQQVQIDEDLLKNIAEETQGKYFRATDNTSLKEIYDEIDALEKTK 297


>gi|332291974|ref|YP_004430583.1| von Willebrand factor type A [Krokinobacter diaphorus 4H-3-7-5]
 gi|332170060|gb|AEE19315.1| von Willebrand factor type A [Krokinobacter diaphorus 4H-3-7-5]
          Length = 334

 Score =  124 bits (310), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 41/242 (16%), Positives = 79/242 (32%), Gaps = 49/242 (20%)

Query: 154 IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
           +  P    V   ++T   +D++I +DVS SM +       +++   K   + +       
Sbjct: 74  LARPRNVEVSTKTKTTKGIDIVIAIDVSASMLAKDL-RPNRLEALKKVAASFI------- 125

Query: 214 DVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFG---VSTNSTPGLKYAYNQI 270
           +     + GL+ ++ +      +    S +   +K +         T    GL    N  
Sbjct: 126 NGRPNDRIGLIEYAGESFTKTPITSDKSIVLSALKSIQYNNIIEGGTAIGMGLATGVN-- 183

Query: 271 FDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI 330
                       +     K+I+ MTDGEN + + D +       A++ G  VY IG+   
Sbjct: 184 ---------RLKDSKALSKVIILMTDGENNAGQIDPRI--AAELAQEFGIKVYTIGMGTN 232

Query: 331 -----------------------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                                     E L   A  +   ++   N   + + +  I K  
Sbjct: 233 GMALSPYARNANGTFVYENIQVTIDEELLEEIAATTGGQYFRATNNEKLQEIYDEIDKLE 292

Query: 366 VT 367
            T
Sbjct: 293 RT 294


>gi|86361153|ref|YP_473040.1| hypothetical protein RHE_PF00423 [Rhizobium etli CFN 42]
 gi|86285255|gb|ABC94313.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 545

 Score =  123 bits (307), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 40/309 (12%), Positives = 110/309 (35%), Gaps = 14/309 (4%)

Query: 3   SLNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAA 62
            +   +R+   +  G + I+ A+ L  + + +G   +    + ++  + S +D +L+ A 
Sbjct: 102 RITGALRSLERDRGGNVGIVVALSLVPMLVAVGASFDYIRSYNVRQRMQSDLDAALIAAV 161

Query: 63  TQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVP 122
            QI N  + +  K+        ++ N++ +   +    N  +    +   +     + + 
Sbjct: 162 KQINNTEDTDALKEKVSDWFHAQVDNSYTLGDIDIDTVNHNITATANG--TVPTTFMKIA 219

Query: 123 QNEGYSISAISRYKIP-LKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIV---- 177
             E   +S  S  K P   +         S  +++  T+S +    +             
Sbjct: 220 NIETVPVSVASAVKGPATSYLNVYVVIDTSPSMLLAATTSGQSTMYSGIGCQFACHTGDA 279

Query: 178 --LDVSRSMESFFDSSITKI----DMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
             +  ++   ++  S+  KI    D+A  ++  +L+ +    + +  ++ GL +  + + 
Sbjct: 280 HTVGKTKYANNYAYSTAKKIKLRADVAGDAVREVLDMIDESDENHERIKVGLYSLGDTLS 339

Query: 232 EFFLLEWGVSHLQRKIKYLSKF-GVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKI 290
           E           + ++   S     +T+               +       T   +  K+
Sbjct: 340 EVLAPTLSTDTARTRLADASYGLTSATSKAATYFDVSLATLKQKVGAGGDGTSSGSPLKL 399

Query: 291 IVFMTDGEN 299
           ++ +TDG  
Sbjct: 400 VLLLTDGVQ 408


>gi|146338996|ref|YP_001204044.1| hypothetical protein BRADO1945 [Bradyrhizobium sp. ORS278]
 gi|146191802|emb|CAL75807.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278]
          Length = 432

 Score =  122 bits (306), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 51/413 (12%), Positives = 116/413 (28%), Gaps = 56/413 (13%)

Query: 8   IRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMN 67
           +  F  N  G + ++ AI L  I   +G  I+ S     K  L + ID +L+ A      
Sbjct: 11  LSRFRRNDSGNIAVIFAIALLPILAFIGSAIDYSMAVRAKAKLSASIDAALLAATGYTAM 70

Query: 68  EGNGNNRKKLKGGDILCRI-KNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEG 126
            G+ ++ K         ++  +    +  +    +           +  +    +     
Sbjct: 71  RGSSSDAKTAATNMFNGQMSAHKLTSNSLSIDITDSVSARTVTGSATVVVKTSFMYMFGY 130

Query: 127 YSISAISRYKIPLKF---CTFIPWYTNSRHIVMPITSSVKVNSQT--DARLDMMIV---- 177
            +++  +       F     F     NS    +  T++     Q                
Sbjct: 131 PTMTVSASSSASASFPTYMDFYVLVDNSPSQGLGATTADMTTLQNATTDTCAFACHDTYT 190

Query: 178 -------LDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN-- 228
                     S   ++       +ID+   +  ++ +       V+N  +  + +     
Sbjct: 191 SSSKKTLQTNSYYDKAKKLGVTMRIDVVRSATQSLTDTATSSQIVSNQYRMAVYSMGADC 250

Query: 229 ------KIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
                  +         V      +  ++      N+     +          +    + 
Sbjct: 251 GSLGLTTVASLSSSMSSVKSSVGALDLMTIPYSGYNNDMCTDFDGTMSAMSGVIPTQGDG 310

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSL--------------YYCNEAKKRGAIV---YA- 324
              N +K + F++DG          S                 C   K RG  +   Y  
Sbjct: 311 SSTNPQKWLFFVSDGVADYAYPTTCSKTTQSGGRCVEPLTTTTCTALKARGIKIAVLYTT 370

Query: 325 -IGIRVIRSHEF------------LRACASPNSFYLVENPHSMYDAFSHIGKD 364
            + I     +              +++CASP  +Y V++  S+  A + + + 
Sbjct: 371 YLAITSNGYYNTWVKPWRDSIGTIMKSCASPGYYYEVDSSGSIGSALTALFQQ 423


>gi|218509981|ref|ZP_03507859.1| hypothetical protein RetlB5_22275 [Rhizobium etli Brasil 5]
          Length = 448

 Score =  122 bits (306), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 36/306 (11%), Positives = 107/306 (34%), Gaps = 16/306 (5%)

Query: 7   NIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIM 66
            +R+   +  G + I+ A+ L  + + +G   +    + ++  + S +D +L+ A  QI 
Sbjct: 12  TLRSLGRDRTGNVAIVVALSLVPMLVAVGASFDYIRSYNVRQRMQSDLDAALIAAVKQIN 71

Query: 67  NEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEG 126
           N  + +  K+        +++N++ +        N  +        +     + +   + 
Sbjct: 72  NTEDTDALKQKVSDWFHAQVENSYALGEIEIDTTNHNITATASG--TVPTTFMKIANIDT 129

Query: 127 YSISAISRYKIP-LKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSR--- 182
             +S  S  K P   +         S  +++  T++ +    +  +         +    
Sbjct: 130 VPVSVASAVKGPATSYLNVYIVVDTSPSMLLAATTAGQSTMYSGIKCQFACHTGDTHTIG 189

Query: 183 -------SMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFL 235
                     S       + D+A  ++  +L+ +      +  ++ GL    + + E   
Sbjct: 190 KKTYANNYDYSTEKGIKLRADVAGDAVREVLDMIDESDSNHERIKVGLYGLGDTLTEVLA 249

Query: 236 LEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN--YKKIIVF 293
                   + ++   S +G+++ ++    Y    +  ++           +    K+++ 
Sbjct: 250 PTLSTDIARTRLAD-SSYGLTSATSKAATYFDVSLATLKQKVGAGGDGTTSGTPLKLVLL 308

Query: 294 MTDGEN 299
           +TDG  
Sbjct: 309 LTDGVQ 314


>gi|148258759|ref|YP_001243344.1| hypothetical protein BBta_7591 [Bradyrhizobium sp. BTAi1]
 gi|146410932|gb|ABQ39438.1| hypothetical protein BBta_7591 [Bradyrhizobium sp. BTAi1]
          Length = 449

 Score =  122 bits (306), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 57/447 (12%), Positives = 124/447 (27%), Gaps = 86/447 (19%)

Query: 1   MFSLNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVH 60
           M  L+  +  F  + +G + +  AI    +   +G  ++ S    ++  L S +D + V 
Sbjct: 1   MRMLSSLLARFRSDIQGNVAVTFAIVCVPLITAVGCGVDYSRANQLRAKLQSAVDAASVG 60

Query: 61  AATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVV 120
           A ++                D +    N    +  N   +      ++ +         V
Sbjct: 61  AVSR---TSPAFIAAGAMTADGIITAGNDDARNIFNGNMNGTTGYTLNSVTPEVKKTGSV 117

Query: 121 VPQNEGYSISA-------------------ISRYKIPLKFCTFIPWYTNSRHIVMPITSS 161
           +     +S S                     +   +P K+  F     NS  + +  T  
Sbjct: 118 LTATVSFSASVPMMFMNIVGIKTMTLQGMSKATASMP-KYIDFYLLLDNSPSMGVAATPD 176

Query: 162 VKVNSQTDAR---------LDMMIVLDVSRSME----SFFDSSITKIDMAIKSINAMLEE 208
                                     D + S      +      T+ID+   +   +++ 
Sbjct: 177 DVTKMVNATSDAKYGSNRYCAFACH-DYNDSNNFYNLAKSIGVTTRIDVLRSATQQLMDT 235

Query: 209 VKLIPDVNNVVQSGLVTFSNKIEE-----FFLLEWGVSHLQRKIKYLSKFG--VSTNSTP 261
                   N  +  +  F    +       F L   +S  +     +   G   + ++  
Sbjct: 236 ATQTQTYPNQFRMAIYDFGAASKTIGLRALFALSANLSSAKSAAGNIDLMGVYGNNDAYT 295

Query: 262 GLKYAYNQIFDMQGMRQHCNTEDA---NYKKIIVFMTDGENLSTK-------------ED 305
             K             +     D    +  K + F++DG    +              + 
Sbjct: 296 ADKDTPFTAVFPAVNNEISTPGDGTTGSPLKYLFFVSDGVADESNAACLKPKASGNRCQS 355

Query: 306 QQSLYYCNEAKKRGAIV---YAIGIRVIRSH-----------------------EFLRAC 339
             +   C   K RG  +   Y   +++  +                        + ++AC
Sbjct: 356 PINPALCTTLKNRGIKIAVLYTTYLQLPTNSWYMSWIDPFNKGPFGPSPNSEIAQNMQAC 415

Query: 340 ASPNSFYLVENPHSMYDAFSHIGKDIV 366
           ASP  ++ V     + DA + + K  V
Sbjct: 416 ASPGFYFEVSPTQGIADAMNALFKKAV 442


>gi|152990340|ref|YP_001356062.1| von Willebrand factor type A domain-containing protein
           [Nitratiruptor sp. SB155-2]
 gi|151422201|dbj|BAF69705.1| von Willebrand factor type A domain protein [Nitratiruptor sp.
           SB155-2]
          Length = 289

 Score =  122 bits (305), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 40/208 (19%), Positives = 66/208 (31%), Gaps = 25/208 (12%)

Query: 162 VKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQS 221
             +        D+++ LD S SME       +K ++          +             
Sbjct: 67  SSIKLDDRKGRDLVLALDASGSMEESLYDEKSKFEVVKSMAQNFFHK-------RFDDNI 119

Query: 222 GLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKF--GVSTNSTPGLKYAYNQIFDMQGMRQH 279
           G+V F +       L +    L   I YL     G +T    GL                
Sbjct: 120 GIVIFGSFAYIAAPLTYDTKALDFLINYLEPSIAGNNTAIGEGLWQGIK----------- 168

Query: 280 CNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRAC 339
               D   +K+++ +TDG + S            +AKK G  +Y IG+        L   
Sbjct: 169 ALQADTAKQKVLILITDGHHNSGSIS--PRQAVEKAKKLGIKIYTIGLG-DADKHLLEQI 225

Query: 340 A--SPNSFYLVENPHSMYDAFSHIGKDI 365
           A  S   F+  ++   +   FS + K  
Sbjct: 226 AKESGGKFFYAKSEEDLQSIFSELNKLE 253


>gi|228472814|ref|ZP_04057572.1| BatA protein [Capnocytophaga gingivalis ATCC 33624]
 gi|228275865|gb|EEK14631.1| BatA protein [Capnocytophaga gingivalis ATCC 33624]
          Length = 332

 Score =  121 bits (304), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 41/242 (16%), Positives = 83/242 (34%), Gaps = 48/242 (19%)

Query: 154 IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
           +  P +SS    ++T   +D+++ +D+S SM +       +I+   +     +++     
Sbjct: 73  LARPRSSSEITKTKTTEGIDIILSIDMSSSMLAKDLK-PNRIEALKRVAAQFIQQ----- 126

Query: 214 DVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSK--FGVSTNSTPGLKYAYNQIF 271
                 + G+V +S +           S + + +K + +      T    GL  A N   
Sbjct: 127 --RASDRIGIVVYSGESYTKVPATTDKSIVLQALKEIRQGEIEDGTAIGMGLGTAIN--- 181

Query: 272 DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI- 330
                      +     K+I+ MTDG N +   D   L     AK+ G  VY IGI    
Sbjct: 182 --------RLKDSKTKSKVIILMTDGVNNTGVID--PLSAAELAKEYGIRVYTIGIGTNG 231

Query: 331 ----------------------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIV 366
                                    + L   +  +   ++   + + +   ++ I K   
Sbjct: 232 KALSPVAYNPDGSFQYDMVPVEIDEKLLAEISKITGGKYFRATDNNKLAQIYTEIDKLEK 291

Query: 367 TK 368
           +K
Sbjct: 292 SK 293


>gi|91977525|ref|YP_570184.1| hypothetical protein RPD_3057 [Rhodopseudomonas palustris BisB5]
 gi|91683981|gb|ABE40283.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB5]
          Length = 464

 Score =  121 bits (304), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 57/451 (12%), Positives = 122/451 (27%), Gaps = 92/451 (20%)

Query: 9   RNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNE 68
             F  +  G + ++ A+ L  I   +G  I+ S     +T + + +D + +  +  +  +
Sbjct: 15  SRFVGDDGGNIAVIFALTLLPILGFIGAAIDYSRASRARTAMQAALDSTALMVSKDLGAD 74

Query: 69  GNGNNRKKLKGGDIL------CRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVP 122
               +    K              +     +      D+G    + +   + S   + + 
Sbjct: 75  KIKTSEVSEKAQTYFNSLYTGTEARGVTLTTNYTAKDDSGSSTVVVNGDGAVSTHFMKMF 134

Query: 123 QNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITS----------------SVKVNS 166
                +I + +                 +  +V+  ++                     S
Sbjct: 135 GFPSLAIGSAATATWGGTRLRVAMALDVTGSMVLNGSTKLAEMKKAASALVDTLRASAQS 194

Query: 167 QTDARLDMMIV---LDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGL 223
           + D  + ++     ++V  S            D      +    + K   D  +  ++  
Sbjct: 195 KDDLYISVVPFAQMVNVGSSNIDASWIKWDVWDE--TEGSCSKSKFKTKTDCEDNGRTWT 252

Query: 224 VTFSNK-------------------------------------------IEEFFLLEWGV 240
           VT  +K                                                      
Sbjct: 253 VTDRSKWKGCVTDRDQPADTTKDAPTSDDTRFPALRTLLGTTSCPAQIFPMTSAYAATDA 312

Query: 241 SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENL 300
             ++  I  L   G  TN   G+ +A+  +     +       +  Y   I+ ++DG N 
Sbjct: 313 QKIKDVIDDLVADG-GTNQPIGMAWAWMSLQQGNPLNTPAKDPNYKYTDAIILLSDGLNT 371

Query: 301 S--------------TKEDQQSLYYCNEAK---KRGAI--VYAIGIRVIRSHE--FLRAC 339
                           K D +    C+  K     G    VY I +      E   L+ C
Sbjct: 372 MDRWPDYGDGQRQFDGKIDARQKLLCDNIKLPDSNGKRPVVYTIQVNTTGDPESTILKYC 431

Query: 340 ASPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           A   +F+       +  AF+ IG  +   RI
Sbjct: 432 ADGGNFFATTTASGIGTAFAQIGSSLSKLRI 462


>gi|326335930|ref|ZP_08202107.1| aerotolerance protein BatA [Capnocytophaga sp. oral taxon 338 str.
           F0234]
 gi|325691894|gb|EGD33856.1| aerotolerance protein BatA [Capnocytophaga sp. oral taxon 338 str.
           F0234]
          Length = 332

 Score =  121 bits (304), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 44/242 (18%), Positives = 83/242 (34%), Gaps = 48/242 (19%)

Query: 154 IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
           +  P +SS    ++T   +D+++ +D+S SM +       +I+   +  +  +EE     
Sbjct: 73  LARPQSSSEITKTKTTEGIDIILAIDMSSSMLAKDLK-PNRIEALKRVASQFIEE----- 126

Query: 214 DVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSK--FGVSTNSTPGLKYAYNQIF 271
                 + G+V +S +           S + + +K + +      T    GL  A N   
Sbjct: 127 --RKSDRIGIVVYSGESYTKVPATTDKSIVLQSLKDIKQGEIEDGTAIGMGLGTAIN--- 181

Query: 272 DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI- 330
                      +     K+I+ MTDG N +   D   L     AK+ G  VY IGI    
Sbjct: 182 --------RLKDSKTKSKVIILMTDGVNNTGVID--PLSAAELAKEYGIRVYTIGIGTNG 231

Query: 331 ----------------------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIV 366
                                    + L   A  +   ++   +   +   ++ I K   
Sbjct: 232 KALSPVAYNPDGSLQYDMVPVEIDEKLLGEIAQSTGGKYFRATDNKKLAQIYTEIDKLEK 291

Query: 367 TK 368
           +K
Sbjct: 292 SK 293


>gi|312793553|ref|YP_004026476.1| von willebrand factor type a [Caldicellulosiruptor kristjanssonii
           177R1B]
 gi|312180693|gb|ADQ40863.1| von Willebrand factor type A [Caldicellulosiruptor kristjanssonii
           177R1B]
          Length = 726

 Score =  121 bits (304), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 44/203 (21%), Positives = 77/203 (37%), Gaps = 30/203 (14%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
            ++ VLD S SM     +   KI  A   ++A+++            ++ +V F +    
Sbjct: 38  MLVFVLDSSGSMSWNDPNGYRKI-AAKSFVDALIQ----------GDRAAVVDFDDYGYL 86

Query: 233 FFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIV 292
              L      ++  I  +  +G  TN   G++ A +Q+               +  K+I+
Sbjct: 87  LQPLTTDFQTVKNAIDRIDSWG-GTNIAEGIRIANHQLISQ---------SSDDRIKVII 136

Query: 293 FMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA--SPNSFYLVEN 350
            +TDGE               EAK  G  +Y IG+        LR  A  +   ++ V +
Sbjct: 137 LLTDGEGYYDNN------LTTEAKNNGITIYTIGLGTSVDENLLRNIATQTGGMYFPVSS 190

Query: 351 PHSMYDAFSHIGKDIVTKRIWYD 373
              +   F  I  +IVT+ I  D
Sbjct: 191 ASQLPQVFKRI-TEIVTEPIDTD 212


>gi|118591415|ref|ZP_01548813.1| hypothetical protein SIAM614_27248 [Stappia aggregata IAM 12614]
 gi|118436087|gb|EAV42730.1| hypothetical protein SIAM614_27248 [Stappia aggregata IAM 12614]
          Length = 474

 Score =  121 bits (303), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 60/461 (13%), Positives = 127/461 (27%), Gaps = 99/461 (21%)

Query: 8   IRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMN 67
           ++ F  + K  +  +  + + +I ++ G+ I+VS     +  L   ID + +  A  +  
Sbjct: 13  LKGFTGDRKASILPVFGLMVVLIVVIAGITIDVSRTVNAREKLSFAIDAAALSVAADLST 72

Query: 68  EGNGNNRKKLKGGDILCRIKNTW--------NMSFRNELRDNGFVNDIDDIVRSTSLDIV 119
               + + K    D                 N+SF  +  +          + +  +D+ 
Sbjct: 73  SVMSDEQIKAALADSFKANLADVEFLDEAIKNLSFVVDAENGTIKVSSFATLDNYFIDMG 132

Query: 120 V---------VPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSV-------K 163
                            S    SR+ + L     +     +    +   S         +
Sbjct: 133 GYGMQALGPETFNFGTSSQVTYSRFDVELALVVDVTGSMRNDMDTLRDASKGLVNILIPE 192

Query: 164 VNSQTDARLDMMIVL----------------------DVS-RSMESFFDSSITKIDMAIK 200
              + D+++ + +V                       D S    E         I     
Sbjct: 193 TTEEADSKVRISLVPYSQGVNLGTYAAKVKGGVYGYADSSVCVTERQDYDDGEDIYKVRY 252

Query: 201 SINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNST 260
           +       VK  P   +V   G     +   +   L      L   I  L   G  T   
Sbjct: 253 TDMPYNYYVKTDPPPKDVFYGGGSNRCSGTSKMIPLTADRDTLLDAIADLDDNG-GTAGQ 311

Query: 261 PGLKYAYNQIFD-----MQGMRQHCNTEDANYKKIIVFMTDGENL--------------- 300
            G+ + +N I            +    ++ +  K  + MTDG+N                
Sbjct: 312 TGVVWGWNSISPNYSDVWPLASKPEPYDNDDVLKFAIIMTDGDNNRFYEFVKEREECDWV 371

Query: 301 ----------------------------STKEDQQSLYYCNEAKKRGAIVYAIGIRVI-- 330
                                       +    +     C   K  G  ++ +       
Sbjct: 372 YSRRYGWQWTCEMVSVNQWQERSESESYNNNSSKAQRALCQAMKDEGISIFGVYFGTNDS 431

Query: 331 -RSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
               + +++CAS  ++Y   +   + +AF++I K I    +
Sbjct: 432 SAGSKNMQSCASTGNYYKATSSDELINAFANIAKKIQQIYV 472


>gi|329848392|ref|ZP_08263420.1| von Willebrand factor type A [Asticcacaulis biprosthecum C19]
 gi|328843455|gb|EGF93024.1| von Willebrand factor type A [Asticcacaulis biprosthecum C19]
          Length = 434

 Score =  121 bits (303), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 52/428 (12%), Positives = 128/428 (29%), Gaps = 65/428 (15%)

Query: 8   IRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMN 67
           ++ FF + +G + ++  + LP++FL +G  ++ S +  +K  L    D + V +      
Sbjct: 5   LKRFFRDTRGNVIMIIGLALPVVFLAIGGAVDFSRVMQLKKELQDAADVASVGSVAVNSY 64

Query: 68  EGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSL--DIVVVPQNE 125
               N +          +    +N + +     N          +ST+L  +I V     
Sbjct: 65  AYKANTKGHSSFKTGENQALAIFNSNVKKHNDLNNIKVKAKIKKQSTNLVSEIGVTADYR 124

Query: 126 GYSISAISRYKIPLK-----------FCTFIPWYTNSRHIVMPITSSVKVNSQTDAR--L 172
            Y +  +    +P+            +  F     NS  + +  T+        +     
Sbjct: 125 PYLLGLMGMNTMPITIKSTSSSTFPPYIDFYLLLDNSPSMGVGATTKDIDTMVANTSDKC 184

Query: 173 DMMIVLDVSRSMESFF----DSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF-- 226
                       + +         T+ID+  ++   ++   K    + +  +  +  F  
Sbjct: 185 AFACHQMDKAGNDYYALAKKLKVTTRIDVVRQATQNLMTTAKNTQTLTDQYRMAIYHFGM 244

Query: 227 -----------SNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQG 275
                        ++          +    KI  ++    + NS     +    +   + 
Sbjct: 245 AADQIDSKNPAPYEVSALTTNLSTSASNAAKIDLMTIPYQNYNSDRQTNFPSYLLGMNKV 304

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYY------------CNEAKKRGAIV- 322
           +    +   ++  + ++F          +   S               C   K RG  + 
Sbjct: 305 IPSSGDGSSSSKPQQVLFFVSDGANDGYDCAYSNGASCRRISPLDTPQCKAMKARGVKIA 364

Query: 323 --YAIGIRVIRS-----------------HEFLRACASPNSFYLVENPHSMYDAFSHI-G 362
             Y   + +  +                    ++ CA+   ++ V     + +A + +  
Sbjct: 365 VLYTTYLPLPTNAFYNSHLAKYVSPTSQLAAKMQECATEGLYFEVGPNEGISEAMNALFA 424

Query: 363 KDIVTKRI 370
           K I T RI
Sbjct: 425 KVISTVRI 432


>gi|327541799|gb|EGF28311.1| von Willebrand factor type A [Rhodopirellula baltica WH47]
          Length = 363

 Score =  121 bits (303), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 48/355 (13%), Positives = 112/355 (31%), Gaps = 30/355 (8%)

Query: 15  YKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNR 74
             G M +L AI + +  +V+   I+++ +   +T L S  D +   AAT + +  + N  
Sbjct: 33  RHGAMLVLIAIMMFLFLIVVAFSIDIAQMHLARTELRSSTDAAANAAATTLADTLDRNLA 92

Query: 75  KKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISR 134
            +         + N   +   +     G         R  +           ++   ++ 
Sbjct: 93  IQRGQQIAQANLVNGQPLLLADGDFQFGRS------DRQVNGKYAFNAGEAPFNGVRVNG 146

Query: 135 YKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITK 194
            +        +P +  +              + T    D+ +V+D S SM        ++
Sbjct: 147 QRTAGSLSGPVPLFFGNVTGTSIFEPEAF-ATATYVERDITLVVDRSGSMAG------SR 199

Query: 195 IDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFG 254
            +    +I    +   L+       Q GL +++++  E   L    + +   +  L   G
Sbjct: 200 FNDLQAAIRIFTD---LLATTPVDEQIGLASYNDRASEDVQLTENFAEVNNAMDRLRT-G 255

Query: 255 VSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNE 314
             T+ + G++                       ++ ++ MTDG +       +      +
Sbjct: 256 GFTSISRGMQAG--------QEIALRGRPPEFVERTMIVMTDGRHNRG---PEPRVVATD 304

Query: 315 AKKRGAIVYAIGIRVIRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVT 367
               G  ++ I          ++  A       +   N   + D +  I   + T
Sbjct: 305 LAADGVTIHTITFGAGADFGRMQDVARIGGGRHFHATNGDQLRDIYREIALTLGT 359


>gi|253584083|ref|ZP_04861281.1| BatA protein [Fusobacterium varium ATCC 27725]
 gi|251834655|gb|EES63218.1| BatA protein [Fusobacterium varium ATCC 27725]
          Length = 319

 Score =  121 bits (302), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 39/229 (17%), Positives = 82/229 (35%), Gaps = 39/229 (17%)

Query: 168 TDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFS 227
               +D+ I LD+S+SM      +  +++ A + ++  +       D     +  L+ F 
Sbjct: 78  KKDGIDIAISLDLSQSMLQEDF-TPNRLEKAKEVLDEFI-------DKRGNDRLSLIVFG 129

Query: 228 NKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287
                   L +  + ++   + L+   +++N+   +        +          +    
Sbjct: 130 GDAYTKVPLTFDHNVIKEMTRKLTVDDITSNTRTAIGMGIGVALN-------RLKDSEAK 182

Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR-----------------VI 330
            K+I+ +TDGEN S +         + AK+ G  +Y IGI                    
Sbjct: 183 SKVIILLTDGENNSGEMSPS--AAADIAKELGIKIYTIGIGAKEIKVPSFFGYKTVKNTE 240

Query: 331 RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK---RIWYDK 374
                L++ A  +   ++   +     + F+ I     TK   R +YDK
Sbjct: 241 LDENMLKSIAETTGGEYFRASDSKEFKEIFNKIDALEKTKIDGRTFYDK 289


>gi|88801581|ref|ZP_01117109.1| batA protein [Polaribacter irgensii 23-P]
 gi|88782239|gb|EAR13416.1| batA protein [Polaribacter irgensii 23-P]
          Length = 334

 Score =  121 bits (302), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 44/272 (16%), Positives = 90/272 (33%), Gaps = 49/272 (18%)

Query: 125 EGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSM 184
              + S +S+ K  L     +        +  P   +V   ++T++ +D+++ +DVS SM
Sbjct: 45  GFKTTSFVSKLKPVLYLLRLLALAAIIIALARPRNVAVSKKTKTNSGIDIIMAIDVSASM 104

Query: 185 ESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQ 244
            +       +++   K     +       D     + G+V ++ +      +    + ++
Sbjct: 105 LARDLK-PNRLEALKKVAIDFV-------DRRPNDRIGIVVYAGESFTQTPITSDKNIVK 156

Query: 245 RKIKYLSKFG--VSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLST 302
           R I  L        T    GL    N              E     K+I+ +TDG N + 
Sbjct: 157 RTISELQWGQLDGGTAIGMGLGSGVN-----------RLKESTAKSKVIILLTDGVNNAG 205

Query: 303 KEDQQSLYYCNEAKKRGAIVYAIGIRVI------------------------RSHEFLRA 338
             D ++      A++    VY IGI                              + L+ 
Sbjct: 206 NIDPRT--ATELARELEIKVYTIGIGTNGMADFPWSKDPRTGKLNFRKQQVEIDEKLLQE 263

Query: 339 CAS--PNSFYLVENPHSMYDAFSHIGKDIVTK 368
            A+     ++   +  S+ + +  I     TK
Sbjct: 264 IATATDGKYFRATDNQSLKEIYDEIDALEKTK 295


>gi|146298482|ref|YP_001193073.1| von Willebrand factor, type A [Flavobacterium johnsoniae UW101]
 gi|146152900|gb|ABQ03754.1| BatA-like protein [Flavobacterium johnsoniae UW101]
          Length = 334

 Score =  121 bits (302), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 37/243 (15%), Positives = 83/243 (34%), Gaps = 49/243 (20%)

Query: 154 IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
           +  P T  +   ++T   +D+++ +DVS SM +       +++   +     +EE     
Sbjct: 74  LARPRTVDISNQTKTTKGIDIVMAIDVSGSMLAKDLK-PNRMEALKRVAADFVEE----- 127

Query: 214 DVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFG---VSTNSTPGLKYAYNQI 270
                 + GLV ++++      +      +   IK +         T    GL  A N  
Sbjct: 128 --RPNDRIGLVLYASEAYTKTPVTSDKPIILEAIKGIRYDTVLQDGTGIGMGLATAVN-- 183

Query: 271 FDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI 330
                       +     ++I+ +TDG N +     +     + AK+ G  VY IG+   
Sbjct: 184 ---------RLKDSKAKSRVIILLTDGVNNAGFI--EPETAADIAKQYGIKVYTIGLGTN 232

Query: 331 -----------------------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                                       +++ A  +  +++   +   + + ++ I K  
Sbjct: 233 GMAESPYAYAPNGGFLFKMQKVEIDERLMKSIAKKTDGTYFRATSNDKLAEIYNSINKLE 292

Query: 366 VTK 368
            T+
Sbjct: 293 TTE 295


>gi|54298847|ref|YP_125216.1| hypothetical protein lpp2914 [Legionella pneumophila str. Paris]
 gi|53752632|emb|CAH14067.1| hypothetical protein lpp2914 [Legionella pneumophila str. Paris]
          Length = 344

 Score =  120 bits (301), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 37/227 (16%), Positives = 79/227 (34%), Gaps = 46/227 (20%)

Query: 168 TDARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGL 223
                ++M+VLD+S SME          ++++ +  ++    +E+           + GL
Sbjct: 86  AREGYNIMMVLDLSGSMEITDMLLHGRPVSRLLVVKRAAEQFVED-------RVGDRIGL 138

Query: 224 VTFSNKIEEFFLLEWGVSHLQRKIKYLSK--FGVSTNSTPGLKYAYNQIFDMQGMRQHCN 281
           + F  +      L +    +  +I   +    G +T+    +  A  ++ D+        
Sbjct: 139 ILFGTRAYLQTPLTYDRHSVLMRIDDATAGLAGKTTSIGDAVGLAVKRLQDV-------- 190

Query: 282 TEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR---------- 331
               +  ++I+ +TDG N S       L     AK+ G  +Y IG+              
Sbjct: 191 ---PSKGRVIILLTDGANNSG--VLAPLKAAELAKQDGIKIYTIGLGSEADPRALTGDFF 245

Query: 332 --------SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                     + L   A  +   ++   +P S+   +  I +    K
Sbjct: 246 APTLSAELDEKTLEEMAKMTGGRYFRATDPESLQSIYQTINQLETVK 292


>gi|148361167|ref|YP_001252374.1| Von Willebrand factor type A (vWA) domain-containing protein
           [Legionella pneumophila str. Corby]
 gi|148282940|gb|ABQ57028.1| conserved hypothetical protein [Legionella pneumophila str. Corby]
          Length = 344

 Score =  120 bits (301), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 37/227 (16%), Positives = 79/227 (34%), Gaps = 46/227 (20%)

Query: 168 TDARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGL 223
                ++M+VLD+S SME          ++++ +  ++    +E+           + GL
Sbjct: 86  AREGYNIMMVLDLSGSMEITDMLLHGRPVSRLLVVKRAAEQFVED-------RVGDRIGL 138

Query: 224 VTFSNKIEEFFLLEWGVSHLQRKIKYLSK--FGVSTNSTPGLKYAYNQIFDMQGMRQHCN 281
           + F  +      L +    +  +I   +    G +T+    +  A  ++ D+        
Sbjct: 139 ILFGTRAYLQTPLTYDRHSVLMRIDDATAGLAGKTTSIGDAVGLAVKRLQDV-------- 190

Query: 282 TEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR---------- 331
               +  ++I+ +TDG N S       L     AK+ G  +Y IG+              
Sbjct: 191 ---PSKGRVIILLTDGANNSG--VLAPLKAAELAKQDGIKIYTIGLGSEADPRALTGDFF 245

Query: 332 --------SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                     + L   A  +   ++   +P S+   +  I +    K
Sbjct: 246 APTLSAELDEKTLEKMAKMTGGRYFRATDPESLQSIYQTINQLETVK 292


>gi|52843052|ref|YP_096851.1| hypothetical protein lpg2856 [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|52630163|gb|AAU28904.1| hypothetical protein lpg2856 [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
          Length = 352

 Score =  120 bits (301), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 37/227 (16%), Positives = 79/227 (34%), Gaps = 46/227 (20%)

Query: 168 TDARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGL 223
                ++M+VLD+S SME          ++++ +  ++    +E+           + GL
Sbjct: 94  AREGYNIMMVLDLSGSMEITDMLLHGRPVSRLLVVKRAAEQFVED-------RVGDRIGL 146

Query: 224 VTFSNKIEEFFLLEWGVSHLQRKIKYLSK--FGVSTNSTPGLKYAYNQIFDMQGMRQHCN 281
           + F  +      L +    +  +I   +    G +T+    +  A  ++ D+        
Sbjct: 147 ILFGTRAYLQTPLTYDRHSVLMRIDDATAGLAGKTTSIGDAVGLAVKRLQDV-------- 198

Query: 282 TEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR---------- 331
               +  ++I+ +TDG N S       L     AK+ G  +Y IG+              
Sbjct: 199 ---PSKGRVIILLTDGANNSG--VLAPLKAAELAKQDGIKIYTIGLGSEADPRALTGDFF 253

Query: 332 --------SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                     + L   A  +   ++   +P S+   +  I +    K
Sbjct: 254 APTLSAELDEKTLEKMAKMTGGRYFRATDPESLQSIYQTINQLETVK 300


>gi|54295680|ref|YP_128095.1| hypothetical protein lpl2768 [Legionella pneumophila str. Lens]
 gi|53755512|emb|CAH17011.1| hypothetical protein lpl2768 [Legionella pneumophila str. Lens]
 gi|307611729|emb|CBX01432.1| hypothetical protein LPW_31221 [Legionella pneumophila 130b]
          Length = 344

 Score =  120 bits (301), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 37/227 (16%), Positives = 79/227 (34%), Gaps = 46/227 (20%)

Query: 168 TDARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGL 223
                ++M+VLD+S SME          ++++ +  ++    +E+           + GL
Sbjct: 86  AREGYNIMMVLDLSGSMEITDMLLHGRPVSRLLVVKRAAEQFVED-------RVGDRIGL 138

Query: 224 VTFSNKIEEFFLLEWGVSHLQRKIKYLSK--FGVSTNSTPGLKYAYNQIFDMQGMRQHCN 281
           + F  +      L +    +  +I   +    G +T+    +  A  ++ D+        
Sbjct: 139 ILFGTRAYLQTPLTYDRHSVLMRIDDATAGLAGKTTSIGDAVGLAVKRLQDV-------- 190

Query: 282 TEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR---------- 331
               +  ++I+ +TDG N S       L     AK+ G  +Y IG+              
Sbjct: 191 ---PSKGRVIILLTDGANNSG--VLAPLKAAELAKQDGIKIYTIGLGSEADPRALTGDFF 245

Query: 332 --------SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                     + L   A  +   ++   +P S+   +  I +    K
Sbjct: 246 APTLSAELDEKTLEKMAKMTGGRYFRATDPESLQSIYQTINQLETVK 292


>gi|296108502|ref|YP_003620203.1| hypothetical protein lpa_04155 [Legionella pneumophila 2300/99
           Alcoy]
 gi|295650404|gb|ADG26251.1| Hypothetical protein lpa_04155 [Legionella pneumophila 2300/99
           Alcoy]
          Length = 352

 Score =  120 bits (300), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 37/227 (16%), Positives = 79/227 (34%), Gaps = 46/227 (20%)

Query: 168 TDARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGL 223
                ++M+VLD+S SME          ++++ +  ++    +E+           + GL
Sbjct: 94  AREGYNIMMVLDLSGSMEITDMLLHGRPVSRLLVVKRAAEQFVED-------RVGDRIGL 146

Query: 224 VTFSNKIEEFFLLEWGVSHLQRKIKYLSK--FGVSTNSTPGLKYAYNQIFDMQGMRQHCN 281
           + F  +      L +    +  +I   +    G +T+    +  A  ++ D+        
Sbjct: 147 ILFGTRAYLQTPLTYDRHSVLMRIDDATAGLAGKTTSIGDAVGLAVKRLQDV-------- 198

Query: 282 TEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR---------- 331
               +  ++I+ +TDG N S       L     AK+ G  +Y IG+              
Sbjct: 199 ---PSKGRVIILLTDGANNSG--VLAPLKAAELAKQDGIKIYTIGLGSEADPRALTGDFF 253

Query: 332 --------SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                     + L   A  +   ++   +P S+   +  I +    K
Sbjct: 254 APTLSAELDEKTLEKMAKMTGGRYFRATDPESLQSIYQTINQLETVK 300


>gi|90422080|ref|YP_530450.1| hypothetical protein RPC_0556 [Rhodopseudomonas palustris BisB18]
 gi|90104094|gb|ABD86131.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB18]
          Length = 453

 Score =  120 bits (300), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 58/444 (13%), Positives = 121/444 (27%), Gaps = 81/444 (18%)

Query: 3   SLNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLV--- 59
            L+    +F ++ +G + IL A  L  + + +G  I+ +    +++ + S  D + V   
Sbjct: 4   RLSGLFDSFHHDRRGNIAILFAFSLIPLLVAIGCAIDYARATQIRSKMQSAADAASVGSV 63

Query: 60  --HAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVR-STSL 116
              +   +       +     G      I N    S                    ++++
Sbjct: 64  SKASPAFLAAGSMTTDGPIAVGSTDATNIFNGNMASQSGYTLSKLDAAVTKSGATLTSTV 123

Query: 117 DIVVVPQNEGYSISAISRYKIPLK---------FCTFIPWYTNSRHIVMPITSSVKVNSQ 167
                      +I   +   I            +  F     NS  + +  T +      
Sbjct: 124 TFSASVATTFLTIIGKTALAIGGTSVSTSSMPVYIDFYLLLDNSPSMGVGATPTDVATMV 183

Query: 168 TDAR--LDMMIVLDVSRSMESF----FDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQS 221
            +           DV+     +         T+ID+   +   +++         N  + 
Sbjct: 184 DNTSDKCAFACH-DVNDEHNYYELAKTLGVKTRIDVLRDATQQLMDTAAATATYPNQFRM 242

Query: 222 GLVTFSNKIE-----EFFLLEWGVSHLQRK---IKYLSKFGVSTNSTPGLKYAYNQIFDM 273
            +  F    +       F L   +S  +     I  ++  G + N      Y+       
Sbjct: 243 AIYDFGASAQSAALRRLFALSSSLSSAKTAAGAIDLMTVKGQNDNDDRDTSYSKLLPAID 302

Query: 274 QGMRQHCNTEDANYKKIIVFMTDGENLSTKE-------------------DQQSLYYCNE 314
           + +           +K ++F++DG    T                            C  
Sbjct: 303 KQITAAGAGTSDAPQKYLLFVSDGVADETNAGCAKTMKNAFWGNKSPRCQSPIDPALCKA 362

Query: 315 AKKRGAIV---YA-------------------------IG-IRVIRSHEF---LRACASP 342
              RG  V   Y                          +G      + E    ++ACASP
Sbjct: 363 MTDRGVKVAVLYTTYLALPLKQANGDPSWYASWIAPFNVGPYGPSPNSEIANNMKACASP 422

Query: 343 NSFYLVENPHSMYDAFSHIGKDIV 366
             ++ V     + DA + I +  V
Sbjct: 423 GFYFEVSPTDGIADAMNAIFRKAV 446


>gi|295132198|ref|YP_003582874.1| von Willebrand factor(vWA) type A domain-containing protein
           [Zunongwangia profunda SM-A87]
 gi|294980213|gb|ADF50678.1| von Willebrand factor(vWA) type A domain-containing protein
           [Zunongwangia profunda SM-A87]
          Length = 334

 Score =  120 bits (300), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 38/240 (15%), Positives = 77/240 (32%), Gaps = 49/240 (20%)

Query: 157 PITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVN 216
           P T  V   + +   +D+++ +DVS SM +       +++         ++         
Sbjct: 77  PRTVDVSTRTNSTQGIDIVMAIDVSASMLARDL-QPNRLEATKAVGEEFIKG-------R 128

Query: 217 NVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGV---STNSTPGLKYAYNQIFDM 273
              + GLV +S +      +    S + R ++ +    +    T    G           
Sbjct: 129 PSDRIGLVLYSGESFTKTPITSDKSVVLRALEDVEFNNILESGTAIGSG----------- 177

Query: 274 QGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI--- 330
                +   +     K+I+ +TDG N S   D +       AK+ G  VY IG+      
Sbjct: 178 LATSVNRLKDSKAESKVIILLTDGVNNSGFIDPKV--ASELAKEFGIKVYTIGVGTNGMA 235

Query: 331 --------------------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                                  + L+  A  +   ++   N   + D +  I +   T+
Sbjct: 236 LTPVGIAANGRFQFGNRQVEIDEDLLKQIADETGGKYFRATNNEKLEDIYDEIDQLEKTE 295


>gi|163786711|ref|ZP_02181159.1| aerotolerance-related membrane protein [Flavobacteriales bacterium
           ALC-1]
 gi|159878571|gb|EDP72627.1| aerotolerance-related membrane protein [Flavobacteriales bacterium
           ALC-1]
          Length = 335

 Score =  119 bits (299), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 40/251 (15%), Positives = 80/251 (31%), Gaps = 52/251 (20%)

Query: 154 IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
           +V P T  V   ++T   +D+++ +DVS SM +       +++   K     +E      
Sbjct: 75  LVRPRTVDVSTKTKTTRGIDIVMSIDVSASMLAKDL-LPNRLEALKKVAADFIEG----- 128

Query: 214 DVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFG---VSTNSTPGLKYAYNQI 270
                 + GLV ++ +      +    S + R ++ +         T    G        
Sbjct: 129 --RPNDRIGLVEYAGEAYTKTPITSDKSIVLRSMRDIKYNTIIEGGTAIGMG-------- 178

Query: 271 FDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI 330
                   +   +     K+I+ +TDG N     D         A + G  VY IG+   
Sbjct: 179 ---LATSVNRLKDSRAKSKVIILLTDGVNNGGFID--PKIASELAVEYGIKVYTIGLGTN 233

Query: 331 -----------------------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                                     + L+  A  +   ++   N   +   +  I K  
Sbjct: 234 GTALSPVRINPNGSFQYGRQKVEIDEDLLKEIADVTGGKYFRATNNKKLAQIYDEINKLE 293

Query: 366 VT---KRIWYD 373
            T   ++ +Y+
Sbjct: 294 KTEIEEKKYYN 304


>gi|209546922|ref|YP_002278840.1| hypothetical protein Rleg2_4864 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209538166|gb|ACI58100.1| hypothetical protein Rleg2_4864 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 462

 Score =  119 bits (298), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 37/307 (12%), Positives = 100/307 (32%), Gaps = 14/307 (4%)

Query: 5   NLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQ 64
              +R    +  G + I+ A+ L  + + +G   +    + ++  + S +D +L+ A  Q
Sbjct: 21  FHTLRGLRRDRTGNVAIVVALSLVPMLVAVGASFDYIRSYNVRQKMQSDLDAALIAAVKQ 80

Query: 65  IMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQN 124
           I N  + +  K         ++ N++ +   +    N  +        +     + +   
Sbjct: 81  INNTADADALKAKVSDWFHAQVDNSYTLGEIDIDTANHNITATASG--TVPTTFMKIANI 138

Query: 125 EGYSISAISRYKIP-LKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMI------- 176
           +   +S  S  K P   +         S  +++  T+S +    +               
Sbjct: 139 DTVPVSVGSAVKGPATSYLNVYIVIDTSPSMLLAATTSGQSTMYSGIGCQFACHTGDAHT 198

Query: 177 VLDVSRSMESFF---DSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEF 233
           V   + +    +    +   + D+A  ++  +L  +      +  ++ GL +  + + E 
Sbjct: 199 VGKKTYANNYEYSTAKNIKLRADVAGDAVKDVLSLIDTSDSNHERIKVGLYSLGDTLTEV 258

Query: 234 FLLEWGVSHLQRKIKYLSKF-GVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIV 292
                     + ++   S     +T+               +       T      K+++
Sbjct: 259 LAPTLSTDTARTRLSTASYGLTSATSKAATYFDVSLATLKQKVGAGGDGTTSGTPLKLVL 318

Query: 293 FMTDGEN 299
            +TDG  
Sbjct: 319 LLTDGVQ 325


>gi|85374104|ref|YP_458166.1| hypothetical protein ELI_06385 [Erythrobacter litoralis HTCC2594]
 gi|84787187|gb|ABC63369.1| hypothetical protein ELI_06385 [Erythrobacter litoralis HTCC2594]
          Length = 623

 Score =  119 bits (298), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 41/295 (13%), Positives = 93/295 (31%), Gaps = 29/295 (9%)

Query: 8   IRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMN 67
           +R    +  G    L A  L  +  + G  +++S  +  ++ L    D  ++ A   +  
Sbjct: 1   MRRLASDRSGNTLALIAAGLLPLLAMAGSGVDMSRAYLAESRLQQACDSGVLAARKALGT 60

Query: 68  EGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGY 127
           E            D   R +  +N +F++             +                Y
Sbjct: 61  EI---ATLTDIPTDAGTRGQEFFNSNFQDGNYGTQNRTFNMVLEND-------------Y 104

Query: 128 SISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESF 187
           S+S  +   +P    T          I + +    +++      +D+M+VLDV+ SM+  
Sbjct: 105 SVSGTATVDVPTSVMT----VFGFTKIPVKVECQARISFSD---VDVMMVLDVTGSMKHT 157

Query: 188 FDSSI-TKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE-----FFLLEWGVS 241
                 +KID    ++    ++++        ++ G V +++ +          +    +
Sbjct: 158 NSGDTLSKIDSLKATVRNFYDQMEGAKSAGTRIRYGFVPYASNVNVGHLLKDEWVVNSWA 217

Query: 242 HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTD 296
           +  R I   +     T +     Y             +  T +        F  D
Sbjct: 218 YQSRAISGTTTVEAGTKTRENWAYKSGSRSAWIEESTYAATMNPGSGDTNPFSCD 272



 Score = 75.3 bits (183), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 32/234 (13%), Positives = 63/234 (26%), Gaps = 31/234 (13%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKID-MAIKS--INAMLEEVKLIPDVNNVVQSGL 223
             +  LD+  V   S     +       I   + ++    +             +     
Sbjct: 389 SANLDLDINTVPVASDQDTQWRPRYPDMIYVRSKEADDKGSFSPAPVYDTKKEFIQTGNW 448

Query: 224 VTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
                      L       L   +  L+  G + +    +              ++ +  
Sbjct: 449 WFSGCPAPAQKLKAMTSGELDSYLDSLTPHGATYHDGGMIWGGRLLSQYGLFAAENSSKP 508

Query: 284 DANYKKIIVFMTDGENL-----STKEDQQSLY----------------------YCNEAK 316
                + ++F+TDG+               +                        CNE K
Sbjct: 509 GRTTSRHLIFLTDGQTEPYDLAYGSYGIDPIDERRWTQTSSLTLAQTVEERFLFACNEVK 568

Query: 317 KRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           K GA V+ +      + + ++ CA    ++   N   + DAFS I K     RI
Sbjct: 569 KLGATVWVVAFGTAANDK-MKTCAGSGRYFEAANASQLNDAFSTIAKSTGDLRI 621


>gi|150024244|ref|YP_001295070.1| BatA protein [Flavobacterium psychrophilum JIP02/86]
 gi|149770785|emb|CAL42250.1| BatA protein [Flavobacterium psychrophilum JIP02/86]
          Length = 333

 Score =  119 bits (297), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 42/267 (15%), Positives = 86/267 (32%), Gaps = 49/267 (18%)

Query: 130 SAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFD 189
           S + + K  L     +        +  P T  V     T   +D+++ +D+S SM +   
Sbjct: 49  SVLPKLKPVLFAMRLLALSALIVAMARPRTVDVSNKRNTTNGIDIVMAIDLSSSMLAKDF 108

Query: 190 SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKY 249
               +++   +   + +E            + G+V ++ +      +    + +   I  
Sbjct: 109 K-PNRMEALKEVAASFVEA-------RQSDRIGVVVYTAEAYTKTPVTSDKAVVLDAINT 160

Query: 250 LSKF---GVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQ 306
           +         T    GL  A N              +     K+I+ MTDG N +     
Sbjct: 161 IKYDNVLQDGTGIGMGLATAVN-----------RLKDSKAKSKVIILMTDGVNNAGFI-- 207

Query: 307 QSLYYCNEAKKRGAIVYAIGIRVI-----------------------RSHEFLRACA--S 341
           + +     AK+ G  VY IGI                             + ++  A  +
Sbjct: 208 EPVTAAEFAKEFGIKVYTIGIGTNGNAPFPYAIAPNGGFLYKMLPVEIDEQLMKDIAKKT 267

Query: 342 PNSFYLVENPHSMYDAFSHIGKDIVTK 368
              ++  ++  S+   +S I K   T+
Sbjct: 268 GGKYFRAQSNSSLESIYSEINKLEKTE 294


>gi|300023811|ref|YP_003756422.1| von Willebrand factor A [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525632|gb|ADJ24101.1| von Willebrand factor type A [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 466

 Score =  119 bits (297), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 60/441 (13%), Positives = 129/441 (29%), Gaps = 77/441 (17%)

Query: 5   NLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQ 64
           +  I  F  + +G + IL  +   ++F ++G+ ++       ++   +  D +++  A  
Sbjct: 26  SRAIEKFSRDTRGDVAILFGLMALVLFAMIGLAVDYGRFVNARSQTIAATDAAVLAGARA 85

Query: 65  I-MNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDI----- 118
           +  N G+     ++         KN  ++S                   +  +       
Sbjct: 86  LQTNGGDQAAALRVAQSYYAQATKNRLSLSNDTINFAIADNATAMVTTGNAVITTPFMGL 145

Query: 119 ------------VVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSV---- 162
                                ++   +   + +     I      + +     ++     
Sbjct: 146 AGTGSLPILRKDGSDYSKAVLAVGGNAELNLEIAMMLDITGSMRGQKLTDMKAAASDLLN 205

Query: 163 ----KVNSQTDARLDMM-IVLDV----------SRSMESFFDSSITKI------DMAIKS 201
                  S+  +++ ++    DV          + +  + +   + +       D A  +
Sbjct: 206 IVVWTDQSKFTSKVAIVPFAYDVRLPAAAFKKATGTTSTNYPCVVERTGTEKYTDAAPAT 265

Query: 202 INAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTP 261
              ++         N    S     ++  E   L     S L  K+  LS  G ST    
Sbjct: 266 GKYVMVHNTSSTKKNKTTYSPTCDVASSAEVLPLT-SDKSTLLAKVNGLSTAG-STAGHI 323

Query: 262 GLKYAYNQIFDMQ------GMRQHCNTEDANYKKIIVFMTDGENL--------------- 300
           G  +A+  +                     N +KI V MTDGE                 
Sbjct: 324 GTAWAWYMLAPNWSSLWTSASSTPAAYNADNLRKIAVLMTDGEYNTQYTTNGVPDDSSSL 383

Query: 301 --------STKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSH--EFLRACASP-NSFYLVE 349
                         Q++  C   K +G  VY +G ++      + L  CA+  + FY   
Sbjct: 384 TRCPNAANGVCSSAQAVSQCTAMKAKGIEVYTVGFQLDNQTAIDTLSQCATDSSHFYNST 443

Query: 350 NPHSMYDAFSHIGKDIVTKRI 370
              ++  AF  I   I T  +
Sbjct: 444 TGDALKAAFRDIALKISTLYL 464


>gi|146337717|ref|YP_001202765.1| hypothetical protein BRADO0586 [Bradyrhizobium sp. ORS278]
 gi|146190523|emb|CAL74522.1| hypothetical protein BRADO0586 [Bradyrhizobium sp. ORS278]
          Length = 418

 Score =  119 bits (297), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 52/414 (12%), Positives = 118/414 (28%), Gaps = 54/414 (13%)

Query: 1   MFSLNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVH 60
           M  L   +R F ++ +G + +L AI    +   +G  I+ S    ++T L   ID +++ 
Sbjct: 1   MDRLLRYLRKFGHDQRGNIAVLFAIACVPVLAFVGAGIDYSMANKLRTKLQMAIDEAVLA 60

Query: 61  AATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVV 120
                    +    +            + +  +                   S +     
Sbjct: 61  GVAAGKAALDSGATQAAAIAMAQAASSSYFTGNTAKIDATPTINFTTMGRTLSGTGSATS 120

Query: 121 VPQNEGYSISAISRYKIPLK---------FCTFIPWYTNSRHIVMPITSSVKVNSQTDAR 171
           V       +       +            +         S  +++P T +     +    
Sbjct: 121 VMNTSFMRLVGFPTMTLNASSASSATMQPYLNVYLLVDISSSMLLPATQAGITQMRNGTG 180

Query: 172 LDMMIVLDVSRSMESFF---DSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
             +      + +    +   ++ + +  +  + +  +L  +       N V+ GL +F N
Sbjct: 181 CALACHETTNGTDSYSYALKNNVLLRYQVVNQGVQNLLTYLNSSAVYKNYVKVGLWSFDN 240

Query: 229 KIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPG--LKYAYNQIFDMQGMRQHCNTEDAN 286
           ++ +   L    S +          G++ N         +    F          +  A 
Sbjct: 241 QLTQLSSLTSSFSSVAA---NFPAPGLAYNDAAAATPFDSLIGSFVSSVGTAGDGSTSAT 297

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYY-----------CNEAKKRGAIVYAI---------- 325
            +K+++  TDG N  T+                   CN  K  G  V  I          
Sbjct: 298 PQKLVIIATDGVNDPTRAWTSQTSLRSQVRVFNTAFCNTFKSNGVTVAIINTPYYPMTWD 357

Query: 326 -GIRVIRSHE--------------FLRACASPNSFYLVENPHSMYDAFSHIGKD 364
            G                       L++CA   +F +  +  ++ +AF+ +   
Sbjct: 358 WGYNATLGQPGSLGGATRVDDIPIALKSCAGS-NFIIASDVATIQNAFTTLFNK 410


>gi|226226933|ref|YP_002761039.1| hypothetical membrane protein [Gemmatimonas aurantiaca T-27]
 gi|226090124|dbj|BAH38569.1| hypothetical membrane protein [Gemmatimonas aurantiaca T-27]
          Length = 326

 Score =  119 bits (297), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 32/232 (13%), Positives = 68/232 (29%), Gaps = 42/232 (18%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           S  +    +   +D+ + +D+S SM +       ++++A   +   +             
Sbjct: 74  SGARAERVSSDGIDIALTVDISSSMLAEDFQPQNRMEVAKDKVKRFVMG-------RKSD 126

Query: 220 QSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQH 279
           + GLV FS +      L      +   I  L           G       I        +
Sbjct: 127 RVGLVAFSGEALTQVPLTTDYPVVLAAIDNLQV---------GQLEDGTAIGTAIATAAN 177

Query: 280 CNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI--------- 330
                    +++V +TDGEN     D ++      A   G  +Y IG+            
Sbjct: 178 RLRNSPGRSRVMVLLTDGENNRGAIDPRT--AAQAAGTFGIRIYTIGVGTDGMAAVPVGR 235

Query: 331 -------------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVT 367
                             L   A  +   ++  ++  ++   +  I +   +
Sbjct: 236 GLFGLRYENRPVKIDEALLTEIANSTGGRYFRAKDAAALQSIYEQIDRLERS 287


>gi|332519334|ref|ZP_08395801.1| von Willebrand factor type A [Lacinutrix algicola 5H-3-7-4]
 gi|332045182|gb|EGI81375.1| von Willebrand factor type A [Lacinutrix algicola 5H-3-7-4]
          Length = 334

 Score =  119 bits (297), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 39/243 (16%), Positives = 76/243 (31%), Gaps = 49/243 (20%)

Query: 154 IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
           I  P T  V   ++T   +D+++ +DVS SM +       +++      +  ++      
Sbjct: 74  IARPRTVDVSTKTKTTRGIDIVMAIDVSASMLAKDLK-PNRLEALKNVASEFIKG----- 127

Query: 214 DVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFG---VSTNSTPGLKYAYNQI 270
                 + GLV ++ +      +    S + R ++ +         T    GL  A N  
Sbjct: 128 --RPNDRIGLVEYAGESYTKTPITSDKSIVLRSLQEIRYNNIIEGGTAIGMGLATAVN-- 183

Query: 271 FDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI 330
                       +     K+I+ +TDG N S             A + G   Y IG+   
Sbjct: 184 ---------RLKDSKAKSKVIILLTDGVNNSGSI--NPKIASELAVEFGIKTYTIGLGTN 232

Query: 331 -----------------------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                                       L+  A  +   ++   N   + + +  I K  
Sbjct: 233 GMALSPIAIKQNGQFQYGRVKVEIDETLLKEIAQVTGGKYFRATNNKKLAEIYDEINKLE 292

Query: 366 VTK 368
            T+
Sbjct: 293 KTE 295


>gi|260061451|ref|YP_003194531.1| aerotolerance operon BatA [Robiginitalea biformata HTCC2501]
 gi|88785583|gb|EAR16752.1| BatA (Bacteroides aerotolerance operon) [Robiginitalea biformata
           HTCC2501]
          Length = 333

 Score =  119 bits (297), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 33/242 (13%), Positives = 74/242 (30%), Gaps = 48/242 (19%)

Query: 154 IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
           +  P T  +   ++T   +D+++ +DVS SM +       ++    +     + +     
Sbjct: 74  MARPQTQDISTRTKTTKGIDIVMAIDVSSSMLARDL-RPNRLSALKEVAAEFIRK----- 127

Query: 214 DVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFG--VSTNSTPGLKYAYNQIF 271
                 + GLV ++ +      +    S +   ++ ++       T    G         
Sbjct: 128 --RPNDRIGLVAYAGESYTKTPITSDKSIVLGALREITYGQLNDGTAIGMG--------- 176

Query: 272 DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI- 330
                  +   E     K+I+ +TDG N +     +     + A + G   Y IG+    
Sbjct: 177 --LATSVNRLKESTAISKVIILLTDGVNNAGFI--EPQTAADLALEYGIKTYTIGLGTNG 232

Query: 331 ----------------------RSHEFLRACAS--PNSFYLVENPHSMYDAFSHIGKDIV 366
                                    E L   A+     ++   +   +   +  I K   
Sbjct: 233 NALSPIGYNPDGSFRYGMRQVEIDEELLTDIATATGGEYFRATDNEKLEAIYEEINKLEK 292

Query: 367 TK 368
           T+
Sbjct: 293 TE 294


>gi|83955719|ref|ZP_00964299.1| hypothetical protein NAS141_07930 [Sulfitobacter sp. NAS-14.1]
 gi|83840013|gb|EAP79189.1| hypothetical protein NAS141_07930 [Sulfitobacter sp. NAS-14.1]
          Length = 480

 Score =  118 bits (296), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 71/460 (15%), Positives = 131/460 (28%), Gaps = 98/460 (21%)

Query: 4   LNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAA- 62
           L   +  F     G +TIL    + ++  V G+ ++       ++ L ++ DR+++ AA 
Sbjct: 24  LRKRLTRFAREDDGLVTILALFMIMMMIAVGGIQLDFMRHEMERSRLQAVSDRAVLAAAD 83

Query: 63  ---TQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVR------- 112
               +       +   K    + L  +     ++FR    D     D   I R       
Sbjct: 84  LDQMRDPKTVVEDYFAKSGMTEFLSNVVVDDGLNFRTVTVDASKNMDTQFIGRFGFPTLE 143

Query: 113 ----------------STSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVM 156
                           S  LDI              +   I   F   +    N   I +
Sbjct: 144 VPAHSQAEERVAKVEISLVLDISGSMATNNRLGEVQNAADI---FLDTVLKDENQDLISV 200

Query: 157 PITSSVKVNSQTDARLDMMIV---LDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
            +    +  +     +D M V    D S     F +     I M   +    ++  +   
Sbjct: 201 SLVPYSEQVNAGPLIMDRMNVNRKHDYSH-CIDFDNGDFDSIAMNSSTRYNQMQHFQWNY 259

Query: 214 DVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQ---- 269
           D  N  +   V      E           L+ +I  L      T+   G+K+A       
Sbjct: 260 DGRNNYRDDTVCPRYDYERITPFSQNKRTLKNQIDDLVPR-AGTSIFLGMKWAAAMLDPA 318

Query: 270 ------------IFDMQGMRQHCNTEDANYKKIIVFMTDGEN--------LSTKEDQQSL 309
                         D +   +  +  D+   K ++ MTDG N             D + +
Sbjct: 319 FRDINNSLVNAGYVDREFYNRPASYTDSETLKTVILMTDGANDNSYRIRSNYYDSDSEYV 378

Query: 310 --------------------------------------YYCNEAKKRGAIVYAIGIR-VI 330
                                                   C+ AK +  ++++IG     
Sbjct: 379 HWNKYNLWWYLRREVDSRYWGYFYYHKYNKTLGNTLLSNICDAAKAKRIVIWSIGFEVDD 438

Query: 331 RSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
                ++ CAS  S +       + +AF  I + I   R+
Sbjct: 439 EDVPAMQDCASSPSHFFRVEGVELSEAFRAIARQINQLRL 478


>gi|298207017|ref|YP_003715196.1| aerotolerance-related membrane protein [Croceibacter atlanticus
           HTCC2559]
 gi|83849651|gb|EAP87519.1| aerotolerance-related membrane protein [Croceibacter atlanticus
           HTCC2559]
          Length = 334

 Score =  118 bits (295), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 35/243 (14%), Positives = 73/243 (30%), Gaps = 49/243 (20%)

Query: 154 IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
           +  P T  V   ++T   +D+++ +DVS SM +       +++      +  ++      
Sbjct: 74  MARPRTVDVSTKTKTTKGIDIVMAIDVSASMLARDL-RPNRLEALKDVASEFIQG----- 127

Query: 214 DVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFG---VSTNSTPGLKYAYNQI 270
                 + G+V ++ +      +    S +   +  +         T    G        
Sbjct: 128 --RPNDRVGIVLYAGESYTKTPITSDKSIVLGALNDVKFSEVLENGTAIGMG-------- 177

Query: 271 FDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI 330
                   +   +     K+I+ +TDG N S   D         A + G   Y IGI   
Sbjct: 178 ---LATSVNRLKDSKALSKVIILLTDGVNNSGTID--PKLASELAVEYGIKTYTIGIGSN 232

Query: 331 -----------------------RSHEFLRACAS--PNSFYLVENPHSMYDAFSHIGKDI 365
                                     + L+  A+     ++   N   +   +  I K  
Sbjct: 233 GMALSPIGIKSNGQFQYGNQKVEIDEDLLKQIATVTGGQYFRATNNQKLEAIYEEINKLE 292

Query: 366 VTK 368
            T+
Sbjct: 293 KTE 295


>gi|257469959|ref|ZP_05634051.1| hypothetical protein FulcA4_11506 [Fusobacterium ulcerans ATCC
           49185]
 gi|317064188|ref|ZP_07928673.1| BatA protein [Fusobacterium ulcerans ATCC 49185]
 gi|313689864|gb|EFS26699.1| BatA protein [Fusobacterium ulcerans ATCC 49185]
          Length = 319

 Score =  118 bits (295), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 38/229 (16%), Positives = 81/229 (35%), Gaps = 39/229 (17%)

Query: 168 TDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFS 227
               +D+ I LD+S+SM      +  +++ A + ++  +       D     +  L+ F 
Sbjct: 78  KKDGIDIAISLDLSQSMLQEDF-TPNRLEKAKEVLSEFI-------DKRTDDRLALIVFG 129

Query: 228 NKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287
                   L +  + ++     L+   +++N+   +        +          +    
Sbjct: 130 GDAYTKVPLTFDHNVIKEMTGKLTVDDITSNTRTAIGMGIGVALN-------RLKDSEAK 182

Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR-----------------VI 330
            K+I+ +TDGEN S +         + AK+ G  +Y IGI                    
Sbjct: 183 SKVIILLTDGENNSGEMSPS--AAADIAKELGIKIYTIGIGAKEIKVPSFFGYTTVKNTE 240

Query: 331 RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK---RIWYDK 374
                L++ A  +   ++   +     + F+ I     T+   R +YDK
Sbjct: 241 LDENMLKSIAETTGGEYFRASDSKEFKEIFNKIDALEKTQIDGRSFYDK 289


>gi|160882770|ref|ZP_02063773.1| hypothetical protein BACOVA_00731 [Bacteroides ovatus ATCC 8483]
 gi|237720676|ref|ZP_04551157.1| BatA [Bacteroides sp. 2_2_4]
 gi|260170239|ref|ZP_05756651.1| aerotolerance protein BatA [Bacteroides sp. D2]
 gi|293373990|ref|ZP_06620331.1| von Willebrand factor type A domain protein [Bacteroides ovatus SD
           CMC 3f]
 gi|299145608|ref|ZP_07038676.1| BatA protein [Bacteroides sp. 3_1_23]
 gi|315918602|ref|ZP_07914842.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|156111794|gb|EDO13539.1| hypothetical protein BACOVA_00731 [Bacteroides ovatus ATCC 8483]
 gi|229449511|gb|EEO55302.1| BatA [Bacteroides sp. 2_2_4]
 gi|292631066|gb|EFF49703.1| von Willebrand factor type A domain protein [Bacteroides ovatus SD
           CMC 3f]
 gi|298516099|gb|EFI39980.1| BatA protein [Bacteroides sp. 3_1_23]
 gi|313692477|gb|EFS29312.1| conserved hypothetical protein [Bacteroides sp. D2]
          Length = 327

 Score =  118 bits (295), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 37/234 (15%), Positives = 71/234 (30%), Gaps = 46/234 (19%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           ++ K  +     +D+M+ +DVS SM +       +++ A       +       +     
Sbjct: 76  TTNKWQNSEIEGIDIMLAIDVSTSMLAEDLK-PNRLEAAKDVAAEFI-------NGRPND 127

Query: 220 QSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSK--FGVSTNSTPGLKYAYNQIFDMQGMR 277
             G+  F+ +      L    + L   I  +        T    G+  A           
Sbjct: 128 NIGITLFAGETFTQCPLTVDHAVLLDMIHNIKCGLITDGTAVGMGIANAVT--------- 178

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI------- 330
                +     K+I+ +TDG N     D   +     AK  G  VY IG+          
Sbjct: 179 --RLKDSKAKSKVIILLTDGTNNKG--DISPMTAAEIAKSFGIRVYTIGVGTNGMAPYPY 234

Query: 331 --------------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                            + L   A  +  +++   +   + + +  I K   TK
Sbjct: 235 PVGNTVQYVSMPVEIDEKTLTEIAGTTDGNYFRATSNSKLKEVYEEIDKLEKTK 288


>gi|237716505|ref|ZP_04546986.1| aerotolerance protein BatA [Bacteroides sp. D1]
 gi|262408103|ref|ZP_06084651.1| conserved hypothetical protein [Bacteroides sp. 2_1_22]
 gi|294645097|ref|ZP_06722823.1| von Willebrand factor type A domain protein [Bacteroides ovatus SD
           CC 2a]
 gi|294809498|ref|ZP_06768201.1| von Willebrand factor type A domain protein [Bacteroides
           xylanisolvens SD CC 1b]
 gi|298484179|ref|ZP_07002345.1| BatA protein [Bacteroides sp. D22]
 gi|229444152|gb|EEO49943.1| aerotolerance protein BatA [Bacteroides sp. D1]
 gi|262354911|gb|EEZ04003.1| conserved hypothetical protein [Bacteroides sp. 2_1_22]
 gi|292639603|gb|EFF57895.1| von Willebrand factor type A domain protein [Bacteroides ovatus SD
           CC 2a]
 gi|294443316|gb|EFG12080.1| von Willebrand factor type A domain protein [Bacteroides
           xylanisolvens SD CC 1b]
 gi|295084189|emb|CBK65712.1| von Willebrand factor type A domain. [Bacteroides xylanisolvens
           XB1A]
 gi|298269683|gb|EFI11278.1| BatA protein [Bacteroides sp. D22]
          Length = 327

 Score =  118 bits (294), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 37/234 (15%), Positives = 71/234 (30%), Gaps = 46/234 (19%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           ++ K  +     +D+M+ +DVS SM +       +++ A       +       +     
Sbjct: 76  TTNKWQNSEIEGIDIMLAIDVSTSMLAEDLK-PNRLEAAKDVAAEFI-------NGRPND 127

Query: 220 QSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSK--FGVSTNSTPGLKYAYNQIFDMQGMR 277
             G+  F+ +      L    + L   I  +        T    G+  A           
Sbjct: 128 NIGITLFAGETFTQCPLTVDHAVLLDMIHNIKCGLITDGTAVGMGIANAVT--------- 178

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI------- 330
                +     K+I+ +TDG N     D   +     AK  G  VY IG+          
Sbjct: 179 --RLKDSKAKSKVIILLTDGTNNKG--DISPMTAAEIAKSFGIRVYTIGVGTNGMAPYPY 234

Query: 331 --------------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                            + L   A  +  +++   +   + + +  I K   TK
Sbjct: 235 PVGNTVQYVSMPVEIDEKTLTEIAGTTDGNYFRATSNSKLKEVYEEIDKLEKTK 288


>gi|153806291|ref|ZP_01958959.1| hypothetical protein BACCAC_00547 [Bacteroides caccae ATCC 43185]
 gi|149130968|gb|EDM22174.1| hypothetical protein BACCAC_00547 [Bacteroides caccae ATCC 43185]
          Length = 327

 Score =  117 bits (293), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 38/234 (16%), Positives = 71/234 (30%), Gaps = 46/234 (19%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           ++ K  +     +D+M+ +DVS SM +       +++ A       +       +     
Sbjct: 76  TTNKWQNSEIEGIDIMLAIDVSTSMLAEDLK-PNRLEAAKDVAAEFI-------NGRPND 127

Query: 220 QSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSK--FGVSTNSTPGLKYAYNQIFDMQGMR 277
             G+  F+ +      L    + L   I  +        T    G+  A           
Sbjct: 128 NIGITLFAGETFTQCPLTVDHAVLLDMIHNIKCGLIEDGTAVGMGIANAVT--------- 178

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI------- 330
                +     K+I+ +TDG N     D   L     AK  G  VY IG+          
Sbjct: 179 --RLKDSKAKSKVIILLTDGTNNKG--DISPLTAAEIAKSFGIRVYTIGVGTNGMAPYPY 234

Query: 331 --------------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                            + L   A  +  +++   +   + + +  I K   TK
Sbjct: 235 PVGNTVQYVNMPVEIDEKTLTQIAGTTDGNYFRATSNSKLKEVYEEIDKLEKTK 288


>gi|144898053|emb|CAM74917.1| conserved hypothetical protein, secreted [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 460

 Score =  117 bits (293), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 50/461 (10%), Positives = 125/461 (27%), Gaps = 99/461 (21%)

Query: 6   LNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQI 65
           + +R   ++ +G + I+ A+ L  + L +G+ ++ +  + +K+ L   +D + +   +  
Sbjct: 1   MILRRLMHDRRGTVAIIFALALIPLSLSVGLAVDTARAYAVKSKLSQALDAAALAVGSST 60

Query: 66  MNEG----NGNNRKKLKGGDILCRIKNTWNMSFRNELRDN----------GFVNDIDDIV 111
                    G         D       ++++S   ++               +  ID I 
Sbjct: 61  GTAAELQQIGQKFFDANFKDSGLDAAGSFSVSVTGDVVSANGSAQVQTTLMQLVGIDTIA 120

Query: 112 RSTSLDIVVVPQNEGYSISAISRYKIPL-----------KFCTFIPWYTNSRHIVMPITS 160
            S S  ++   +    ++   +   +             +    I +   + H  + +  
Sbjct: 121 VSESAQVIRSIKGLELALVLDNTGSMTTSDNIGALRDAAQELVDILFGGRADHPTLRVAV 180

Query: 161 SVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIK-SINAMLEEVKLIPDVNNVV 219
                S     +   ++   S +      + +      I+    AM +            
Sbjct: 181 VPYSASVNPGPIAPTLI---SGNDAYAPTNLLGWKGCVIERVGRAMEDSPASTAPWLRYQ 237

Query: 220 QSGLVTFSNKIEEFFLLEWGVSHLQ------------------------RKIKYLSKFG- 254
               +       +   +    S                             I+ L  +  
Sbjct: 238 WLPAIDNYYDATKASTVRADPSQGNGGTGPNLGCPTPITPLTGVKATVDSAIQALRAWSR 297

Query: 255 VSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTK----------- 303
             T    G+ +    +       +        + K ++ MTDG+N   K           
Sbjct: 298 GGTMGDIGMAWGLRVLSPEPPFTEGLAWNTPKWAKAVILMTDGDNQFYKLTSTTGPNKVN 357

Query: 304 ------------------------------EDQQSLYYCNEAKKRGAIVYAIGIRVIRSH 333
                                          + +    C   K +G  VY I      + 
Sbjct: 358 SAVNSDYSGYGRLDQYGALGTTSTTTAKSVINTRLTQVCQAMKDKGITVYTITFTSGINQ 417

Query: 334 ---EFLRACASP-NSFYLVENPHSMYDAFSHIGKDIVTKRI 370
              +  +ACAS    ++   +   +  +F  I  ++   R+
Sbjct: 418 ATKDIYKACASSTAKWFDSPSQADLRASFRAIATELSQLRV 458


>gi|167946540|ref|ZP_02533614.1| BatB protein, putative [Endoriftia persephone 'Hot96_1+Hot96_2']
          Length = 345

 Score =  117 bits (293), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 32/228 (14%), Positives = 74/228 (32%), Gaps = 49/228 (21%)

Query: 170 ARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVT 225
           A  D+M+ +D SRSM +         ++++ +    +   +       D     + GL+ 
Sbjct: 94  AGYDLMLAVDTSRSMTAEDFTVHGREVSRLSVLKGIMGKFV-------DGRVGDRIGLII 146

Query: 226 FSNKIEEFFLLEWGVSHLQRKIKYLSKF--GVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           F +       L +  + + + +  +     G  T    G+                   E
Sbjct: 147 FGDTSYVLSPLTFDRNAIHQLLDGIVPTLAGGGTAIGDGIGLGIK-----------KLRE 195

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV-------------- 329
                ++++ +TDG+N +       L     AK+ G  +Y IG+                
Sbjct: 196 RPEGSRVLILVTDGKNETGTIP--PLKAAQLAKQEGIRIYTIGVGSTKNRVRLLSPDLRT 253

Query: 330 -------IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                      E L+  A  +  +++   +   +   +  I +   ++
Sbjct: 254 YEIATGLAIDEETLQQIAETTGGAYFRANDTAGLEKVYQRIDELEKSE 301


>gi|86143679|ref|ZP_01062055.1| batA protein [Leeuwenhoekiella blandensis MED217]
 gi|85829722|gb|EAQ48184.1| batA protein [Leeuwenhoekiella blandensis MED217]
          Length = 334

 Score =  117 bits (293), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 35/242 (14%), Positives = 75/242 (30%), Gaps = 49/242 (20%)

Query: 154 IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
           +  P    V   + T   +D++I +DVS SM +       +++   +  +  + +     
Sbjct: 74  LARPRNVDVSTRTNTTRGIDIVIAIDVSASMLARDLK-PNRLEALKEVASQFIAD----- 127

Query: 214 DVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFG---VSTNSTPGLKYAYNQI 270
                 + GLV ++ +      +    S +   +  +         T    G        
Sbjct: 128 --RPSDRIGLVEYAGESYTRTPITSDKSIVLSSLNDIQYNSIIEGGTAIGMG-------- 177

Query: 271 FDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI 330
                   +   +     K+I+ MTDG N +     +       A++ G  VY IG+   
Sbjct: 178 ---LATSVNRLKDSRAKSKVIILMTDGVNNAGFI--EPSTASELAQEFGIKVYTIGLGTN 232

Query: 331 -----------------------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                                       L+  A  +   ++   +  S+ + ++ I K  
Sbjct: 233 GTALSPVALRPDGSFQYGSIPVEIDEALLQEIADKTGGLYFRATDNESLEEIYAEINKLE 292

Query: 366 VT 367
            T
Sbjct: 293 KT 294


>gi|167752252|ref|ZP_02424379.1| hypothetical protein ALIPUT_00495 [Alistipes putredinis DSM 17216]
 gi|167660493|gb|EDS04623.1| hypothetical protein ALIPUT_00495 [Alistipes putredinis DSM 17216]
          Length = 328

 Score =  117 bits (293), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 40/235 (17%), Positives = 73/235 (31%), Gaps = 47/235 (20%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           S  + ++     +D+++ +D+S SM +       +I  A +     +             
Sbjct: 76  SVDEGSTSNTEGIDIVLAIDISTSMLAQDL-QPDRIQAAKQVAGNFI-------TDRPGD 127

Query: 220 QSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSK--FGVSTNSTPGLKYAYNQIFDMQGMR 277
           + GLV F+ +      L      LQ  +  L        T    GL  A N         
Sbjct: 128 RIGLVAFAGEAFTQSPLTTDQGTLQTLLGRLRSGVVEDGTAIGNGLATAIN--------- 178

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV-------- 329
                E     K+I+ +TDGEN   +     L     A+ +G  VY IG+          
Sbjct: 179 --RLRESNAKSKVIILLTDGENNRGEI--APLTAAEIARDQGIRVYTIGVGTRGTAPYPT 234

Query: 330 --------------IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                             + L   A  +   ++   +   +   +  I +   +K
Sbjct: 235 VDFFGNPTVVQAKVQIDEKILGEIADLTGGRYFRATDNAKLQSIYDEINQLEKSK 289


>gi|255693880|ref|ZP_05417555.1| BatA protein [Bacteroides finegoldii DSM 17565]
 gi|260620309|gb|EEX43180.1| BatA protein [Bacteroides finegoldii DSM 17565]
          Length = 327

 Score =  117 bits (292), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 37/234 (15%), Positives = 71/234 (30%), Gaps = 46/234 (19%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           ++ K  +     +D+M+ +DVS SM +       +++ A       +       +     
Sbjct: 76  TTNKWQNSEIEGIDIMLAVDVSTSMLAEDLK-PNRLEAAKDVAAEFI-------NGRPND 127

Query: 220 QSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSK--FGVSTNSTPGLKYAYNQIFDMQGMR 277
             G+  F+ +      L    + L   I  +        T    G+  A           
Sbjct: 128 NIGITLFAGESFTQCPLTVDHAVLLDMIHNIKCGLIEDGTAVGMGIANAVT--------- 178

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI------- 330
                +     K+I+ +TDG N     D   +     AK  G  VY IG+          
Sbjct: 179 --RLKDSKAKSKVIILLTDGTNNKG--DISPMTAAEIAKSFGIRVYTIGVGTNGMAPYPY 234

Query: 331 --------------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                            + L   A  +  +++   +   + + +  I K   TK
Sbjct: 235 PVGNTVQYVSMPVEIDEKTLTQIAGTTDGNYFRATSNSKLKEVYEEIDKLEKTK 288


>gi|83941160|ref|ZP_00953622.1| hypothetical protein EE36_02988 [Sulfitobacter sp. EE-36]
 gi|83846980|gb|EAP84855.1| hypothetical protein EE36_02988 [Sulfitobacter sp. EE-36]
          Length = 480

 Score =  117 bits (292), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 72/460 (15%), Positives = 131/460 (28%), Gaps = 98/460 (21%)

Query: 4   LNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAA- 62
           L   +  F     G +TIL    + ++  V G+ ++       ++ L ++ DR+++ AA 
Sbjct: 24  LRKRLTRFAREDDGLVTILALFMIMMMIAVGGIQLDFMRHEMERSRLQAVSDRAVLAAAD 83

Query: 63  ---TQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVR------- 112
               +       +   K    + L  +     ++FR    D     D   I R       
Sbjct: 84  LDQMRDPKTVVEDYFAKSGMTEFLSNVVVDDGLNFRTVTVDASKDMDTQFIGRFGFPTLE 143

Query: 113 ----------------STSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVM 156
                           S  LDI                  I   F   +    N   I +
Sbjct: 144 VPAHSQAEERVAKVEISLVLDISGSMATNNRLGEVQDAADI---FLDTVLKDENEDLISV 200

Query: 157 PITSSVKVNSQTDARLDMMIV---LDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
            +    +  +     +D M V    D S     F +     I M   +    ++  +   
Sbjct: 201 SLVPYSEQVNAGPLIMDRMNVNRKHDYSH-CIDFDNGDFDSIAMNSSTRYNQMQHFQWNY 259

Query: 214 DVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQ---- 269
           D  N  +   V      E           L+ +I  L      T+   G+K+A       
Sbjct: 260 DGRNNYRDDTVCPRYDYERITPFSQNKRTLKNQIDDLVPR-AGTSIFLGMKWAAAMLDPA 318

Query: 270 ------------IFDMQGMRQHCNTEDANYKKIIVFMTDGEN--------LSTKEDQQSL 309
                         D +   +  +  D+   K ++ MTDG N            ED + +
Sbjct: 319 FRDINNSLVNAGHVDREFYNRPASYTDSETLKTVILMTDGANDNSFRISNTYYNEDSEYV 378

Query: 310 --------------------------------------YYCNEAKKRGAIVYAIGIR-VI 330
                                                   C+ AK +  ++++IG     
Sbjct: 379 HWNRYNLWWYLRREVNSRYWGYFYYQKYNKSLGNTLLSNICDAAKAKRIVIWSIGFEVDD 438

Query: 331 RSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
                ++ CAS  S +       + +AF  I + I   R+
Sbjct: 439 EDVPAMQDCASSPSHFFRVEGVELSEAFRAIARQINQLRL 478


>gi|306821351|ref|ZP_07454960.1| von Willebrand factor [Eubacterium yurii subsp. margaretiae ATCC
           43715]
 gi|304550638|gb|EFM38620.1| von Willebrand factor [Eubacterium yurii subsp. margaretiae ATCC
           43715]
          Length = 467

 Score =  117 bits (292), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 34/196 (17%), Positives = 69/196 (35%), Gaps = 26/196 (13%)

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
            +++  V+D S SM     + + +               K I  + +   + ++ F  K 
Sbjct: 26  GINIAFVIDSSGSMFYNDPNGLRR-----------EVTHKFIDRLTDNDMAAVIGFDYKA 74

Query: 231 EEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKI 290
                       L   +  +   G  TN    +  AY+   ++   R+        Y K 
Sbjct: 75  TVLEQFTSNKEKLHDAVDKIRSDG-GTNIGRAVSIAYDLFNNLDNNRK------EKYPKF 127

Query: 291 IVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA--SPNSFYLV 348
           ++ +TDG+   ++E          AKK G  +Y IG+    S + L+  A  +   ++  
Sbjct: 128 LILLTDGDGDYSEEYTI------LAKKAGIKIYTIGLGNGVSEKLLKDIAKGTDGEYFHA 181

Query: 349 ENPHSMYDAFSHIGKD 364
           ++   +   F  I   
Sbjct: 182 KDASKLNKIFEKIADK 197


>gi|224024929|ref|ZP_03643295.1| hypothetical protein BACCOPRO_01660 [Bacteroides coprophilus DSM
           18228]
 gi|224018165|gb|EEF76163.1| hypothetical protein BACCOPRO_01660 [Bacteroides coprophilus DSM
           18228]
          Length = 332

 Score =  117 bits (292), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 40/258 (15%), Positives = 77/258 (29%), Gaps = 51/258 (19%)

Query: 141 FCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIK 200
           F   I  +     ++    ++    +     +D+M+ +DVS SM +       +++ A +
Sbjct: 57  FLLRIVAFVMIVLVLARPQTTDNWQNTEIEGIDIMLAVDVSTSMLAEDLK-PNRLEAAKQ 115

Query: 201 SINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKF------- 253
                +       +       GL  F+ +      L      L    + +          
Sbjct: 116 VAAEFI-------NGRPNDNIGLTIFAGEAFTQCPLTVDHGVLLNLFQSIKCDIAQKGLI 168

Query: 254 GVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCN 313
              T    GL  A +              +     K+I+ +TDG N     D   L    
Sbjct: 169 MDGTALGMGLANAVS-----------RLKDSKAKSKVIILLTDGVNNRG--DISPLTAAE 215

Query: 314 EAKKRGAIVYAIGIRVI---------------------RSHEFLRACA--SPNSFYLVEN 350
            AK+ G  VY IG+                           + L   A  +  +++   +
Sbjct: 216 IAKQFGIRVYTIGVGTNGTAPYPMQTYAGVQYVQVPVEIDEQTLTQIAGTTNGNYFRATS 275

Query: 351 PHSMYDAFSHIGKDIVTK 368
              + + +  I K   TK
Sbjct: 276 NSKLKEVYQEIDKLEKTK 293


>gi|237737388|ref|ZP_04567869.1| BatA protein [Fusobacterium mortiferum ATCC 9817]
 gi|229421250|gb|EEO36297.1| BatA protein [Fusobacterium mortiferum ATCC 9817]
          Length = 319

 Score =  117 bits (292), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 40/229 (17%), Positives = 79/229 (34%), Gaps = 39/229 (17%)

Query: 168 TDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFS 227
               +D+++ LD+S+SM         +++ A K +   +       D     +  LV F 
Sbjct: 78  KKEGIDIVVALDLSQSMLQRDFK-PNRLETAKKLLEEFI-------DKRINDRISLVVFG 129

Query: 228 NKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287
                   L +  + ++     L+   +++N+   +        +          +    
Sbjct: 130 GDAYTKVPLTFDHNVVKDITSKLTTDDITSNNRTAIGMGLGVSLN-------RLKDSEAK 182

Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR-----------------VI 330
            K+I+ MTDGEN S +     +     AK+ G  +Y IGI                    
Sbjct: 183 SKVIILMTDGENNSGE--MSPMGASEIAKELGIKIYTIGIGAREIQIRVPFGHTTVKNTE 240

Query: 331 RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK---RIWYDK 374
                L+  A  +   ++   +     + F+ I     TK   R +Y+K
Sbjct: 241 LDENLLKNIASTTGGEYFRAGSEKEFQEIFNRIDSLEKTKIDGRSYYEK 289


>gi|332664649|ref|YP_004447437.1| von Willebrand factor type A [Haliscomenobacter hydrossis DSM 1100]
 gi|332333463|gb|AEE50564.1| von Willebrand factor type A [Haliscomenobacter hydrossis DSM 1100]
          Length = 328

 Score =  117 bits (292), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 40/226 (17%), Positives = 76/226 (33%), Gaps = 48/226 (21%)

Query: 170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229
             +D+M+ +D+S SM +       +++++ K     ++            + GLV F+ +
Sbjct: 85  NGIDIMLSMDLSSSMLAQDF-EPNRLEVSKKMAIEFVKG-------RPHDRIGLVVFAGE 136

Query: 230 IEEFFLLEWGVSHLQRKIKYLSKFG--VSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287
                 L      L+  ++ L        T    GL  A N              +    
Sbjct: 137 AFTQCPLTTDHKILETFLEQLECGNLEDGTAIGMGLAGAVN-----------RLKKSPAK 185

Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV------------------ 329
            K+I+ +TDG N       + L     AK+ G  VY+IG+                    
Sbjct: 186 SKVIILLTDGVNNVG--YFKPLTAGELAKELGIKVYSIGVGTIGEALTPVSRLSDGSFFL 243

Query: 330 -----IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                    E LR  A  +   ++  +N   +   ++ I +   T+
Sbjct: 244 DYAQVEIDEELLREIARMTGGQYFRAKNNQDLRQIYNTIDRLEKTE 289


>gi|149371021|ref|ZP_01890616.1| aerotolerance-related membrane protein [unidentified eubacterium
           SCB49]
 gi|149355807|gb|EDM44365.1| aerotolerance-related membrane protein [unidentified eubacterium
           SCB49]
          Length = 334

 Score =  117 bits (292), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 36/233 (15%), Positives = 70/233 (30%), Gaps = 49/233 (21%)

Query: 163 KVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSG 222
               ++   +D+++ +DVS SM +       ++    +     +       +     + G
Sbjct: 83  STRVKSTKGIDIVMAIDVSASMLARDLK-PDRLQALKQVAARFI-------NGRPNDRIG 134

Query: 223 LVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFG---VSTNSTPGLKYAYNQIFDMQGMRQH 279
           LV ++ +      L    + +   +  +         T    GL  A N           
Sbjct: 135 LVEYAGESYTKTPLTSDKTVVLSSLNSIEYNSIIEGGTAIGMGLATAVN----------- 183

Query: 280 CNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI--------- 330
              E     K+I+ +TDGEN S   D         A + G  VY IG+            
Sbjct: 184 RLKESTAKSKVIILLTDGENNSGFID--PKIASELAVEFGIKVYTIGLGTNGMASSPIGI 241

Query: 331 --------------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVT 367
                              L+  A  +   ++   +   + + +  I K   T
Sbjct: 242 LPNGRFQYGNQPVKIDETLLKEIAKTTGGQYFRATSNTKLNEIYEEINKLEKT 294


>gi|218515283|ref|ZP_03512123.1| hypothetical protein Retl8_17130 [Rhizobium etli 8C-3]
          Length = 329

 Score =  117 bits (292), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 59/326 (18%), Positives = 100/326 (30%), Gaps = 52/326 (15%)

Query: 92  MSFRNELRDNGFVNDIDDIVRS-TSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTN 150
            +F      N   + +D    +  ++       +  Y ++    Y + +        +T 
Sbjct: 1   RNFVAGQMANYLQSGVDIKSATGVTVQTNTSGNSTSYQVTVSPSYDLTVNPLMQAVGFTT 60

Query: 151 SRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSM-------------------------- 184
                   T      +Q    + M + LD S SM                          
Sbjct: 61  QHLSTSGTTIGGHSQTQ--GSISMYLALDKSGSMGEDTATVNEEDPTESYTYDCNGHYNK 118

Query: 185 ---------ESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFL 235
                         +  TKI+    +   +  ++         V++G V++         
Sbjct: 119 KGKWIYDTCTGSRANYYTKIEALKMAAGNLFGQLSSADPNAQYVRTGAVSYDIVQYTPSA 178

Query: 236 LEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAY------NQIFDMQGMRQHCNTEDANYKK 289
           L WG S +   +  L   G  TNS+  +  AY      N   +      H        KK
Sbjct: 179 LAWGTSGVSTYVNALQA-GGGTNSSGAMSTAYSSLTAKNAAGNDAEDAAHKLKTGQTPKK 237

Query: 290 IIVFMTDGENLSTKE-----DQQSLYYCNEAKKRGAIVYAIGIRVIR-SHEFLRACASPN 343
            IVFMTDG+N          D  +   C+ AK +G  +Y I           L  CAS +
Sbjct: 238 YIVFMTDGDNNDDSSGGRSYDTLTKATCDTAKSKGIEIYTIAFMAPEGGQALLHYCASDD 297

Query: 344 -SFYLVENPHSMYDAFSHIGKDIVTK 368
             ++  E    +  AF  IG    ++
Sbjct: 298 SHYFQAEKMEDLLAAFKAIGAKASSQ 323


>gi|332877593|ref|ZP_08445337.1| von Willebrand factor type A domain protein [Capnocytophaga sp.
           oral taxon 329 str. F0087]
 gi|332684442|gb|EGJ57295.1| von Willebrand factor type A domain protein [Capnocytophaga sp.
           oral taxon 329 str. F0087]
          Length = 333

 Score =  117 bits (292), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 38/242 (15%), Positives = 77/242 (31%), Gaps = 48/242 (19%)

Query: 154 IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
           +  P T S    ++    +D+++ +DVS SM S       + +   K  +  +++     
Sbjct: 74  LARPQTHSENAKTKITDGIDIVMAIDVSASMLSQDLK-PNRFEALKKVASQFVKD----- 127

Query: 214 DVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFG--VSTNSTPGLKYAYNQIF 271
                 + GLV ++ +      +      +   +  ++       T    GL  A N   
Sbjct: 128 --RPNDRIGLVIYAGESYTKTPVTTDKLIILNALSEITYGQIEDGTAIGMGLATAVN--- 182

Query: 272 DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV-- 329
                      E     ++I+ +TDG N +   D Q+      A + G  VY +GI    
Sbjct: 183 --------RLKESKAKSRVIILLTDGVNNTGFIDPQT--AAELAAEYGIKVYTVGIGTNG 232

Query: 330 ---------------------IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIV 366
                                      ++  A  +   ++   N   +   +  I +   
Sbjct: 233 MALSPYALNADGSIIYRMQQVDIDEPLMKKIAQVTKGRYFRATNNQKLQQIYDEINQMET 292

Query: 367 TK 368
           TK
Sbjct: 293 TK 294


>gi|253568262|ref|ZP_04845673.1| aerotolerance protein BatA [Bacteroides sp. 1_1_6]
 gi|298385671|ref|ZP_06995229.1| BatA protein [Bacteroides sp. 1_1_14]
 gi|251842335|gb|EES70415.1| aerotolerance protein BatA [Bacteroides sp. 1_1_6]
 gi|298261812|gb|EFI04678.1| BatA protein [Bacteroides sp. 1_1_14]
          Length = 327

 Score =  116 bits (291), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 39/234 (16%), Positives = 71/234 (30%), Gaps = 46/234 (19%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           S+ K  +     +D+M+ +DVS SM +       +++ A       +       +     
Sbjct: 76  STNKWQNSEIEGIDIMLAIDVSTSMLAEDLK-PNRLEAAKDVAAEFI-------NGRPND 127

Query: 220 QSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSK--FGVSTNSTPGLKYAYNQIFDMQGMR 277
             G+  F+ +      L    + L   I  +        T    G+  A           
Sbjct: 128 NIGITLFAGETFTQCPLTVDHAVLLDMIHNIKCGLIEDGTAVGMGVANAVT--------- 178

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI------- 330
                +     K+I+ +TDG N     D   L     AK  G  VY IG+          
Sbjct: 179 --RLKDSKAKSKVIILLTDGTNNKG--DISPLTAAEIAKSFGIRVYTIGVGTNGMAPYPY 234

Query: 331 --------------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                            + L   A  +  +++   +   + + +  I K   TK
Sbjct: 235 PVGNTVQYINMPVEIDEKTLTQIAGTTDGNYFRATSNSKLKEVYEEIDKLEKTK 288


>gi|29346317|ref|NP_809820.1| aerotolerance protein BatA [Bacteroides thetaiotaomicron VPI-5482]
 gi|29338212|gb|AAO76014.1| BatA [Bacteroides thetaiotaomicron VPI-5482]
          Length = 327

 Score =  116 bits (291), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 39/234 (16%), Positives = 71/234 (30%), Gaps = 46/234 (19%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           S+ K  +     +D+M+ +DVS SM +       +++ A       +       +     
Sbjct: 76  STNKWQNSEIEGIDIMLAIDVSTSMLAEDLK-PNRLEAAKDVAAEFI-------NGRPND 127

Query: 220 QSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSK--FGVSTNSTPGLKYAYNQIFDMQGMR 277
             G+  F+ +      L    + L   I  +        T    G+  A           
Sbjct: 128 NIGITLFAGETFTQCPLTVDHAVLLDMIHNIKCGLIEDGTAVGMGVANAVT--------- 178

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI------- 330
                +     K+I+ +TDG N     D   L     AK  G  VY IG+          
Sbjct: 179 --RLKDSKAKSKVIILLTDGTNNKG--DISPLTAAEIAKSFGIRVYTIGVGTNGMAPYPY 234

Query: 331 --------------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                            + L   A  +  +++   +   + + +  I K   TK
Sbjct: 235 PVGNTVQYINMPVEIDEKTLTQIAGTTDGNYFRATSNSKLKEVYEEIDKLEKTK 288


>gi|160889563|ref|ZP_02070566.1| hypothetical protein BACUNI_01987 [Bacteroides uniformis ATCC 8492]
 gi|317480055|ref|ZP_07939167.1| von Willebrand factor type A domain-containing protein [Bacteroides
           sp. 4_1_36]
 gi|156861080|gb|EDO54511.1| hypothetical protein BACUNI_01987 [Bacteroides uniformis ATCC 8492]
 gi|316903797|gb|EFV25639.1| von Willebrand factor type A domain-containing protein [Bacteroides
           sp. 4_1_36]
          Length = 327

 Score =  116 bits (291), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 37/234 (15%), Positives = 71/234 (30%), Gaps = 46/234 (19%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           ++    +     +D+M+ +DVS SM +       +++ A       +       +     
Sbjct: 76  TTDSWQNSEIEGIDIMLAMDVSTSMLAEDLK-PNRLEAAKDVAAEFI-------NGRPND 127

Query: 220 QSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSK--FGVSTNSTPGLKYAYNQIFDMQGMR 277
             G+  F+ +      L    + L   +K +        T    G+  A           
Sbjct: 128 NIGITLFAGESFTQCPLTVDHAVLLNLLKDMKCGLIEDGTAIGMGIANAVT--------- 178

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI------- 330
                +     K+I+ +TDG N     D   L     AK  G  VY IG+          
Sbjct: 179 --RLKDSKAKSKVIILLTDGVNNKG--DISPLTAAEIAKSFGIRVYTIGVGTNGMAPYPY 234

Query: 331 --------------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                            + L   A  +  +++   +   + + +  I K   TK
Sbjct: 235 PVGGTVQYVNMPVEIDEKTLTQIAGTTEGNYFRATSNSKLKEVYEEIDKLEKTK 288


>gi|115525407|ref|YP_782318.1| hypothetical protein RPE_3406 [Rhodopseudomonas palustris BisA53]
 gi|115519354|gb|ABJ07338.1| conserved hypothetical protein [Rhodopseudomonas palustris BisA53]
          Length = 580

 Score =  116 bits (291), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 42/285 (14%), Positives = 85/285 (29%), Gaps = 34/285 (11%)

Query: 4   LNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAAT 63
           L  +   F  +  G + +L  I    +   +G  ++ S     +T + S +D + +  A 
Sbjct: 9   LRKSAARFIADRSGNIAVLFGIACVPLITFVGAAVDYSRAVAARTAMQSALDSTALMVAK 68

Query: 64  QIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQ 123
                    +    K              S  + L  N   N ++ +   T         
Sbjct: 69  DYSLNKISASEIDGK------------AKSIFSALYTNKSANSVEVVAVLTPNT------ 110

Query: 124 NEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRS 183
            +G +I      K+P  F        N   I +  +S+    +    RL + +VLD + S
Sbjct: 111 GKGSTIKVDGTGKVPTDFM----KLVNISQIDIGASST---TTWGSTRLRVALVLDTTGS 163

Query: 184 MESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE----FFLLEWG 239
           M         KI     +   +L ++K        V   ++ FS  +      +      
Sbjct: 164 MNDNG-----KIGALKTATQNLLTQLKDAAGKPEDVYVSIIPFSKDVNVGASNYTANWID 218

Query: 240 VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
            +  + +   L      + S      A+  +          +   
Sbjct: 219 WTDWKSQPPVLDYAKSGSKSGLVDNVAWKDVGPGSKCPFSDSKHG 263



 Score = 59.1 bits (141), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 33/175 (18%), Positives = 56/175 (32%), Gaps = 25/175 (14%)

Query: 220 QSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQ-IFDMQGMRQ 278
           +      S+   +   +    + +   +  L   G  TN   GL + +   +        
Sbjct: 405 RFPAEQISSCAPKVTEMNNNWATMNTTVDGLFPVG-GTNQPIGLVWGWQSLVGGGPFPTP 463

Query: 279 HCNTEDANYKKIIVFMTDGENLSTKEDQQ----------------SLYYCNEAKKRGAIV 322
               E   Y+ IIV M+DG N   +                    +   C   K  G  V
Sbjct: 464 PVKDEQYTYQDIIVLMSDGLNTVDRWYGNGWDTNTSVDNRMYASATTGTCVNVKAAGIKV 523

Query: 323 YAIGIRVIRSHE--FLRACAS-----PNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           Y + +    S E   L+ CAS        F +V +   +  AF+ I   +   R+
Sbjct: 524 YTVHVNTNGSPESTLLKNCASPADDGGKEFQMVTSASGLNAAFNSIATKLTDLRV 578


>gi|256820507|ref|YP_003141786.1| von Willebrand factor type A [Capnocytophaga ochracea DSM 7271]
 gi|256582090|gb|ACU93225.1| von Willebrand factor type A [Capnocytophaga ochracea DSM 7271]
          Length = 333

 Score =  116 bits (291), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 40/242 (16%), Positives = 78/242 (32%), Gaps = 48/242 (19%)

Query: 154 IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
           +  P T S   +++    +D+++ +DVS SM S       + +   K  +  +++     
Sbjct: 74  LARPQTHSENAHTKITDGIDIVMAIDVSASMLSKDLK-PNRFEALKKVASQFVKD----- 127

Query: 214 DVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFG--VSTNSTPGLKYAYNQIF 271
                 + GLV ++ +      +      +   +  L+       T    GL  A N   
Sbjct: 128 --RPNDRIGLVIYAGESYTKTPVTTDKGIILNALSELTYGQIEDGTAIGMGLATAVN--- 182

Query: 272 DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI- 330
                      E     ++I+ +TDG N +   D Q+      A + G  VY IGI    
Sbjct: 183 --------RLKESKAKSRVIILLTDGVNNTGFIDPQT--AAELAAEYGIRVYTIGIGSNG 232

Query: 331 ----------------------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIV 366
                                      ++  A  +   ++   +   +   +  I K   
Sbjct: 233 TALSPYALNPDGSIMYRMLQVEIDEPLMKKIAEVTHGRYFRATDNQKLQQIYDEINKMET 292

Query: 367 TK 368
           TK
Sbjct: 293 TK 294


>gi|150005795|ref|YP_001300539.1| hypothetical protein BVU_3288 [Bacteroides vulgatus ATCC 8482]
 gi|149934219|gb|ABR40917.1| conserved hypothetical protein BatA [Bacteroides vulgatus ATCC
           8482]
          Length = 332

 Score =  116 bits (291), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 38/260 (14%), Positives = 74/260 (28%), Gaps = 51/260 (19%)

Query: 139 LKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMA 198
             F            I+    ++    +     +D+M+ +DVS SM +       +++ A
Sbjct: 55  TPFVLRTVAIIMVILILARPQTTDNWQNTEIEGIDIMLAVDVSTSMLAEDLK-PNRLEAA 113

Query: 199 IKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLS------- 251
            +  +  +       +       GL  F+ +      L      L      +        
Sbjct: 114 KQVASEFI-------NGRPNDNIGLTIFAGESFTQCPLTVDHGVLLNLFNSIKGDIAQRG 166

Query: 252 KFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYY 311
                T    G+  A                +     K+I+ +TDG N     D   L  
Sbjct: 167 LIEDGTAIGMGIANAVT-----------RLKDSKAKSKVIILLTDGSNNRG--DISPLTA 213

Query: 312 CNEAKKRGAIVYAIGIRVI---------------------RSHEFLRACA--SPNSFYLV 348
              AK+ G  +Y IG+                           + L   A  +  +++  
Sbjct: 214 AEIAKQFGIRIYTIGVGTNGTAPYPMQTYAGTQYVNVPVEIDEKTLTEIAGTTNGNYFRA 273

Query: 349 ENPHSMYDAFSHIGKDIVTK 368
            +   + + +  I K   TK
Sbjct: 274 TSNSKLKEVYQEIDKLEKTK 293


>gi|209809314|ref|YP_002264852.1| hypothetical protein VSAL_II0524 [Aliivibrio salmonicida LFI1238]
 gi|208010876|emb|CAQ81278.1| putative membrane protein [Aliivibrio salmonicida LFI1238]
          Length = 320

 Score =  116 bits (290), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 37/224 (16%), Positives = 71/224 (31%), Gaps = 46/224 (20%)

Query: 168 TDARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGL 223
                DMM+V+D+S SM           + ++    + ++  +E+           + GL
Sbjct: 79  QPEHRDMMLVVDLSGSMSEEDMKTDSGFVDRLTAVKRVVSDFIEK-------RKGDRLGL 131

Query: 224 VTFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCN 281
           V F +       L +  + +Q ++    L   G  T    GL  A               
Sbjct: 132 VLFGDHAYLQTPLTFDRNTVQEQLNRTVLGLVGQRTAIGEGLGLATKTFI---------- 181

Query: 282 TEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV------------ 329
            E    ++ I+ ++DG N +       +     AK   A +Y +GI              
Sbjct: 182 -ESNAPQRTIILLSDGANTAG--VLDPIEAAQLAKDNNAKIYTVGIGAGEMQVRGFFGNQ 238

Query: 330 ------IRSHEFLRACAS--PNSFYLVENPHSMYDAFSHIGKDI 365
                     + L   A+     ++   N   + + +  I K  
Sbjct: 239 TVNTARDLDEDTLTKIATMTGGQYFRARNADELAEIYQTIDKLE 282


>gi|305665951|ref|YP_003862238.1| BatA protein [Maribacter sp. HTCC2170]
 gi|88710726|gb|EAR02958.1| batA protein [Maribacter sp. HTCC2170]
          Length = 332

 Score =  116 bits (290), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 34/242 (14%), Positives = 74/242 (30%), Gaps = 48/242 (19%)

Query: 154 IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
           +  P T  +   ++T   +D+++ +DVS SM +       ++    +     + +     
Sbjct: 73  MARPQTEDISTRTKTTKGIDIVMAIDVSSSMLARDLK-PNRLSALKEVAADFIRQ----- 126

Query: 214 DVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFG--VSTNSTPGLKYAYNQIF 271
                 + GLV ++ +      +    S +   ++ ++       T    G         
Sbjct: 127 --RPNDRIGLVAYAGEAFTKTPITSDKSIVLNSLREITYGQLNDGTAIGMG--------- 175

Query: 272 DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI- 330
                  +   E     KII+ +TDG N S     +     + A + G   Y IG+    
Sbjct: 176 --LATSVNRLKESKAISKIIILLTDGVNNSGFI--EPQTAADLAVEYGIKSYTIGLGTNG 231

Query: 331 ----------------------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIV 366
                                    + L   A  +   ++   +   +   +  I K   
Sbjct: 232 NALSPIAYNADGSYRYGMRQVEIDEKLLEGIAETTGGKYFRATDNEKLEAIYDEINKLEK 291

Query: 367 TK 368
           T+
Sbjct: 292 TE 293


>gi|329963581|ref|ZP_08301060.1| von Willebrand factor type A domain protein [Bacteroides fluxus YIT
           12057]
 gi|328528570|gb|EGF55541.1| von Willebrand factor type A domain protein [Bacteroides fluxus YIT
           12057]
          Length = 327

 Score =  116 bits (290), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 36/234 (15%), Positives = 71/234 (30%), Gaps = 46/234 (19%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           ++    +     +D+M+ +DVS SM +       +++ A       +       +     
Sbjct: 76  TTDSWQNSEIEGIDIMLAMDVSTSMLAEDLK-PNRLEAAKDVAAEFI-------NGRPND 127

Query: 220 QSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSK--FGVSTNSTPGLKYAYNQIFDMQGMR 277
             G+  F+ +      L    + L   +K +        T    G+  A           
Sbjct: 128 NIGITLFAGESFTQCPLTVDHAVLLNLLKDMKCGLIEDGTAIGMGIANAVT--------- 178

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI------- 330
                +     K+I+ +TDG N     D   L     AK  G  +Y IG+          
Sbjct: 179 --RLKDSKAKSKVIILLTDGVNNKG--DISPLTAAEIAKSFGIRIYTIGVGTNGMAPYPY 234

Query: 331 --------------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                            + L   A  +  +++   +   + + +  I K   TK
Sbjct: 235 PVGGTVQYVNMPVEIDEKTLTQIAGTTDGNYFRATSNSKLKEVYEEIDKLEKTK 288


>gi|270296687|ref|ZP_06202886.1| conserved hypothetical protein [Bacteroides sp. D20]
 gi|270272674|gb|EFA18537.1| conserved hypothetical protein [Bacteroides sp. D20]
          Length = 327

 Score =  116 bits (290), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 37/234 (15%), Positives = 71/234 (30%), Gaps = 46/234 (19%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           ++    +     +D+M+ +DVS SM +       +++ A       +       +     
Sbjct: 76  TTDSWQNSEIEGIDIMLAMDVSTSMLAEDLK-PNRLEAAKDVAAEFI-------NGRPND 127

Query: 220 QSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSK--FGVSTNSTPGLKYAYNQIFDMQGMR 277
             G+  F+ +      L    + L   +K +        T    G+  A           
Sbjct: 128 NIGITLFAGESFTQCPLTVDHAVLLNLLKDMKCGLIEDGTAIGMGIANAVT--------- 178

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI------- 330
                +     K+I+ +TDG N     D   L     AK  G  VY IG+          
Sbjct: 179 --RLKDSKAKSKVIILLTDGVNNKG--DISPLTAAEIAKSFGIRVYTIGVGTNGMAPYPY 234

Query: 331 --------------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                            + L   A  +  +++   +   + + +  I K   TK
Sbjct: 235 PVGGTVQYVNMPVEIDEKTLTQIAGTTEGNYFRATSNSKLKEVYEEIDKLEKTK 288


>gi|86356688|ref|YP_468580.1| hypothetical protein RHE_CH01044 [Rhizobium etli CFN 42]
 gi|86280790|gb|ABC89853.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 445

 Score =  116 bits (289), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 45/438 (10%), Positives = 127/438 (28%), Gaps = 78/438 (17%)

Query: 8   IRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHS------------MID 55
           +  F ++  G   I+TA+ +  +    G  ++ +    ++T L++              +
Sbjct: 2   LLRFIFDRSGNFGIMTALLVVPLLGAAGTAVDFASALSLRTELYAAADAAAVGSITPTSE 61

Query: 56  RSLVH--AATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRS 113
            +      +         +  +K+    +  +  +       +  +    ++       +
Sbjct: 62  AAAQANTMSGDGSLTLGKSEAQKIFFSQMSKKQGDAPVTVDISVQKKGDTLSSTVSFNAT 121

Query: 114 TSLDIVVVPQNEGYSISAISRYKIPL-KFCTFIPWYTNSRHIVMPITSSVKVNSQ----- 167
                + V   +  +++  +  +     +  F     N+  + +  T+      +     
Sbjct: 122 MPTTFMQVMGFDEIAVTGAATAQYQTPSYMDFFMLLDNTPSMGVAATTDDITAMKKATAN 181

Query: 168 -----TDARLDMMIVL--------DVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPD 214
                 D        +          S    +  +    +ID+   ++ A++ + K    
Sbjct: 182 GHDGGKDKNCAFACHIVSEKGVEDKNSYYNVARNNGVTIRIDVVASAVKALMAKAKDTQS 241

Query: 215 VNNVVQSGLVTFSNKIEEFF----LLEWGVSHLQRKIK---------YLSKFGVSTNSTP 261
           + +  +    T     ++           +++    +           +      ++   
Sbjct: 242 MPSQFRVAAYTSGKTAQDAKAAKLFKVSDLNYDLGAVAAAANMIKLMSIPYQNYYSDQQT 301

Query: 262 GLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQS------------- 308
               A   I           T +A+ +KI+ F+ DG   S K    +             
Sbjct: 302 SFDEALKGIEGEIKGNIGTGTSNADRQKIVFFVADGVGDSYKPTGCTSPKGANGGRCIEP 361

Query: 309 --LYYCNEAKKRGAIV---YAIGIRVIRS--------------HEFLRACASPNSFYLVE 349
               YC + K RG  V   Y   + +  +                 +  CA+P  ++ V 
Sbjct: 362 IDTTYCKKLKDRGIKVAVLYTTYLPLPDNGFYKDWVKPFETRIAAKMEECATPGFYFAVS 421

Query: 350 NPHSMYDAFSHIGKDIVT 367
               + +A   + + IV+
Sbjct: 422 PTEGIEEAMEALFRKIVS 439


>gi|218506166|ref|ZP_03504044.1| hypothetical protein RetlB5_00485 [Rhizobium etli Brasil 5]
          Length = 205

 Score =  116 bits (289), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 25/197 (12%), Positives = 69/197 (35%), Gaps = 3/197 (1%)

Query: 5   NLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQ 64
              +R    +  G + I+ A+ L  + + +G   +    + ++  + S +D +L+ A  Q
Sbjct: 7   FAALRGLRRDRTGNVGIIVALSLVPMLVAVGASFDYIRSYNVRQKMQSDLDAALIAAVKQ 66

Query: 65  IMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQN 124
           I N G+ +  K         +++N++ +   +    N  +        +     + +   
Sbjct: 67  INNTGDTDALKLKVTDWFHAQVENSYTLGEIDIDTTNHNITATASG--TVPTTFMKIANI 124

Query: 125 EGYSISAISRYKIP-LKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRS 183
           +   +S  S  K P   +         S  +++  T++ +    +            S  
Sbjct: 125 DTVPVSVASAVKGPATSYLNVYIVIDTSPSMLLAATTAGQATMYSGIGCQFACHTGDSHK 184

Query: 184 MESFFDSSITKIDMAIK 200
           + +   ++  +   A  
Sbjct: 185 VGNKTYANNYEYSTAKS 201


>gi|329954838|ref|ZP_08295855.1| von Willebrand factor type A domain protein [Bacteroides clarus YIT
           12056]
 gi|328526942|gb|EGF53953.1| von Willebrand factor type A domain protein [Bacteroides clarus YIT
           12056]
          Length = 327

 Score =  116 bits (289), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 37/234 (15%), Positives = 71/234 (30%), Gaps = 46/234 (19%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           ++    +     +D+M+ +DVS SM +       +++ A       +       +     
Sbjct: 76  TTDSWQNSEIEGIDIMLAIDVSTSMLAEDLK-PNRLEAAKDVAAEFI-------NGRPND 127

Query: 220 QSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSK--FGVSTNSTPGLKYAYNQIFDMQGMR 277
             G+  F+ +      L    + L   IK +        T    G+  A           
Sbjct: 128 NVGITLFAGESFTQCPLTVDHAVLLNLIKDVKCGLIEDGTAVGMGIANAVT--------- 178

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI------- 330
                +     K+I+ +TDG N   +     L     AK  G  VY IG+          
Sbjct: 179 --RLKDSKAKSKVIILLTDGTNNRGEIS--PLTAAEIAKSFGIRVYTIGVGTNGMAPYPY 234

Query: 331 --------------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                            + L   A  +  +++   +   + + +  I K   TK
Sbjct: 235 PVGGTVQYVNMPVEIDEKTLTQIAGTTDGNYFRATSNSKLKEVYEEIDKLEKTK 288


>gi|291514853|emb|CBK64063.1| Mg-chelatase subunit ChlD [Alistipes shahii WAL 8301]
          Length = 328

 Score =  116 bits (289), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 40/227 (17%), Positives = 73/227 (32%), Gaps = 47/227 (20%)

Query: 168 TDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFS 227
               +D+M+ +DVS SM +       +I  A +   + + +           + GLV F+
Sbjct: 84  NTEGIDIMLAIDVSGSMLARDFK-PDRITAAKEVAGSFIAD-------RYGDRIGLVAFA 135

Query: 228 NKIEEFFLLEWGVSHLQRKIKYLSK--FGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDA 285
            +      L    S LQ  +  +        T    GL  A N              E  
Sbjct: 136 GEAFTQSPLTTDQSTLQTLLARIRSGLIEDGTAIGNGLATAIN-----------RLRESD 184

Query: 286 NYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV---------------- 329
              K+I+ +TDG N   +     +     AK +G  VY IG+                  
Sbjct: 185 AKSKVIILLTDGVNNQGQI--APMTAAEIAKAQGIRVYTIGVGTEGMAPYPAIDMFGNLT 242

Query: 330 ------IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                     + L+A +  +   ++   +   +   +  I +   +K
Sbjct: 243 FVNQKVEIDEKVLKAISDMTGGRYFRATDKEKLKAVYDEINQLEKSK 289


>gi|167763116|ref|ZP_02435243.1| hypothetical protein BACSTE_01485 [Bacteroides stercoris ATCC
           43183]
 gi|167699456|gb|EDS16035.1| hypothetical protein BACSTE_01485 [Bacteroides stercoris ATCC
           43183]
          Length = 327

 Score =  116 bits (289), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 38/234 (16%), Positives = 71/234 (30%), Gaps = 46/234 (19%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           ++    +     +D+M+ +DVS SM +       +++ A       +       +     
Sbjct: 76  TTDSWQNSEIEGIDIMLAIDVSTSMLAEDLK-PNRLEAAKDVAAEFI-------NGRPND 127

Query: 220 QSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSK--FGVSTNSTPGLKYAYNQIFDMQGMR 277
             G+  F+ +      L    + L   IK +        T    G+  A           
Sbjct: 128 NVGITLFAGESFTQCPLTVDHAVLLNLIKDVKCGLIEDGTAVGMGIANAVT--------- 178

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI------- 330
                +     K+I+ +TDG N     D   L     AK  G  VY IG+          
Sbjct: 179 --RLKDSKAKSKVIILLTDGTNNRG--DISPLTAAEIAKSFGIRVYTIGVGTNGMAPYPY 234

Query: 331 --------------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                            + L   A  +  +++   +   + + +  I K   TK
Sbjct: 235 PVGGTVQYVNMPVEIDEKTLTQIAGTTDGNYFRATSNSKLKEVYEEIDKLEKTK 288


>gi|163754426|ref|ZP_02161548.1| BatA (Bacteroides aerotolerance operon) [Kordia algicida OT-1]
 gi|161325367|gb|EDP96694.1| BatA (Bacteroides aerotolerance operon) [Kordia algicida OT-1]
          Length = 335

 Score =  115 bits (288), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 42/244 (17%), Positives = 77/244 (31%), Gaps = 50/244 (20%)

Query: 154 IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
           +  P T  V    +T+  +D+++ +DVS SM S       ++    K     +E      
Sbjct: 74  LARPQTKEVSTRIKTNKGIDIVMAIDVSASMLSKDL-RPNRLTALKKVAAEFIEG----- 127

Query: 214 DVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKF----GVSTNSTPGLKYAYNQ 269
                 + GLV ++ +      +    S +Q  +K +          T    GL  A N 
Sbjct: 128 --RPSDRIGLVVYAGESFTKTPITTDKSIIQNALKDIKYKHGELIGGTAIGMGLATAVN- 184

Query: 270 IFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV 329
                        +     K+I+ +TDG N +     +       A + G   Y IGI  
Sbjct: 185 ----------RLKDSKAKSKVIILLTDGVNNAGFI--EPQIASELAVEYGIKTYTIGIGT 232

Query: 330 I-----------------------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKD 364
                                      + L+  A  +   ++   N   + + +  I K 
Sbjct: 233 NGMASTPVALNPDGTILFRNMQVEIDEKLLQQIAKTTGGKYFRATNTKKLAEIYDEINKL 292

Query: 365 IVTK 368
             T+
Sbjct: 293 EKTE 296


>gi|254882023|ref|ZP_05254733.1| BatA aerotolerance operon protein [Bacteroides sp. 4_3_47FAA]
 gi|294776174|ref|ZP_06741663.1| von Willebrand factor type A domain protein [Bacteroides vulgatus
           PC510]
 gi|319640969|ref|ZP_07995677.1| hypothetical protein HMPREF9011_01274 [Bacteroides sp. 3_1_40A]
 gi|254834816|gb|EET15125.1| BatA aerotolerance operon protein [Bacteroides sp. 4_3_47FAA]
 gi|294449997|gb|EFG18508.1| von Willebrand factor type A domain protein [Bacteroides vulgatus
           PC510]
 gi|317387414|gb|EFV68285.1| hypothetical protein HMPREF9011_01274 [Bacteroides sp. 3_1_40A]
          Length = 332

 Score =  115 bits (288), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 36/239 (15%), Positives = 71/239 (29%), Gaps = 51/239 (21%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           ++    +     +D+M+ +DVS SM +       +++ A +  +  +       +     
Sbjct: 76  TTDNWQNTEIEGIDIMLAVDVSTSMLAEDLK-PNRLEAAKQVASEFI-------NGRPND 127

Query: 220 QSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLS-------KFGVSTNSTPGLKYAYNQIFD 272
             GL  F+ +      L      L      +             T    G+  A      
Sbjct: 128 NIGLTIFAGESFTQCPLTVDHGVLLNLFNSIKGDIAQRGLIEDGTAIGMGIANAVT---- 183

Query: 273 MQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI-- 330
                     +     K+I+ +TDG N     D   L     AK+ G  +Y IG+     
Sbjct: 184 -------RLKDSKAKSKVIILLTDGSNNRG--DISPLTAAEIAKQFGIRIYTIGVGTNGT 234

Query: 331 -------------------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                                 + L   A  +  +++   +   + + +  I K   TK
Sbjct: 235 APYPMQTYAGTQYVNVPVEIDEKTLTEIAGTTNGNYFRATSNSKLKEVYQEIDKLEKTK 293


>gi|241113143|ref|YP_002972978.1| hypothetical protein Rleg_4788 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240861351|gb|ACS59017.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 461

 Score =  115 bits (288), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 36/329 (10%), Positives = 109/329 (33%), Gaps = 15/329 (4%)

Query: 3   SLNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAA 62
            +   +R    +  G + I+ A+ L  + + +G   +    + ++  + S +D +L+ A 
Sbjct: 19  RVFKTLRGLGRDRGGNVAIVVALTLVPMIVAVGASFDYIRTYNVRQRMQSDLDTALIAAV 78

Query: 63  TQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVP 122
            +I +  +    K+        +++N++ +   N    N  +        +    ++ + 
Sbjct: 79  KEI-DTDDAVALKQKVSDWFHAQVENSYTLGDINIDTSNHKITATASG--TVPTTLMRIA 135

Query: 123 QNEGYSISAISRYKIP-LKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIV---- 177
             +   +S  S  K P   +         S  +++  T++ +    +             
Sbjct: 136 NIDTVDVSVASAVKGPATSYLNVYIVIDTSPSMLLAATTAGQATMYSGIGCQFACHTGDA 195

Query: 178 ---LDVSRSMESFF---DSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
               + + +    +    +   + D+A  ++  +L  +      +  ++ GL +  + + 
Sbjct: 196 HKIGNKTYNNNYEYSTAKNIKLRADVAGDAVKDVLALIDTSDSNHQRIKVGLYSLGDTLT 255

Query: 232 EFFLLEWGVSHLQRKIKYLSKF-GVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKI 290
           E           + ++   S     +T+               +       T   +  K+
Sbjct: 256 EVLAPTLSTDTARNRLTDASYGLTSATSKAATYFDVSLTTLKQKVGTGGDGTASNSPLKL 315

Query: 291 IVFMTDGENLSTKEDQQSLYYCNEAKKRG 319
           ++ +TDG     +     + + N     G
Sbjct: 316 VLLLTDGVQSQREWVTDKVTWSNNKAISG 344


>gi|315223608|ref|ZP_07865462.1| aerotolerance protein BatA [Capnocytophaga ochracea F0287]
 gi|314946389|gb|EFS98384.1| aerotolerance protein BatA [Capnocytophaga ochracea F0287]
          Length = 340

 Score =  115 bits (288), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 40/242 (16%), Positives = 79/242 (32%), Gaps = 48/242 (19%)

Query: 154 IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
           +  P T S   +++    +D+++ +DVS SM S       + +   K  +  +++     
Sbjct: 81  LARPQTHSENAHTKITDGIDIVMAIDVSASMLSKDLK-PNRFEALKKVASQFVKD----- 134

Query: 214 DVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFG--VSTNSTPGLKYAYNQIF 271
                 + GLV ++ +      +      +   +  L+       T    GL  A N   
Sbjct: 135 --RPNDRIGLVIYAGESYTKTPVTTDKGIILNALSELTYGQIEDGTAIGMGLATAVN--- 189

Query: 272 DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI- 330
                      E     ++I+ +TDG N +   D Q+      A + G  VY IGI    
Sbjct: 190 --------RLKESKAKSRVIILLTDGVNNTGFIDPQT--AAELAAEYGIRVYTIGIGSNG 239

Query: 331 ----------------------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIV 366
                                      ++  A  +   ++   +   +   ++ I K   
Sbjct: 240 TALSPYALNPDGSIMYRMLQVEIDEPLMKKIAEVTHGRYFRATDNQKLQQIYNEINKMET 299

Query: 367 TK 368
           TK
Sbjct: 300 TK 301


>gi|32474888|ref|NP_867882.1| hypothetical protein RB7557 [Rhodopirellula baltica SH 1]
 gi|32445428|emb|CAD75429.1| conserved hypothetical protein [Rhodopirellula baltica SH 1]
          Length = 327

 Score =  115 bits (288), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 47/351 (13%), Positives = 111/351 (31%), Gaps = 30/351 (8%)

Query: 19  MTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLK 78
           M +L AI + +  +V+   I+++ +   +T L S  D +   AAT + +  + N   +  
Sbjct: 1   MLVLIAIMMFLFLIVVAFSIDIAQMHLARTELRSSTDAAANAAATTLADTLDRNLAIQRG 60

Query: 79  GGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIP 138
                  + N   +   +     G         R  +           ++   ++  +  
Sbjct: 61  QQIAQANLVNGQPLLLADGDFQFGRS------DRQVNGKYAFNAGEAPFNGVRVNGQRTT 114

Query: 139 LKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMA 198
                 +P +  +              + T    D+ +V+D S SM        ++ +  
Sbjct: 115 GSLSGPVPLFFGNVTGTSIFEPEAF-ATATYVERDITLVVDRSGSMAG------SRFNDL 167

Query: 199 IKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTN 258
             +I    +   L+       Q GL +++++  E   L    + +   +  L   G  T+
Sbjct: 168 QAAIRIFTD---LLATTPVDEQIGLASYNDRASEDVQLTENFAEVNNAMDRLRT-GGFTS 223

Query: 259 STPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKR 318
            + G++                       ++ ++ MTDG +       +      +    
Sbjct: 224 ISRGMQAG--------QEIALRGRPPEFVERTMIVMTDGRHNRG---PEPRVVATDLAAD 272

Query: 319 GAIVYAIGIRVIRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVT 367
           G  ++ I          ++  A       +   N   + D +  I   + T
Sbjct: 273 GVTIHTITFGAGADFGRMQDVARIGGGRHFHATNGDQLRDIYREIALTLGT 323


>gi|59713864|ref|YP_206639.1| hypothetical protein VF_A0681 [Vibrio fischeri ES114]
 gi|59482112|gb|AAW87751.1| hypothetical membrane spanning protein [Vibrio fischeri ES114]
          Length = 321

 Score =  115 bits (287), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 35/225 (15%), Positives = 72/225 (32%), Gaps = 47/225 (20%)

Query: 168 TDARLDMMIVLDVSRSMESFFD-----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSG 222
                DMM+V+D+S SM            + ++    + ++  +++           + G
Sbjct: 79  QPEHRDMMLVVDLSGSMAEEDMKTSNGDFVDRLTAVKQVVSDFIDQ-------RKGDRLG 131

Query: 223 LVTFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHC 280
           LV F +       L +  + ++ ++    L+  G  T    GL  A              
Sbjct: 132 LVLFGDHAYLQTPLTFDRNTVREQLDRTVLNLVGQRTAIGEGLGLATKTFI--------- 182

Query: 281 NTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV----------- 329
             E    ++ I+ ++DG N +     + L     AK   A +Y +GI             
Sbjct: 183 --ESNAPQRTIILLSDGANTAG--VLEPLEAAQLAKDNHAKIYTVGIGAGEMQVRGFFGK 238

Query: 330 -------IRSHEFLRACAS--PNSFYLVENPHSMYDAFSHIGKDI 365
                      + L   A+     ++   N   + + +  I    
Sbjct: 239 QTVNTARDLDEDTLTKIATMTGGQYFRARNADELAEIYQTIDALE 283


>gi|313159758|gb|EFR59115.1| von Willebrand factor type A domain protein [Alistipes sp. HGB5]
          Length = 330

 Score =  115 bits (287), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 41/229 (17%), Positives = 73/229 (31%), Gaps = 49/229 (21%)

Query: 168 TDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFS 227
               +D+M+ +DVS SM +       +I  A +   + + +           + GLV F+
Sbjct: 84  NTEGIDIMLAIDVSGSMLARDF-RPDRITAAKEVAGSFIAD-------RYGDRIGLVAFA 135

Query: 228 NKIEEFFLLEWGVSHLQRKIKYLSK--FGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDA 285
            +      L      LQ  +  +        T    GL  A N              E  
Sbjct: 136 GEAFTQSPLTTDQGTLQTLLARIRSGLIEDGTAIGNGLATAIN-----------RLRESE 184

Query: 286 NYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV---------------- 329
              K+I+ +TDG N   +   Q+      AK +G  VY IG+                  
Sbjct: 185 AKSKVIILLTDGVNNRGEIAPQT--AAEIAKAQGIRVYTIGVGTEGMAPYPAVDIYGTPT 242

Query: 330 --------IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                       + LR+ A  +   ++   +   +   +  I +   +K
Sbjct: 243 GGTVMAKVEIDEKTLRSIAEQTGGQYFRATDKAKLKAIYDQINQLEKSK 291


>gi|213963729|ref|ZP_03391979.1| BatA protein [Capnocytophaga sputigena Capno]
 gi|213953609|gb|EEB64941.1| BatA protein [Capnocytophaga sputigena Capno]
          Length = 333

 Score =  115 bits (287), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 39/242 (16%), Positives = 76/242 (31%), Gaps = 48/242 (19%)

Query: 154 IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
           +  P T S    ++    +D+++ +DVS SM S       + +   K  +  +++     
Sbjct: 74  LARPQTHSENAQTKITDGIDIVMAIDVSSSMLSQDLK-PNRFEALKKVASQFVKD----- 127

Query: 214 DVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFG--VSTNSTPGLKYAYNQIF 271
                 + GLV ++ +      +      +   +  L+       T    GL  A N   
Sbjct: 128 --RPNDRIGLVVYAGESYTKTPVTTDKGIILSSLAELTYGQVEDGTAIGMGLATAVN--- 182

Query: 272 DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI- 330
                      E     ++I+ +TDG N +   D   L     A + G  VY +GI    
Sbjct: 183 --------RLKESKAKSRVIILLTDGVNNTGVID--PLIAAELAAEYGIKVYTVGIGTNG 232

Query: 331 ----------------------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIV 366
                                      ++  A  +   ++   N   +   +  I K   
Sbjct: 233 MALSPYALNPDGSIMYRMLQVEIDESLMKKIAQVTHGRYFRATNNQKLQQIYDEINKLET 292

Query: 367 TK 368
           +K
Sbjct: 293 SK 294


>gi|260592520|ref|ZP_05857978.1| BatA protein [Prevotella veroralis F0319]
 gi|260535566|gb|EEX18183.1| BatA protein [Prevotella veroralis F0319]
          Length = 318

 Score =  115 bits (287), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 35/218 (16%), Positives = 70/218 (32%), Gaps = 37/218 (16%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
           +    +D+M+ +D+S SM +       +I++A +  +  +               GL  F
Sbjct: 83  KDAEGIDIMLTMDISASMLTED-VFPNRIEVAKEVASDFI-------SGRPNDNIGLTIF 134

Query: 227 SNKIEEFFLLEWGVSHLQRKIKYLSKF-------GVSTNSTPGLKYAYNQIFDMQGMRQH 279
           + +      +    + L   +  +             T    G                 
Sbjct: 135 AGEAFTQCPMTVDHAALLNLLHNVRTDLVVKGLIQDGTAIGMG-----------LANSVS 183

Query: 280 CNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR-------S 332
              +     K+I+ +TDG N         +   + AKK G  +Y IG+            
Sbjct: 184 RLKDSKAKSKVIILLTDGSNNVGSIS--PMTAASIAKKYGIRIYTIGLGKESEGDLGAID 241

Query: 333 HEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
           ++ L+  A  +   FY  ++   +   +  I K   TK
Sbjct: 242 YKTLQNIAVSTNGEFYRAQSQAELSKIYQDIDKLEKTK 279


>gi|225010241|ref|ZP_03700713.1| von Willebrand factor type A [Flavobacteria bacterium MS024-3C]
 gi|225005720|gb|EEG43670.1| von Willebrand factor type A [Flavobacteria bacterium MS024-3C]
          Length = 330

 Score =  115 bits (287), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 35/261 (13%), Positives = 79/261 (30%), Gaps = 52/261 (19%)

Query: 139 LKFCTFIPWYTNSRHIVM----PITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITK 194
           LK   FI    +   +++    P  SS    ++T   +D+++ +DVS SM +   S   +
Sbjct: 52  LKPMLFILRLLSISALIIGLARPQNSSENTKTETTKGIDIVMAIDVSSSMLAKDLS-PNR 110

Query: 195 IDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKF- 253
           +    +  +  +++           + GLV ++ +      +      +   +K +    
Sbjct: 111 LVALKEVASNFIKD-------RPNDRIGLVVYAGESYTKTPITSDKRLVLEALKEIKYGA 163

Query: 254 -GVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYC 312
               T    G                +   +     K+I+ +TDG N +     +     
Sbjct: 164 LTDGTAIGMG-----------LATSVNRLKDSKALSKVIILLTDGVNNAGFI--EPATAA 210

Query: 313 NEAKKRGAIVYAIGIRVI-----------------------RSHEFLRACAS--PNSFYL 347
             A +     Y IG+                               L   A+     ++ 
Sbjct: 211 ELAVEYDIKTYTIGLGTNGNALSPIAYNPDGSFRYGMAEVQIDEALLEQIATLTGGKYFR 270

Query: 348 VENPHSMYDAFSHIGKDIVTK 368
             +   +   ++ I     T+
Sbjct: 271 ATDNKKLEAIYNEINSLEKTE 291


>gi|212693197|ref|ZP_03301325.1| hypothetical protein BACDOR_02707 [Bacteroides dorei DSM 17855]
 gi|237709939|ref|ZP_04540420.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
 gi|237725394|ref|ZP_04555875.1| conserved hypothetical protein [Bacteroides sp. D4]
 gi|265753591|ref|ZP_06088946.1| conserved hypothetical protein [Bacteroides sp. 3_1_33FAA]
 gi|212664302|gb|EEB24874.1| hypothetical protein BACDOR_02707 [Bacteroides dorei DSM 17855]
 gi|229436081|gb|EEO46158.1| conserved hypothetical protein [Bacteroides dorei 5_1_36/D4]
 gi|229456032|gb|EEO61753.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
 gi|263235305|gb|EEZ20829.1| conserved hypothetical protein [Bacteroides sp. 3_1_33FAA]
          Length = 332

 Score =  114 bits (286), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 44/314 (14%), Positives = 89/314 (28%), Gaps = 54/314 (17%)

Query: 88  NTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPW 147
             +       L        I  +++    +  +        + A   +KI L    F+  
Sbjct: 1   MIFANIEYLFLLILLIPYIIWYVMKRKKTEPTLQVSTTRMYMKAPKSWKIYLLHAPFVLR 60

Query: 148 ---YTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINA 204
                    I+    ++    +     +D+M+ +DVS SM +       +++ A +  + 
Sbjct: 61  TVAIIMVILILARPQTTDNWQNTEIEGIDIMLAVDVSTSMLAEDLK-PNRLEAAKQVASE 119

Query: 205 MLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLS-------KFGVST 257
            +       +       GL  F+ +      L      L      +             T
Sbjct: 120 FI-------NGRPNDNIGLTIFAGESFTQCPLTVDHGVLLNLFNSIKGDIAQRGLIEDGT 172

Query: 258 NSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKK 317
               G+  A                +     K+I+ +TDG N     D   L     AK+
Sbjct: 173 AIGMGIANAVT-----------RLKDSKAKSKVIILLTDGSNNRG--DISPLTAAEIAKQ 219

Query: 318 RGAIVYAIGIRVI---------------------RSHEFLRACA--SPNSFYLVENPHSM 354
            G  +Y IG+                           + L   A  +  +++   +   +
Sbjct: 220 FGIRIYTIGVGTNGTAPYPMQTYAGTQYVNVPVEIDEKTLTEIAGTTNGNYFRATSNSKL 279

Query: 355 YDAFSHIGKDIVTK 368
            + +  I K   TK
Sbjct: 280 KEVYQEIDKLEKTK 293


>gi|42524204|ref|NP_969584.1| hypothetical protein Bd2794 [Bdellovibrio bacteriovorus HD100]
 gi|39576412|emb|CAE80577.1| conserved hypothetical protein [Bdellovibrio bacteriovorus HD100]
          Length = 336

 Score =  114 bits (286), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 48/294 (16%), Positives = 92/294 (31%), Gaps = 57/294 (19%)

Query: 117 DIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTD---ARLD 173
              +   +     S     +  L     I         ++ +    ++N++       +D
Sbjct: 30  TPTLQFGSVELLKSVTPTVRTRLMHLPVILKSLALVFAIVALARPQEMNTKIRKNVEGID 89

Query: 174 MMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEF 233
           ++I LDVS SM       + +++ A ++I   +             + GLV F+ +    
Sbjct: 90  IVICLDVSDSMLIEDMKPLNRLEAAKETIAKFISA-------RTSDRIGLVVFAGESFTM 142

Query: 234 FLLEWGVSHLQRKIKYLSKFG-----VSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
                    + +++  +S          T     +  A                +     
Sbjct: 143 VPPTLDYQMILQRVNEISSASSAKIKDGTALGVAMANA-----------AGRLKDSQARS 191

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI------------------ 330
           ++++FMTDGEN S   D ++      AK  G  VY+IGI                     
Sbjct: 192 RVMIFMTDGENNSGTIDPETG--LEIAKGYGIKVYSIGIGKDGPTRIPVYSRDIFGQKVK 249

Query: 331 --------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYDK 374
                    + + L   A  +   +Y      ++   FS I     TK I  +K
Sbjct: 250 TYQPFESTVNEDLLGRMASDTGGKYYRATTEGALQKVFSDIDTLEKTK-IDVNK 302


>gi|193214188|ref|YP_001995387.1| von Willebrand factor type A [Chloroherpeton thalassium ATCC 35110]
 gi|193087665|gb|ACF12940.1| von Willebrand factor type A [Chloroherpeton thalassium ATCC 35110]
          Length = 340

 Score =  114 bits (286), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 37/226 (16%), Positives = 67/226 (29%), Gaps = 47/226 (20%)

Query: 170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229
             +D+++ +D+S SM +       +I+ A       + +           + GLV FS K
Sbjct: 96  EGIDIVLAIDLSGSMLAEDFEPKNRIEAAKSVATDFIHQ-------RLSDRIGLVVFSGK 148

Query: 230 IEEFFLLEWGVSHLQRKIKYLSKFG---VSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
                 L      L   I  L         T     +  A            +   E   
Sbjct: 149 SFTQCPLTLDYRLLTNFISELKAGTIEEDGTAIGTAIATAT-----------NRLRESTA 197

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV----------------- 329
             K+I+ +TDG+N + +   + +     A   G  +Y +G                    
Sbjct: 198 KSKVIILLTDGQNNAGEI--EPVTAAELAAALGIKIYTVGAGTRGYARYPIPDPLFGKRY 255

Query: 330 -----IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                      L   A  S   ++   +  S+   +  I +   TK
Sbjct: 256 VQMKVDVDDSTLTRIARISGGRYFRATDLESLKKTYHEIDELEKTK 301


>gi|320158179|ref|YP_004190557.1| BatA [Vibrio vulnificus MO6-24/O]
 gi|319933491|gb|ADV88354.1| BatA [Vibrio vulnificus MO6-24/O]
          Length = 323

 Score =  114 bits (286), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 35/219 (15%), Positives = 71/219 (32%), Gaps = 46/219 (21%)

Query: 173 DMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
           D+M+V+D+S SM+          I ++      +   +E+           + GLV F++
Sbjct: 87  DLMLVVDLSGSMQQEDILQDGDYIDRLSAVKNVVTQFIEQ-------RQGDRLGLVLFAD 139

Query: 229 KIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
                  L      +  ++    +   G  T    GL  A                +   
Sbjct: 140 HAYLQTPLTADRQTVANQLNQTIIGLIGQKTAIGDGLALATKTFV-----------DSEA 188

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR------------------ 328
            +++++ ++DG N +   D   +   N AKK G  +Y IGI                   
Sbjct: 189 PQRVVILLSDGSNTAGTLD--PIEAANIAKKYGVKIYTIGIGAGEMEVKQFFMTRKVNTS 246

Query: 329 VIRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                + L   A  +   ++   +   +   +  I +  
Sbjct: 247 ADLDEKTLTKIATMTGGQYFRARDAQELQAIYQAINQLE 285


>gi|120437734|ref|YP_863420.1| von Willebrand factor(vWA) type A domain-containing protein
           [Gramella forsetii KT0803]
 gi|117579884|emb|CAL68353.1| membrane protein containing von Willebrand factor(vWA) type A
           domain [Gramella forsetii KT0803]
          Length = 335

 Score =  114 bits (286), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 36/244 (14%), Positives = 80/244 (32%), Gaps = 50/244 (20%)

Query: 154 IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
           +  P +  V   + +   +D+++ +DVS SM +       ++D         +++     
Sbjct: 74  MARPRSVDVSTQTSSTQGIDIVMAIDVSASMLARDL-QPNRLDATKNVAEEFIQD----- 127

Query: 214 DVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFG---VSTNSTPGLKYAYNQI 270
                 + GLV ++ +      +    + +   ++ +         T    GL  A N+I
Sbjct: 128 --RPGDRIGLVVYAGESFTKTPITSDKAIVLDALEDIEYNNVLENGTAIGSGLATAVNRI 185

Query: 271 FDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI 330
                       +     K+I+ +TDG N +   D  +      A + G  VY IG+   
Sbjct: 186 -----------KDSDAESKVIILLTDGVNNAGFIDPST--ASELAVEFGIKVYTIGVGSN 232

Query: 331 ------------------------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKD 364
                                      + L+  A  +   ++   N   + + ++ I   
Sbjct: 233 GMALSPVGVNPANGRLRFGNVQVEIDEDLLKEIAAATGGKYFRATNNEKLEEIYAEIDSL 292

Query: 365 IVTK 368
             T+
Sbjct: 293 EKTE 296


>gi|37676036|ref|NP_936432.1| hypothetical protein VVA0376 [Vibrio vulnificus YJ016]
 gi|37200576|dbj|BAC96402.1| conserved hypothetical protein [Vibrio vulnificus YJ016]
          Length = 323

 Score =  114 bits (285), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 35/219 (15%), Positives = 71/219 (32%), Gaps = 46/219 (21%)

Query: 173 DMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
           D+M+V+D+S SM+          I ++      +   +E+           + GLV F++
Sbjct: 87  DLMLVVDLSGSMQQEDILQDGDYIDRLSSVKNVVTQFIEQ-------RQGDRLGLVLFAD 139

Query: 229 KIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
                  L      +  ++    +   G  T    GL  A                +   
Sbjct: 140 HAYLQTPLTADRQTVANQLNQTIIGLIGQKTAIGDGLALATKTFV-----------DSEA 188

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR------------------ 328
            +++++ ++DG N +   D   +   N AKK G  +Y IGI                   
Sbjct: 189 PQRVVILLSDGSNTAGTLD--PIEAANIAKKYGVKIYTIGIGAGEMEVKQFFMTRKVNTS 246

Query: 329 VIRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                + L   A  +   ++   +   +   +  I +  
Sbjct: 247 ADLDEKTLTKIATMTGGQYFRARDAQELQTIYQAINQLE 285


>gi|225012026|ref|ZP_03702463.1| von Willebrand factor type A [Flavobacteria bacterium MS024-2A]
 gi|225003581|gb|EEG41554.1| von Willebrand factor type A [Flavobacteria bacterium MS024-2A]
          Length = 334

 Score =  114 bits (285), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 37/243 (15%), Positives = 78/243 (32%), Gaps = 49/243 (20%)

Query: 154 IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
           I  P T  +   ++T+  +D+++ +DVS SM +       ++    +  +A +       
Sbjct: 74  IARPQTVDISTRTKTNKGIDIVMAIDVSSSMLAQDLK-PDRLSALKRVASAFV------- 125

Query: 214 DVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFG---VSTNSTPGLKYAYNQI 270
           D     + GLV ++ +      +      ++  ++ +S  G     T    G        
Sbjct: 126 DDRLSDRIGLVVYAGESYTLTPITSDKGIVKGSLREISYQGLIEDGTAIGMG-------- 177

Query: 271 FDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI 330
                   +   +     K+I+ +TDG N S   D         A + G   Y IG+   
Sbjct: 178 ---LATSVNRLKDSRAKSKVIILLTDGVNNSGFID--PKIATELAVEFGIKTYTIGLGSN 232

Query: 331 -----------------------RSHEFLRACAS--PNSFYLVENPHSMYDAFSHIGKDI 365
                                       L+  A+     ++   +   + + +  I K  
Sbjct: 233 GTARAPVGILPNGSFQYAMTKVEIDEALLQEIATATGGIYFRATDNKKLEEIYEEINKLE 292

Query: 366 VTK 368
            T+
Sbjct: 293 KTE 295


>gi|53713710|ref|YP_099702.1| hypothetical protein BF2419 [Bacteroides fragilis YCH46]
 gi|60681981|ref|YP_212125.1| aerotolerance-related membrane protein [Bacteroides fragilis NCTC
           9343]
 gi|253565658|ref|ZP_04843113.1| BatA [Bacteroides sp. 3_2_5]
 gi|265764034|ref|ZP_06092602.1| BatA [Bacteroides sp. 2_1_16]
 gi|4838138|gb|AAD30858.1|AF116251_1 BatA [Bacteroides fragilis]
 gi|52216575|dbj|BAD49168.1| conserved hypothetical protein BatA [Bacteroides fragilis YCH46]
 gi|60493415|emb|CAH08201.1| aerotolerance-related membrane protein [Bacteroides fragilis NCTC
           9343]
 gi|251945937|gb|EES86344.1| BatA [Bacteroides sp. 3_2_5]
 gi|263256642|gb|EEZ27988.1| BatA [Bacteroides sp. 2_1_16]
 gi|301163419|emb|CBW22970.1| aerotolerance-related membrane protein [Bacteroides fragilis 638R]
          Length = 327

 Score =  114 bits (285), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 36/234 (15%), Positives = 70/234 (29%), Gaps = 46/234 (19%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           ++    +     +D+M+ +DVS SM +       +++ A       +       +     
Sbjct: 76  TTNSWQNSEIEGIDIMLAIDVSTSMLAEDLK-PNRLEAAKDVAAEFI-------NGRPND 127

Query: 220 QSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFG--VSTNSTPGLKYAYNQIFDMQGMR 277
             G+  F+ +      L    + L    + +        T    G+  A           
Sbjct: 128 NIGITLFAGESFTQCPLTVDHAVLLNLFQGIQCDIIEDGTAVGMGIANAVT--------- 178

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI------- 330
                +     K+I+ +TDG N     D   L     AK  G  VY IG+          
Sbjct: 179 --RLKDSKAKSKVIILLTDGTNNKG--DISPLTAAEIAKSFGIRVYTIGVGTNGMAPYPV 234

Query: 331 --------------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                            + L   A  +  +++   +   + + +  I K   TK
Sbjct: 235 RVGGTTQYINTPVEIDEKTLTQIAGTTDGNYFRATSNSKLKEVYEEIDKLEKTK 288


>gi|333030669|ref|ZP_08458730.1| von Willebrand factor type A [Bacteroides coprosuis DSM 18011]
 gi|332741266|gb|EGJ71748.1| von Willebrand factor type A [Bacteroides coprosuis DSM 18011]
          Length = 328

 Score =  114 bits (285), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 39/235 (16%), Positives = 70/235 (29%), Gaps = 47/235 (20%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           S+    S     +D+M+ +DVS SM +       +++ A       +       +     
Sbjct: 76  STDNWKSSEVEGIDIMLAIDVSGSMLAEDL-QPNRLEAAKDVAAKFI-------NDRPND 127

Query: 220 QSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSK--FGVSTNSTPGLKYAYNQIFDMQGMR 277
             G+  F+ +      L    + L      +        T    G+  A           
Sbjct: 128 NIGITLFAGESFTQCPLTIDHTALLNLFGNIQTGVIEDGTAIGMGVSNAVA--------- 178

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV-------- 329
                +     K+I+ +TDG N +   D   L     AK  G  VY +GI          
Sbjct: 179 --RLKDSQAKSKVIILLTDGSNNAG--DISPLTSAEIAKTYGIRVYTVGIGTRGTAPYPI 234

Query: 330 --------------IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                               L+  A  +   ++   +  S+ D +  I +   TK
Sbjct: 235 QTMTGAIQRIQVEVDIDEPTLKDIARTTGGVYFRATDNTSLQDIYQEIDQLEKTK 289


>gi|78776847|ref|YP_393162.1| von Willebrand factor, type A [Sulfurimonas denitrificans DSM 1251]
 gi|78497387|gb|ABB43927.1| von Willebrand factor, type A [Sulfurimonas denitrificans DSM 1251]
          Length = 307

 Score =  114 bits (285), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 36/214 (16%), Positives = 73/214 (34%), Gaps = 31/214 (14%)

Query: 168 TDARLDMMIVLDVSRSMESFFDSS---------ITKIDMAIKSINAMLEEVKLIPDVNNV 218
                D+++ +D S SM S              +++ ++A    +  +++          
Sbjct: 78  NRNGKDIVLAIDASGSMNSTGFDFEGEAALPQKLSRFEIAKIVASEFIQK-------RLS 130

Query: 219 VQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQ 278
              G+V + +       + +  + +   + YL++     N+  G   A            
Sbjct: 131 DNVGIVLYGDFAFIASPITYEKNIIIEMLSYLNQGMAGQNTAIGEAIAM---------SL 181

Query: 279 HCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV--IRSHEFL 336
                     KI+V +TDGE+ S   D         AK+    +Y IG+          L
Sbjct: 182 RAFKHSKAKSKIVVLLTDGEHNSG--DISPKDALVLAKEENIKIYTIGMGNRGEADEALL 239

Query: 337 RACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
           +  A  S   F+   N   + + + HI +   +K
Sbjct: 240 KKIADESGGEFFYATNAKELKEIYEHIDELESSK 273


>gi|218131126|ref|ZP_03459930.1| hypothetical protein BACEGG_02731 [Bacteroides eggerthii DSM 20697]
 gi|317476996|ref|ZP_07936238.1| von Willebrand factor type A domain-containing protein [Bacteroides
           eggerthii 1_2_48FAA]
 gi|217986646|gb|EEC52980.1| hypothetical protein BACEGG_02731 [Bacteroides eggerthii DSM 20697]
 gi|316906789|gb|EFV28501.1| von Willebrand factor type A domain-containing protein [Bacteroides
           eggerthii 1_2_48FAA]
          Length = 327

 Score =  114 bits (285), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 38/234 (16%), Positives = 71/234 (30%), Gaps = 46/234 (19%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           ++    +     +D+M+ +DVS SM +       +++ A       +       +     
Sbjct: 76  TTNSWQNSEIEGIDIMLAIDVSTSMLAEDLK-PNRLEAAKDVAAEFI-------NGRPND 127

Query: 220 QSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSK--FGVSTNSTPGLKYAYNQIFDMQGMR 277
             G+  F+ +      L    + L   IK +        T    G+  A           
Sbjct: 128 NIGITLFAGESFTQCPLTVDHAVLLNLIKDVKCGLIEDGTAVGMGIANAVT--------- 178

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI------- 330
                +     K+I+ +TDG N     D   L     AK  G  VY IG+          
Sbjct: 179 --RLKDSKAKSKVIILLTDGTNNKG--DISPLTAAEIAKSFGIRVYTIGVGTNGMAPYPY 234

Query: 331 --------------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                            + L   A  +  +++   +   + + +  I K   TK
Sbjct: 235 PVGGTVQYVNMPVEIDEKTLTQIAGTTDGNYFRATSNSKLKEVYEEIDKLEKTK 288


>gi|197336671|ref|YP_002158318.1| von Willebrand factor, type A [Vibrio fischeri MJ11]
 gi|197313923|gb|ACH63372.1| von Willebrand factor, type A [Vibrio fischeri MJ11]
          Length = 321

 Score =  114 bits (284), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 35/225 (15%), Positives = 71/225 (31%), Gaps = 47/225 (20%)

Query: 168 TDARLDMMIVLDVSRSMESFFD-----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSG 222
                DMM+V+D+S SM            + ++    + ++  +++           + G
Sbjct: 79  QPEHRDMMLVVDLSGSMAEEDMKTSNGDFVDRLTAVKQVVSDFIDQ-------RKGDRLG 131

Query: 223 LVTFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHC 280
           LV F +       L +  + ++ ++    L   G  T    GL  A              
Sbjct: 132 LVLFGDHAYLQTPLTFDRNTVREQLDRTVLRLVGQMTAMGEGLGLATKTFI--------- 182

Query: 281 NTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV----------- 329
             E    ++ I+ ++DG N +     + L     AK   A +Y +GI             
Sbjct: 183 --ESNAPQRTIILLSDGANTAG--VLEPLEAAQLAKDNHAKIYTVGIGAGEMQVRGFFGK 238

Query: 330 -------IRSHEFLRACAS--PNSFYLVENPHSMYDAFSHIGKDI 365
                      + L   A+     ++   N   + + +  I    
Sbjct: 239 QTVNTARDLDEDTLTKIATMTGGQYFRARNADELAEIYQTIDALE 283


>gi|307565272|ref|ZP_07627765.1| von Willebrand factor type A domain protein [Prevotella amnii CRIS
           21A-A]
 gi|307345941|gb|EFN91285.1| von Willebrand factor type A domain protein [Prevotella amnii CRIS
           21A-A]
          Length = 318

 Score =  114 bits (284), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 38/224 (16%), Positives = 69/224 (30%), Gaps = 37/224 (16%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
           +    +D+M+ +D+S SM +       ++++A +  +  +               GL  F
Sbjct: 83  KDSEGIDIMLAMDISASMLTND-VIPNRLEVAKEVASDFISG-------RPNDNIGLTIF 134

Query: 227 SNKIEEFFLLEWGVSHLQRKIKYLSKF-------GVSTNSTPGLKYAYNQIFDMQGMRQH 279
           + +      L    + L   +  +             T    GL  A             
Sbjct: 135 AGEAFTQCPLTTDHASLINLLNSVRTDLVVKGLIQDGTAIGMGLINAVG----------- 183

Query: 280 CNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV-------IRS 332
                    K+++ +TDG N         +     AKK    VY IG+            
Sbjct: 184 RLKSSKAKSKVVILLTDGSNNVGSIS--PMTAAEIAKKFNIRVYTIGLGTEQNNGYSDID 241

Query: 333 HEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYDK 374
           +  LR  A  +   FY  ++   +   +  I K   TK     K
Sbjct: 242 YTTLRQIANVTNGKFYSAQSQTELSQIYKDINKLEKTKLKIKGK 285


>gi|325297739|ref|YP_004257656.1| von Willebrand factor type A [Bacteroides salanitronis DSM 18170]
 gi|324317292|gb|ADY35183.1| von Willebrand factor type A [Bacteroides salanitronis DSM 18170]
          Length = 332

 Score =  114 bits (284), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 39/251 (15%), Positives = 75/251 (29%), Gaps = 37/251 (14%)

Query: 141 FCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIK 200
           F   I  +     ++    ++    +     +D+M+ +DVS SM +       +++ A +
Sbjct: 57  FLLRIVTFIMIVLVLARPQTTDNWQNTEIEGIDIMLAVDVSTSMLAEDLK-PNRLEAAKQ 115

Query: 201 SINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNST 260
                +       +       GL  F+ +      L      L      +        + 
Sbjct: 116 VAAQFI-------NGRPNDNIGLTIFAGEAFTQCPLTIDHGVLLNLFGSIK----GDIAQ 164

Query: 261 PGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGA 320
            GL      I            +     K+I+ +TDG N     D   L     AK+ G 
Sbjct: 165 RGLIEDGTAIGMGLANSISRLKDSKAKSKVIILLTDGSNNRG--DISPLTAAEIAKQFGI 222

Query: 321 IVYAIGIRVI---------------------RSHEFLRACA--SPNSFYLVENPHSMYDA 357
            VY IG+                           + L   A  +  +++   +   + + 
Sbjct: 223 RVYTIGVGTNGTAPYPMPTYAGVQYVNVPVEIDEQTLIQIASTTNGNYFRATSNSKLKEV 282

Query: 358 FSHIGKDIVTK 368
           +  I K   TK
Sbjct: 283 YEEIDKLEKTK 293


>gi|319952789|ref|YP_004164056.1| von willebrand factor type a [Cellulophaga algicola DSM 14237]
 gi|319421449|gb|ADV48558.1| von Willebrand factor type A [Cellulophaga algicola DSM 14237]
          Length = 332

 Score =  114 bits (284), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 35/239 (14%), Positives = 72/239 (30%), Gaps = 48/239 (20%)

Query: 157 PITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVN 216
           P T  +   ++T   +D+++ +DVS SM +       ++    K     +++        
Sbjct: 76  PQTEDISTKTKTTKGIDIVMAIDVSSSMLARDLK-PNRLASLKKVAADFIKK-------R 127

Query: 217 NVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFG--VSTNSTPGLKYAYNQIFDMQ 274
              + GLV ++ +      +      +   +K ++       T    G            
Sbjct: 128 PNDRIGLVVYAGESYTKTPITSDKGIVLNALKEITYGSLEDGTAIGMG-----------L 176

Query: 275 GMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI---- 330
               +   E     K+I+ +TDG N S     +       A +     Y IG+       
Sbjct: 177 ATSVNRLKESKALSKVIILLTDGINNSGFI--EPQTAAELAVEYDIKTYTIGLGTNGNAL 234

Query: 331 -------------------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                                   L   A  +  +++   N  S+   +  I K   T+
Sbjct: 235 SPIAINSDGSFRYGMKPVEIDEGLLEQIAKTTGGAYFRATNNESLASIYDEINKLEKTE 293


>gi|327403932|ref|YP_004344770.1| von Willebrand factor type A [Fluviicola taffensis DSM 16823]
 gi|327319440|gb|AEA43932.1| von Willebrand factor type A [Fluviicola taffensis DSM 16823]
          Length = 341

 Score =  114 bits (284), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 35/225 (15%), Positives = 72/225 (32%), Gaps = 47/225 (20%)

Query: 169 DARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
              +D+++ +D S SM +       ++++A +     +       D     + GLV +  
Sbjct: 99  KNGIDIILSIDASGSMLAQDFD-PNRLEVAKRVAKKFV-------DSRKGDRVGLVVYEG 150

Query: 229 KIEEFFLLEWGVSHLQRKIKYLSKFGV--STNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
           +             L+ +I  +    +   T    GL  A                 D+ 
Sbjct: 151 EAYTACPATLDYKLLKEQISAIEPGHLEPGTAIGSGLGVAVT-----------RLRSDSL 199

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI---------------- 330
             K+I+ +TDG + +     + L     AK +   VY IG+                   
Sbjct: 200 ISKVIILLTDGSSNTG---PEPLEVAELAKAKKCRVYTIGVGADGMAPTPVNTPFGVVYQ 256

Query: 331 -----RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                     L+  A  +   ++  ++  S+   ++ I K    K
Sbjct: 257 NLPVEIDEGVLKEIASATNGKYFRAQDEKSLEKIYAEIDKLEKRK 301


>gi|218887819|ref|YP_002437140.1| von Willebrand factor A [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|218758773|gb|ACL09672.1| von Willebrand factor type A [Desulfovibrio vulgaris str. 'Miyazaki
           F']
          Length = 406

 Score =  114 bits (284), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 43/433 (9%), Positives = 119/433 (27%), Gaps = 119/433 (27%)

Query: 19  MTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLK 78
           M +L A+ LP++  + G+ I+   ++     L   +D + +  + ++  +   +      
Sbjct: 1   MAMLMAVLLPVVLGLAGLGIDSGMLYLAHNRLQGAVDAAALAGSLELPYDPQLDKGL--- 57

Query: 79  GGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIP 138
              +   +      ++   +                     V P  E  S++  +   + 
Sbjct: 58  ---VKGAVNQYMAANYPAAVLKG------------------VTPGTEERSVTVKAEATVD 96

Query: 139 LKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESF----------- 187
             F            + +  ++     +     L+++ V+D + SM+             
Sbjct: 97  TIFMGA---------LGIGSSTVRAQATAGYNNLEVVFVIDNTGSMKGTAIQQANAAATQ 147

Query: 188 --------FDSSITKIDMA-------------------IKSINAMLEEVKLIPDVNNVVQ 220
                      +  K+ +                      +   +     L        +
Sbjct: 148 LAELIMPDGMETSVKVGLVPFRGKVHIPAGVDGLADGCRNADGTLAPSWILEEYKQTKYR 207

Query: 221 SGL-------VTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM 273
                         + I     L    + +   I      G ++ +       + +    
Sbjct: 208 YPTGSSLNVPKGTCDSIPRVQALTSNRTTIVSAIAKQDALGDASGTVISEGIKWGRHVLT 267

Query: 274 QGMRQHCNTEDANYKKIIVFMTDGE----------------------------------N 299
                   + + + +K+++ +TDG+                                   
Sbjct: 268 PEAPFTQGSSNKDMRKVMIVLTDGDTEDGKCGGNYALNYTPNAYWTNAYYGMFDMNTHCE 327

Query: 300 LSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHE--FLRACA-----SPNSFYLVENPH 352
              K +   L     AK +G  ++AI      S +   ++A A     + + +Y   + +
Sbjct: 328 NGGKLNAAMLSEAQIAKDKGIEIFAIRYGDSDSTDISLMKAIASSKAGTDDHYYNAPSAY 387

Query: 353 SMYDAFSHIGKDI 365
            + + F  IG+ +
Sbjct: 388 DLEEIFKKIGRQL 400


>gi|92117939|ref|YP_577668.1| hypothetical protein Nham_2418 [Nitrobacter hamburgensis X14]
 gi|91800833|gb|ABE63208.1| conserved hypothetical protein [Nitrobacter hamburgensis X14]
          Length = 483

 Score =  114 bits (284), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 59/479 (12%), Positives = 124/479 (25%), Gaps = 113/479 (23%)

Query: 3   SLNLNIR----NFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSL 58
           S+   IR     F  + +G +  + AI L  +   +G  ++ +     ++ + + +D + 
Sbjct: 5   SIRERIRSSAVRFGQDLRGNIAPIFAIALLPMLGFVGAAVDYTRANAARSSMQAAMDSAA 64

Query: 59  VHAATQIMNEGNGNNRKKLKGG------------DILCRIKNTWNMSFRNELRDNGFVND 106
           +  A             ++               D      +     + N       ++ 
Sbjct: 65  LMVAKDANAASPQMTADQVTAAAQKYFNALYHNTDAQGASVSAVYTPYNNGTPATVVLSG 124

Query: 107 IDDIVRS-------------TSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRH 153
             ++                T+            +++      +              + 
Sbjct: 125 SGNVQTDFMKVVGFPQISFKTNSTATWGNTKLRVAMALDVTGSMSSAGKLVQMKIAAKKL 184

Query: 154 I-VMPITSSVKVNSQ-TDARLDMMIVL-----------------DVSRSMESFFDSSITK 194
           I  +  +++ + +   +    ++M+ +                 D S S       S   
Sbjct: 185 IDTLKASATAEGDVYISIIPFNVMVNVGANNNTASWLEWEDGSYDNSSSNYGSCSGSGKS 244

Query: 195 IDMAIKSINAMLEEV-----------------------------------------KLIP 213
                 S  A  +                                            L  
Sbjct: 245 KPNTKSSCIAAGKTWTPKNISSWKGCVTDRGPVSKPGSGDYDTTKDEPVASTPYTLYLAR 304

Query: 214 DVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM 273
           + +    S L   S    +        S L+ KI  L   G  TN    ++ A+  +   
Sbjct: 305 NYSTCPSSILPMTSAYDSKESDSSTDDSTLKGKINNLVANGA-TNQAIAMQMAWMMLQPT 363

Query: 274 QGMRQHCNTEDANYKKIIVFMTDGENL-----------STKEDQQSLYYCNEAKKRGA-- 320
                    E   Y   I+ ++DG N            S++ D +    CN  K      
Sbjct: 364 APFPAPAKDEKYKYTDAIILLSDGLNTQDRWYGNGSDWSSQVDTRQALLCNNIKNDPISK 423

Query: 321 -------IVYAIGIRVIRSHE--FLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
                   +Y I +      E   L+ CA+   F+       +  AF+ IG  +   RI
Sbjct: 424 TDPTRRTRIYTIQVNTDGDPESTVLKNCATDG-FFPTSTASGIASAFAQIGASLSQLRI 481


>gi|83859217|ref|ZP_00952738.1| hypothetical protein OA2633_12470 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83852664|gb|EAP90517.1| hypothetical protein OA2633_12470 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 436

 Score =  113 bits (283), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 56/436 (12%), Positives = 132/436 (30%), Gaps = 68/436 (15%)

Query: 1   MFSLNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVH 60
           M  L      +  + +G + I+ A+   ++   +G  ++ S    + + L S +D   + 
Sbjct: 1   MSVLERIFSRWSDDRRGNVAIIMALCSGVLVTAVGGALDYSRSTTVSSELQSALDSGALA 60

Query: 61  AATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVV 120
           AA+ +  + N  +  +      L            + + D    + + +   S ++   +
Sbjct: 61  AAS-LTQDRNPEDVVRAYVEAALADHPQLLASLQLDVVADISLNSRVVNATASVAMPTTM 119

Query: 121 VPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLD- 179
           +      +++     +   +               M  +    +       +++++  D 
Sbjct: 120 LGLVGINTLTLEHASEAIEQVRDVEISLVLDVSGSMGGSKINALQDAAIEFVEIVLAADA 179

Query: 180 ---VSRS----------------MESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQ 220
               S S                     +++  +    +        E+ L        +
Sbjct: 180 AERTSISVIPYNGGVRTPREVNQDIVSGNNNHRRQSGCVDMGTDYPVEMTLPYREMEFTE 239

Query: 221 SGLVTFSNKIEEFFLLEWGVSH---------LQRKIKYLSKFGVS------TNSTPGLKY 265
                 +      F     +           ++  I  L   G +            L  
Sbjct: 240 YYGSEQTGNSSSAFCPRSNMESEFLSQNEGRMRGLINSLRAEGNTGLDVATMWGARALDP 299

Query: 266 AYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLS------------------------ 301
           A+          +  + +D +  KI+V MTDGE  +                        
Sbjct: 300 AWRGNLGGSFSDRPASYDDRDTIKILVVMTDGEATAQIRSEEYTYYDWWGRERTGTRSYE 359

Query: 302 ----TKEDQQSLYYCNEAKKRGAIVYAIGIRVIR--SHEFLRACASPN-SFYLVENPHSM 354
                +  +     C+ A+  G  +Y I  ++    + + +R CA+   ++Y VEN   +
Sbjct: 360 LYSARQARENMAEACDIAEGNGVQIYTIAFQLSGQTNRDLMRNCANKPQNYYQVENLD-I 418

Query: 355 YDAFSHIGKDIVTKRI 370
            +AFS I  DI   R+
Sbjct: 419 AEAFSSIAADINRLRL 434


>gi|325268973|ref|ZP_08135594.1| aerotolerance protein BatA [Prevotella multiformis DSM 16608]
 gi|324988594|gb|EGC20556.1| aerotolerance protein BatA [Prevotella multiformis DSM 16608]
          Length = 318

 Score =  113 bits (283), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 40/218 (18%), Positives = 71/218 (32%), Gaps = 37/218 (16%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
           +    +D+M+ +DVS SM    D    ++ +A +  +  +               GL  F
Sbjct: 83  KETEGIDIMLTMDVSASML-TDDVYPNRMAVAKEVASEFISS-------RPNDNIGLTIF 134

Query: 227 SNKIEEFFLLEWGVSHLQRKIKYLSK-------FGVSTNSTPGLKYAYNQIFDMQGMRQH 279
           + +      +    + L   +  +             T    GL  A +++         
Sbjct: 135 AGEAFTQCPMTLDHAALLNLLHNVRPDLVTSGLMKDGTAIGMGLANAVSRLQ-------- 186

Query: 280 CNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF---- 335
              +     KI++ +TDG N         +     AKK G  VY IG       E     
Sbjct: 187 ---DSKAKSKIVILLTDGSNNVGSIS--PMTAAAIAKKFGIRVYTIGFGRETGEEIGAID 241

Query: 336 ---LRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
              L+  A  +   FY  ++   +   +  I K   TK
Sbjct: 242 YRALQNIAVSTNGEFYRAQSQAELSRIYQDIDKLEKTK 279


>gi|262193845|ref|YP_003265054.1| von Willebrand factor type A [Haliangium ochraceum DSM 14365]
 gi|262077192|gb|ACY13161.1| von Willebrand factor type A [Haliangium ochraceum DSM 14365]
          Length = 346

 Score =  113 bits (283), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 39/237 (16%), Positives = 72/237 (30%), Gaps = 47/237 (19%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSI----TKIDMAIKSINAMLEEVKLIPDVNNVVQ 220
           N+     + +M+V+D S SM +   +      T++++      A +   +   D  +   
Sbjct: 84  NTIRREGIAIMMVVDTSGSMRALDLADGGLDQTRLEVVKDVFRAFV-AGEDGLDGRSNDT 142

Query: 221 SGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKF----GVSTNSTPGLKYAYNQIFDMQGM 276
            GLV+F+   +    L      L   +  L          T    GL  A          
Sbjct: 143 IGLVSFAGFADTRCPLTLNHGSLLTILDDLEIVRERAEDGTAIGDGLGLAVE-------- 194

Query: 277 RQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI------ 330
                 E     ++I+ +TDG N +    +  L     A + G  VY IG          
Sbjct: 195 ---RLRESEASSRVIILLTDGVNNAG--IETPLEAAELASRLGIKVYTIGAGTDGVAPVR 249

Query: 331 -----------------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                                 L A A  +   ++   +   +   +  I +   T+
Sbjct: 250 VTNPLTGAEELRPMPVEIDEATLEAIAEHTGGRYFRATDGDGLRQVYEQIDRLERTE 306


>gi|255009407|ref|ZP_05281533.1| aerotolerance-related membrane protein [Bacteroides fragilis
           3_1_12]
 gi|313147166|ref|ZP_07809359.1| aerotolerance protein BatA [Bacteroides fragilis 3_1_12]
 gi|313135933|gb|EFR53293.1| aerotolerance protein BatA [Bacteroides fragilis 3_1_12]
          Length = 327

 Score =  113 bits (283), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 36/234 (15%), Positives = 70/234 (29%), Gaps = 46/234 (19%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           ++    +     +D+M+ +DVS SM +       +++ A       +       +     
Sbjct: 76  TTNSWQNSEIEGIDIMLAIDVSTSMLAEDLK-PNRLEAAKDVAAEFI-------NGRPND 127

Query: 220 QSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFG--VSTNSTPGLKYAYNQIFDMQGMR 277
             G+  F+ +      L    + L    + +        T    G+  A           
Sbjct: 128 NIGITLFAGESFTQCPLTVDHAVLLNLFQGIKCDIIEDGTAVGMGIANAVT--------- 178

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI------- 330
                +     K+I+ +TDG N     D   L     AK  G  VY IG+          
Sbjct: 179 --RLKDSKAKSKVIILLTDGTNNKG--DISPLTAAEIAKSFGIRVYTIGVGTNGMAPYPV 234

Query: 331 --------------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                            + L   A  +  +++   +   + + +  I K   TK
Sbjct: 235 PVGGTVQYINTPVEIDEKTLTQIAGITDGNYFRATSNSKLKEVYEEIDKLEKTK 288


>gi|189461337|ref|ZP_03010122.1| hypothetical protein BACCOP_01987 [Bacteroides coprocola DSM 17136]
 gi|189431866|gb|EDV00851.1| hypothetical protein BACCOP_01987 [Bacteroides coprocola DSM 17136]
          Length = 332

 Score =  113 bits (282), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 40/258 (15%), Positives = 76/258 (29%), Gaps = 51/258 (19%)

Query: 141 FCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIK 200
           F   I  +     ++    ++    +     +D+M+ +DVS SM +       +++ A +
Sbjct: 57  FVLRIVAFVMIVLVLARPQTTDNWQNTEIEGIDIMLAVDVSTSMLAEDLK-PNRLEAAKQ 115

Query: 201 SINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLS-------KF 253
                +       +       GL  F+ +      L      L      +          
Sbjct: 116 VAAEFI-------NGRPNDNIGLTVFAGEAFTQCPLTVDHGVLLNLFNSIKGDIAQRGMI 168

Query: 254 GVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCN 313
              T    GL  A +              +     K+I+ +TDG N     D   L    
Sbjct: 169 EDGTAIGMGLANAIS-----------RLKDSKAKSKVIILLTDGSNNRG--DISPLTAAE 215

Query: 314 EAKKRGAIVYAIGIRVI---------------------RSHEFLRACA--SPNSFYLVEN 350
            AK+ G  VY IG+                           + L   A  +  +++   +
Sbjct: 216 IAKQFGIRVYTIGVGTNGTAPYPMQTYAGVQYVNVPVEIDEQTLTQIAGTTNGNYFRATS 275

Query: 351 PHSMYDAFSHIGKDIVTK 368
              + + +  I K   TK
Sbjct: 276 NSKLEEVYREIDKLEKTK 293


>gi|323700353|ref|ZP_08112265.1| von Willebrand factor type A [Desulfovibrio sp. ND132]
 gi|323460285|gb|EGB16150.1| von Willebrand factor type A [Desulfovibrio desulfuricans ND132]
          Length = 400

 Score =  113 bits (282), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 51/436 (11%), Positives = 127/436 (29%), Gaps = 134/436 (30%)

Query: 23  TAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDI 82
            A+ LP++  V G+ +++ +++   T L + +D   +  + ++  + + +     +    
Sbjct: 1   MALLLPVLLGVAGIAVDMGNMYMTHTRLQAAVDAGALAGSLELPYDPDLSKGIVTQA--- 57

Query: 83  LCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFC 142
                                VND+ +     ++   +    E  S+   ++ ++ +   
Sbjct: 58  ---------------------VNDMVETNMEEAVVTEISAGTEIRSVKVTAQAEVRMLLM 96

Query: 143 TFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSI 202
                      + M   +          +L+++ V+D S SM+         ID+  ++ 
Sbjct: 97  ---------EVLGMADKTVEASAMAGFNKLEVVFVIDNSGSMKGT------PIDLVKQAS 141

Query: 203 NAMLEEVKLIPDVNN--------------------------------------------- 217
             + + +       +                                             
Sbjct: 142 EELTDLLIPDGTTPDTKVGLVPFRGKIRLGEAVDGYAEGCVNADGSLNTGINEEFMDEYN 201

Query: 218 -----VVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFG--VSTNSTPGLKYAYNQI 270
                  +   +   + I     L    S +   I   +  G    T  + G+K+  N +
Sbjct: 202 ALPYYYKRYITLDTCSDIPTVLPLSKNKSTIIAAIGSQTATGAASGTVISEGIKWGRNIL 261

Query: 271 FDMQGMRQHCNTEDANYKKIIVFMTDGE-------------------------------- 298
                  Q  + ED  ++KI++ +TDG+                                
Sbjct: 262 TPDAPFTQAGSKED--FRKIMIVLTDGDTEDGECGGTYRATYRPNNYWTNAYYGMGVDTA 319

Query: 299 --NLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR--SHEFLRACA-----SPNSFYLVE 349
             N     +   L     AK  G  +++I            ++  A     + + ++   
Sbjct: 320 HCNDGGVLNADMLSEAQLAKDAGIEIFSIRFGSSDTTDINLMKEIASSKAGTDDHYFDAP 379

Query: 350 NPHSMYDAFSHIGKDI 365
           + + + D F  IGK +
Sbjct: 380 SVYDIPDIFKQIGKQL 395


>gi|126662671|ref|ZP_01733670.1| batA protein [Flavobacteria bacterium BAL38]
 gi|126626050|gb|EAZ96739.1| batA protein [Flavobacteria bacterium BAL38]
          Length = 334

 Score =  113 bits (281), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 36/240 (15%), Positives = 81/240 (33%), Gaps = 42/240 (17%)

Query: 154 IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
           +  P +  V   S+T   +D+++ +DVS SM +       +++   K     +++     
Sbjct: 73  MARPRSVDVTSKSKTTRGIDIVMAIDVSSSMLANDLK-PNRLEALKKVAATFVQD----- 126

Query: 214 DVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM 273
                 + GLV ++ +      +    + + + +K +           G+          
Sbjct: 127 --RINDRIGLVVYAGESYTRTPVTSDKTIILQSLKSVEFDDSIIADGTGIGVGL------ 178

Query: 274 QGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI--- 330
                +   +     +II+ +TDG N S   D ++    + AK+ G  VY IGI      
Sbjct: 179 -ATAINRIKDSKAKSRIIILLTDGVNNSGTIDPRT--AASIAKEYGIKVYTIGIGTNGKA 235

Query: 331 --------------------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                                  + ++  A  +   ++   +   +   +  I K   T+
Sbjct: 236 MFPVAKDANGKLVFKMMPVEIDEKLMQEIAKNTDAKYFRATSNKKLQAIYDEINKLETTE 295


>gi|284040938|ref|YP_003390868.1| von Willebrand factor A [Spirosoma linguale DSM 74]
 gi|283820231|gb|ADB42069.1| von Willebrand factor type A [Spirosoma linguale DSM 74]
          Length = 359

 Score =  113 bits (281), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 37/219 (16%), Positives = 73/219 (33%), Gaps = 29/219 (13%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
           +    +D+M+ +DVS SM        T++  A +   A +             + GLV F
Sbjct: 108 EQSEGIDIMLAMDVSVSMSESDI-LPTRLAAARRVAQAFVRG-------RRNDRIGLVIF 159

Query: 227 SNKIEEFFLLEWGVSHLQRKIKYLSKFGV---STNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           + +      L    + L + +  L+   +    T     L    N++ D           
Sbjct: 160 AGEAFSLCPLTTDYNLLNQYLNDLNDGMIRTSGTAIGDALARCINRMRDRPAASSDTTQA 219

Query: 284 DAN-----YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI-------- 330
                     K+I+ ++DG+N +   D   +   + AK     +Y I +           
Sbjct: 220 KTEQWKSERSKVIILLSDGDNTAGNLD--PITAASLAKAFNIKIYTIAVGQPVASASEAS 277

Query: 331 -RSHEFLRACAS--PNSFYLVENPHSMYDAFSHIGKDIV 366
                 L+  A+    SF+   +   +   F+ I +   
Sbjct: 278 TVDEGILKKIATIGKGSFFRAVDSGRLKTVFAQISQLEK 316


>gi|223558081|gb|ACM91085.1| aerotolerance protein BatA [uncultured bacterium Rlip1]
          Length = 332

 Score =  113 bits (281), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 35/224 (15%), Positives = 70/224 (31%), Gaps = 46/224 (20%)

Query: 170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229
             +D+++ +DVS SM +       ++  A    +  ++            + GLV FS +
Sbjct: 90  EGIDIVMAMDVSGSMLARDLK-PDRLTAAKNVASDFVKG-------RPGDRMGLVIFSGE 141

Query: 230 IEEFFLLEWGVSHLQRKIKYLSK--FGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287
                 L      +   +  +        T    GL  A +              +    
Sbjct: 142 TFTQVPLTTDHGVMLNMLAEMKNGLIDDGTAIGDGLATAIS-----------RLKDSEAI 190

Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV------------------ 329
            K+++ +TDG N +   D  +      AK  G  VY IG+                    
Sbjct: 191 SKVVILLTDGMNNAGSVDPYT--AAEIAKLYGIRVYTIGVGSYGTAPYPVQTPFGTQIQQ 248

Query: 330 ---IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                  + L + A  +   ++   +   + + +  I K   +K
Sbjct: 249 MKVEIDEKLLASVASMTGGKYFRATSNQKLDEIYEEIDKLERSK 292


>gi|319902109|ref|YP_004161837.1| von Willebrand factor type A [Bacteroides helcogenes P 36-108]
 gi|319417140|gb|ADV44251.1| von Willebrand factor type A [Bacteroides helcogenes P 36-108]
          Length = 327

 Score =  113 bits (281), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 38/234 (16%), Positives = 71/234 (30%), Gaps = 46/234 (19%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           ++    +     +D+M+ +DVS SM +       +++ A       +       +     
Sbjct: 76  TTNSWQNSEIEGIDIMLAMDVSTSMLAEDLK-PNRLEAAKDVATEFI-------NGRPND 127

Query: 220 QSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSK--FGVSTNSTPGLKYAYNQIFDMQGMR 277
             G+  F+ +      L    + L   +K +        T    GL  A           
Sbjct: 128 NIGITLFAGESFTQCPLTVDHAVLLNLLKDMKCGFIEDGTAIGMGLANAVT--------- 178

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI------- 330
                +     K+I+ +TDG N     D   L     AK  G  VY IG+          
Sbjct: 179 --RLKDSKAKSKVIILLTDGVNNKG--DISPLTAAEIAKSFGIRVYTIGVGTNGMAPYPY 234

Query: 331 --------------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                            + L   A  +  +++   +   + + +  I K   TK
Sbjct: 235 PVGGTVQYVNMPVEIDEKTLTQIAGTTEGNYFRATSNSKLKEVYEEIDKLEKTK 288


>gi|331006778|ref|ZP_08330044.1| BatA [gamma proteobacterium IMCC1989]
 gi|330419396|gb|EGG93796.1| BatA [gamma proteobacterium IMCC1989]
          Length = 364

 Score =  113 bits (281), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 37/225 (16%), Positives = 83/225 (36%), Gaps = 39/225 (17%)

Query: 171 RLDMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+++ +D+S SM+           T++    K ++  +++           + GL+ F
Sbjct: 93  GRDLLLAVDISGSMQQEDMQINNRPATRLAAVKKVVSDFIDQ-------RQGDRIGLILF 145

Query: 227 SNKIEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
             +      L +    + + ++   L   G  T     +  +  ++ +         +  
Sbjct: 146 GTQAYLQTPLTFDTQSVNQFLQEAQLGFAGKDTAIGDAIGLSVKRLKNQSSAS----SAK 201

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR------------- 331
            +  K+I+ +TDGEN + +   + L     A+K GA +Y +GI                 
Sbjct: 202 PSNSKVIILLTDGENTAGE--VEPLQAAKLAEKIGAKIYTVGIGADEMIVRGFFGNRRVN 259

Query: 332 -----SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKR 369
                  E L A A  +   ++   N   + + +S + K   T++
Sbjct: 260 PSASLDEETLTAIANTTGGLYFRARNTQELNNIYSELDKLEPTEK 304


>gi|288802180|ref|ZP_06407620.1| BatA protein [Prevotella melaninogenica D18]
 gi|288335147|gb|EFC73582.1| BatA protein [Prevotella melaninogenica D18]
          Length = 318

 Score =  112 bits (280), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 36/211 (17%), Positives = 70/211 (33%), Gaps = 23/211 (10%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
           +    +D+M+ +D+S SM +       ++++A +  +  +               GL  F
Sbjct: 83  KDTEGIDIMLTMDISASMLTED-VFPNRMEVAKEVASEFISS-------RPSDNIGLTIF 134

Query: 227 SNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
           + +      +    + L   +  +         T GL      I            +   
Sbjct: 135 AGEAFTQCPMTLDHAALLNLLHNVRTD----LVTNGLMQDGTAIGLGLANSVSRLKDSKA 190

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHE-------FLRAC 339
             K+++ +TDG N         +     AKK G  VY IG+      +        L+  
Sbjct: 191 KSKVVILLTDGSNNVGSIS--PMTAATIAKKFGIRVYTIGLGRETGEDIGAIDYKTLQDI 248

Query: 340 A--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
           A  +   FY  ++   +   +  I K   TK
Sbjct: 249 AVLTNGEFYRAQSQAELSKIYQDIDKLEKTK 279


>gi|269104787|ref|ZP_06157483.1| protein BatA [Photobacterium damselae subsp. damselae CIP 102761]
 gi|268161427|gb|EEZ39924.1| protein BatA [Photobacterium damselae subsp. damselae CIP 102761]
          Length = 321

 Score =  112 bits (280), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 38/220 (17%), Positives = 73/220 (33%), Gaps = 47/220 (21%)

Query: 173 DMMIVLDVSRSMESFFDSS-----ITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFS 227
           DMM+ +D+S SM      +     I ++      ++  +E+           + GLV F 
Sbjct: 84  DMMLAVDLSGSMAIKDMQTQSGQSIDRLTAIKHVLSNFIEK-------RKGDRLGLVLFG 136

Query: 228 NKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDA 285
           +       L +    +++++    L   G ST    GL  A                   
Sbjct: 137 DHAYLQTPLTFDRHTVEQQLDRTVLGLVGQSTAIGEGLGIATKTFIK-----------SK 185

Query: 286 NYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR-------------- 331
             +++I+ ++DG N +   D   L     AK+ G  +Y +GI                  
Sbjct: 186 APQRVIILLSDGANTAGVID--PLEAAKLAKESGVTIYTVGIGADEMLQRSIFGVQKVNP 243

Query: 332 ----SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                 + L   A  +   ++   NP  +   +  I +  
Sbjct: 244 SQDLDEKTLTKIAQMTGGKYFRARNPQELDKIYQIINQLE 283


>gi|330447847|ref|ZP_08311495.1| von Willebrand factor type A domain protein [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
 gi|328492038|dbj|GAA05992.1| von Willebrand factor type A domain protein [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
          Length = 321

 Score =  112 bits (280), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 39/219 (17%), Positives = 76/219 (34%), Gaps = 47/219 (21%)

Query: 173 DMMIVLDVSRSMESFFD-----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFS 227
           DM++ +D+S SM           SI ++      ++  +E+           + GLV F+
Sbjct: 84  DMLLAVDLSGSMSIPDMVTKNGQSIDRLTAVKHVLSDFIEK-------RKGDRLGLVLFA 136

Query: 228 NKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDA 285
           +       L +  + +++++    L   G ST    GL  A                   
Sbjct: 137 DHAYLQTPLTFDRNTVEQQLDRTVLGLIGQSTAIGEGLGIATKTFI-----------NSK 185

Query: 286 NYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR-------------- 331
             +++I+ ++DG N S   D   L     AK+ G  +Y +G+   +              
Sbjct: 186 APQRVIILLSDGANTSGVID--PLEAAKLAKESGVKIYTVGVGADQMVQKGFFGDRLVNP 243

Query: 332 ----SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKD 364
                 + L   A  +   ++   NP  +   +  I K 
Sbjct: 244 SQDLDEKTLTEIAKMTGGEYFRARNPQQLEKIYDIINKL 282


>gi|256419476|ref|YP_003120129.1| hypothetical protein Cpin_0430 [Chitinophaga pinensis DSM 2588]
 gi|256034384|gb|ACU57928.1| conserved hypothetical protein [Chitinophaga pinensis DSM 2588]
          Length = 336

 Score =  112 bits (279), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 37/235 (15%), Positives = 71/235 (30%), Gaps = 47/235 (20%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           +S    S     +D+++ +D+S SM +       +++ A +     +       D     
Sbjct: 84  TSNTSESIDSEGIDIVLAMDISGSMLAQDL-QPDRLEAAKRVAMNFV-------DSRISD 135

Query: 220 QSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFG--VSTNSTPGLKYAYNQIFDMQGMR 277
           + GLV FS +      +      L+ +I  +        T    G               
Sbjct: 136 RIGLVIFSGESFTQCPITTDHGVLKNQIAQVKSGMLQDGTAIGMG-----------LATS 184

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR------ 331
                      K+I+ +TDG N +   D   L     AK     VY IG+  I       
Sbjct: 185 VERLRTSKAKSKVIILLTDGVNNTGLID--PLTALEIAKAFKIRVYTIGVGTIGKAPFPM 242

Query: 332 ----------------SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                               ++  +  +   ++   +   + + +  I K   TK
Sbjct: 243 TMPDGSIQMQMQDVQLDEPLMKKISVETGGKYFRATSNKELENIYGEIDKLEKTK 297


>gi|95928343|ref|ZP_01311091.1| von Willebrand factor, type A [Desulfuromonas acetoxidans DSM 684]
 gi|95135614|gb|EAT17265.1| von Willebrand factor, type A [Desulfuromonas acetoxidans DSM 684]
          Length = 329

 Score =  112 bits (279), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 35/225 (15%), Positives = 74/225 (32%), Gaps = 46/225 (20%)

Query: 171 RLDMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+M+ +D+S SM +        S+ ++        A +++           + GL+ F
Sbjct: 89  GRDLMLAVDLSGSMRTDDFQLSGRSVDRLTALKAVAGAFIDQ-------RQGDRIGLILF 141

Query: 227 SNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
             +      L +  + + R +    +   G  T     +  A                +D
Sbjct: 142 GEQPYIQAPLTFDHNTVTRLLHEAVVGLAGNKTAIGDAIGLAVK-----------RLRKD 190

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR------------- 331
              K +++ +TDG + S   D   L     A +RG  VY IGI                 
Sbjct: 191 PQAKNVLILLTDGASNSGSLD--PLKAAKLAAQRGLKVYTIGIGAEAVEVGSFFFKRTVN 248

Query: 332 -----SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKR 369
                  + L+A A  +   ++   +   +   +  + +    ++
Sbjct: 249 PSLDLDEKTLKAIAETTGGRYFRARDTEELAQIYQQLDQLEPVEK 293


>gi|91201136|emb|CAJ74195.1| conserved hypothetical protein [Candidatus Kuenenia
           stuttgartiensis]
          Length = 331

 Score =  112 bits (279), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 35/250 (14%), Positives = 69/250 (27%), Gaps = 51/250 (20%)

Query: 154 IVMPITSSVKVNSQ-TDARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEE 208
           I +         ++     +D+++ +D+S SM +           ++ +  + +   +  
Sbjct: 67  IALARPQQGNEQTKVKTEGIDIVLAVDISGSMLAEDFEMDGKRQNRLYVVKQVVKDFI-- 124

Query: 209 VKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYA 266
                +  +    GLV FS        L      L + ++   +      T         
Sbjct: 125 -----NKRSTDPIGLVVFSANAYTQCPLTLDYGILLQFLEKTEIGLLEDGTAIGSA---- 175

Query: 267 YNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIG 326
                                 K+IV +TDG N S + D   L     A+     +Y IG
Sbjct: 176 -------IASSVDRLRNTKAQSKVIVLLTDGRNNSGQID--PLTAAELAQAFNIKIYTIG 226

Query: 327 IRV----------------------IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIG 362
                                        E L   A  +   +Y   +  S+ + +  I 
Sbjct: 227 AGSKGLVPYPARDLFGNRVMRQVKIDIDDESLAEIANITGGRYYRATDTGSLKEIYQQID 286

Query: 363 KDIVTKRIWY 372
               T+    
Sbjct: 287 ALEKTETEIT 296


>gi|307354884|ref|YP_003895935.1| hypothetical protein Mpet_2754 [Methanoplanus petrolearius DSM
           11571]
 gi|307158117|gb|ADN37497.1| conserved hypothetical protein [Methanoplanus petrolearius DSM
           11571]
          Length = 316

 Score =  112 bits (279), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 34/222 (15%), Positives = 79/222 (35%), Gaps = 39/222 (17%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
           QT   +++++V+D S SM++   S   +++    +   +      I D++     G+V F
Sbjct: 83  QTKEGVNVVLVIDDSGSMQATDYS-PNRLEATKSAAEEL------INDLDPKDYVGIVVF 135

Query: 227 SNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
            +       L      +   ++ + +   +T    GL    N                 N
Sbjct: 136 ESGASTASYLSPDKDSVIENLENIMEKDGATAIGDGLSLGINM-----------ADSIPN 184

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR--------------- 331
            KK+++ ++DG N +             AK     V+ IG+   +               
Sbjct: 185 RKKVVILLSDGVNNAGVISPD--EAIQFAKDSDIQVFTIGMGSEQPVVMGYDWFGNPQYA 242

Query: 332 --SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKR 369
                 L+  A  +   ++   +  ++ + +S+I  +I  ++
Sbjct: 243 ELDEATLKEIADETGGKYFKSVDDQTLNEIYSNINSEIKREK 284


>gi|89889805|ref|ZP_01201316.1| BatA, aerotolerance operon [Flavobacteria bacterium BBFL7]
 gi|89518078|gb|EAS20734.1| BatA,  aerotolerance operon [Flavobacteria bacterium BBFL7]
          Length = 337

 Score =  112 bits (279), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 38/227 (16%), Positives = 70/227 (30%), Gaps = 49/227 (21%)

Query: 170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229
             +D+++ +DVS SM +       +++   K     ++            + G+V ++ +
Sbjct: 93  EGIDIVLAVDVSASMLAEDLK-PNRLEATKKVAADFIKG-------RPNDRIGVVVYAGE 144

Query: 230 IEEFFLLEWGVSHLQRKIKYLSKFG---VSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
                 +        R I  ++  G     T    GL  A N              +   
Sbjct: 145 SYTKTPITTDEMISLRAINEIAFDGVLENGTAIGMGLATAVN-----------RLKDSEA 193

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI---------------- 330
             K+I+ MTDG N S   D         A +    VY IGI                   
Sbjct: 194 LSKVIILMTDGVNNSGFID--PKIASELALEYDIKVYTIGIGTNGNAPSPVAQIGRNKFR 251

Query: 331 -------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                     E ++  A  +   ++   N   + + +  I K   T+
Sbjct: 252 MAMMPVEIDEELMKQIAVDTGGKYFRATNNKKLEEIYGEIDKLEKTE 298


>gi|307943467|ref|ZP_07658811.1| putative Flp pilus assembly protein TadG [Roseibium sp. TrichSKD4]
 gi|307773097|gb|EFO32314.1| putative Flp pilus assembly protein TadG [Roseibium sp. TrichSKD4]
          Length = 466

 Score =  112 bits (279), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 45/458 (9%), Positives = 114/458 (24%), Gaps = 98/458 (21%)

Query: 8   IRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMN 67
              F  + +G +  L A    I+ +V G  ++       +  + + +D + +  A Q+  
Sbjct: 10  FHKFGSDERGSLLPLVAGVCLILLVVAGSAVDYGRALGYRHKIANAVDAAALTVAKQLST 69

Query: 68  EGNGNNRKKLKGGDILCRIKNTWNMSFRNEL--------------------------RDN 101
                N+ +    +      N   ++ +                             +  
Sbjct: 70  TVLTENQIRTGLKNAFRANLNAAGINSQGIDNLDFKVDPGEGTLDVWSSVDIQTNFIKLG 129

Query: 102 GFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSS 161
           G   +  ++  ++ ++           +      +  +           +  +     S 
Sbjct: 130 GIGPEKLEVGAASQVNYSRFDVELALVLDVTGSMRPDMNALKEASKSIVNILLPDDSNSR 189

Query: 162 VK----VNSQTDARLDM---MIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPD 214
                         +++      +    S      +  +       +             
Sbjct: 190 ESKVRISLVPYSQGVNLGSYATRVTNGGSTWRNCVNERSGPQKFTDAPYNYAGSRSDFFH 249

Query: 215 VNNVVQSGLVTFSNKIEEFFLLEW---------GVSHLQRKIKYLS-----------KFG 254
                      ++ + +                  + L R I  L             +G
Sbjct: 250 GKPKQFVWDYGWTEQWQTRPEACPKTAVEPLTADRTKLLRAISGLKDGGGTGGQTGIAWG 309

Query: 255 VSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTK----------- 303
             T S    K+      D         +   + KK  + MTDG+  +             
Sbjct: 310 WYTLS---PKWKNLWPRDSAPATYGTGSHTDDTKKFALIMTDGDFNAAYGWDCGCRKIRD 366

Query: 304 ---------------------------EDQQSLYYCNEAKKRGAIVYAIGI---RVIRSH 333
                                        Q++   C+E K +   ++ +           
Sbjct: 367 KPLYCRKKSNKKSWIERYFSPSKISHAPAQRAKKLCDEMKSKNIEIFTVYFDTGGATFGD 426

Query: 334 EFLRACASPNS-FYLVENPHSMYDAFSHIGKDIVTKRI 370
           + +  CAS +  +Y  +N + +  AFS+I  +I +  I
Sbjct: 427 DLMSYCASGSRNYYRADNSNELIQAFSNIANEIQSIYI 464


>gi|302346571|ref|YP_003814869.1| von Willebrand factor type A domain protein [Prevotella
           melaninogenica ATCC 25845]
 gi|302150280|gb|ADK96541.1| von Willebrand factor type A domain protein [Prevotella
           melaninogenica ATCC 25845]
          Length = 318

 Score =  112 bits (279), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 36/211 (17%), Positives = 70/211 (33%), Gaps = 23/211 (10%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
           +    +D+M+ +D+S SM +       ++++A +  +  +               GL  F
Sbjct: 83  KDTEGIDIMLTMDISASMLTED-VFPNRMEVAKEVASEFISS-------RPSDNIGLTIF 134

Query: 227 SNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
           + +      +    + L   +  +         T GL      I            +   
Sbjct: 135 AGEAFTQCPMTLDHAALLNLLHNVRTD----LVTNGLMQDGTAIGLGLANSVSRLKDSKA 190

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHE-------FLRAC 339
             K+++ +TDG N         +     AKK G  VY IG+      +        L+  
Sbjct: 191 KSKVVILLTDGSNNVGSIS--PMTAATIAKKFGIRVYTIGLGRETGEDIGAIDYKTLQDI 248

Query: 340 A--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
           A  +   FY  ++   +   +  I K   TK
Sbjct: 249 AVLTNGEFYRAQSQAELSKIYQDIDKLEKTK 279


>gi|150007595|ref|YP_001302338.1| hypothetical protein BDI_0948 [Parabacteroides distasonis ATCC
           8503]
 gi|255013876|ref|ZP_05286002.1| hypothetical protein B2_08207 [Bacteroides sp. 2_1_7]
 gi|256839782|ref|ZP_05545291.1| conserved hypothetical protein [Parabacteroides sp. D13]
 gi|149936019|gb|ABR42716.1| conserved hypothetical protein BatA [Parabacteroides distasonis
           ATCC 8503]
 gi|256738712|gb|EEU52037.1| conserved hypothetical protein [Parabacteroides sp. D13]
          Length = 328

 Score =  112 bits (279), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 40/224 (17%), Positives = 74/224 (33%), Gaps = 46/224 (20%)

Query: 170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229
             +D+M+ +D+S SM +       +++ A     + +       +       GLV FS +
Sbjct: 87  EGIDIMLAMDISGSMLAQDLK-PNRLEAAKDVAASFI-------NGRPNDNIGLVVFSAE 138

Query: 230 IEEFFLLEWGVSHLQRKIKYLSKFG--VSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287
                 L    + L    K +        T    GL  A ++I            +    
Sbjct: 139 SFTQCPLTTDHTVLLNLFKDIQSGMIQDGTAIGLGLANAVSRI-----------KDSHAK 187

Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV------------------ 329
            K+I+ +TDG N + +     +     AK  G  VY IG+                    
Sbjct: 188 SKVIILLTDGSNNAGEI--APVTAAEIAKTFGVRVYTIGVGTKGMAPYPFQTAFGVQYQN 245

Query: 330 ---IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                    L+  A  +   ++   +  S+ + +S I +   TK
Sbjct: 246 IPVEIDEATLKQIASTTGGQYFRATDNASLKEIYSEIDQMEKTK 289


>gi|224539999|ref|ZP_03680538.1| hypothetical protein BACCELL_04911 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224518389|gb|EEF87494.1| hypothetical protein BACCELL_04911 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 327

 Score =  112 bits (279), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 38/253 (15%), Positives = 74/253 (29%), Gaps = 46/253 (18%)

Query: 141 FCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIK 200
           F   I        ++    ++    +     +D+M+ +DVS SM +       +++ A  
Sbjct: 57  FMLRIIALALIIVVLARPQTTNSWQNSEIEGIDIMMAIDVSTSMLAEDLK-PNRLEAAKD 115

Query: 201 SINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFG--VSTN 258
                +       +       G+  F+ +      L    + L    + +        T 
Sbjct: 116 VAAEFI-------NGRPNDNIGITLFAGESFTQCPLTVDHAVLLNLFQGIKCGIIEDGTA 168

Query: 259 STPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKR 318
              G+  A                +     K+I+ +TDG N     D   L     AK  
Sbjct: 169 VGMGIANAVT-----------RLKDSKAKSKVIILLTDGTNNKG--DISPLTAAEIAKSF 215

Query: 319 GAIVYAIGIRVI---------------------RSHEFLRACA--SPNSFYLVENPHSMY 355
           G  VY IG+                           + L   A  +  +++   +   + 
Sbjct: 216 GIRVYTIGVGTNGMAPYPYPVGNTVQYVNMPVEIDEKTLTQIAATTEGNYFRATSNSKLK 275

Query: 356 DAFSHIGKDIVTK 368
           + +  I K   TK
Sbjct: 276 EVYEEIDKLEKTK 288


>gi|189465623|ref|ZP_03014408.1| hypothetical protein BACINT_01981 [Bacteroides intestinalis DSM
           17393]
 gi|189437897|gb|EDV06882.1| hypothetical protein BACINT_01981 [Bacteroides intestinalis DSM
           17393]
          Length = 327

 Score =  112 bits (279), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 38/253 (15%), Positives = 74/253 (29%), Gaps = 46/253 (18%)

Query: 141 FCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIK 200
           F   I        ++    ++    +     +D+M+ +DVS SM +       +++ A  
Sbjct: 57  FMLRIIALALIIVVLARPQTTNSWQNSEIEGIDIMMAIDVSTSMLAEDLK-PNRLEAAKD 115

Query: 201 SINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFG--VSTN 258
                +       +       G+  F+ +      L    + L    + +        T 
Sbjct: 116 VAAEFI-------NGRPNDNIGITLFAGESFTQCPLTVDHAVLLNLFQGIKCGIIEDGTA 168

Query: 259 STPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKR 318
              G+  A                +     K+I+ +TDG N     D   L     AK  
Sbjct: 169 VGMGIANAVT-----------RLKDSKAKSKVIILLTDGTNNKG--DISPLTAAEIAKSF 215

Query: 319 GAIVYAIGIRVI---------------------RSHEFLRACA--SPNSFYLVENPHSMY 355
           G  VY IG+                           + L   A  +  +++   +   + 
Sbjct: 216 GIRVYTIGVGTNGMAPYPYPVGNTVQYVNMPVEIDEKTLTQIAATTEGNYFRATSNSKLK 275

Query: 356 DAFSHIGKDIVTK 368
           + +  I K   TK
Sbjct: 276 EVYEEIDKLEKTK 288


>gi|156308416|ref|XP_001617662.1| hypothetical protein NEMVEDRAFT_v1g225902 [Nematostella vectensis]
 gi|156195093|gb|EDO25562.1| predicted protein [Nematostella vectensis]
          Length = 273

 Score =  112 bits (279), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 35/241 (14%), Positives = 82/241 (34%), Gaps = 43/241 (17%)

Query: 154 IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
           +  P +  V   S+T   +D+++ +DVS SM +       ++D   +  +  +E+     
Sbjct: 11  LARPRSVDVTAKSRTTKGIDIVMAIDVSGSMLAKDFK-PNRLDALKRVASTFIED----- 64

Query: 214 DVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM 273
                 + GLV ++ +      +    + + + +K +           G+          
Sbjct: 65  --RINDRIGLVVYAGESYTRTPITSDKTVILQSLKTVEYDDSIIADGTGIGVGL------ 116

Query: 274 QGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI--- 330
                +   +     ++I+ +TDG N +   D +     + AK+ G  VY IGI      
Sbjct: 117 -ATAINRIKDSKAKSRVIILLTDGVNNAGTIDPRM--AADIAKQYGIKVYTIGIGTNGMA 173

Query: 331 ---------------------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVT 367
                                   + ++  A  +   ++   +   +   ++ I K   T
Sbjct: 174 LFPYAKDQETGKFLFRNMQVEIDEKLMKEIAEMTDGKYFRATDDKKLKAIYAEINKLETT 233

Query: 368 K 368
           +
Sbjct: 234 E 234


>gi|303240108|ref|ZP_07326629.1| conserved hypothetical protein [Acetivibrio cellulolyticus CD2]
 gi|302592377|gb|EFL62104.1| conserved hypothetical protein [Acetivibrio cellulolyticus CD2]
          Length = 323

 Score =  112 bits (279), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 37/227 (16%), Positives = 84/227 (37%), Gaps = 48/227 (21%)

Query: 168 TDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFS 227
           +   +D+ + LDVS +M+S       ++++A K+I   +++           +  L+ F+
Sbjct: 78  SKQGIDIAVALDVSGTMQSVDF-EPNRLEVARKTIQDFVDQ-------RPSDRIALIAFA 129

Query: 228 NKIEEFFLLEWGVSHLQRKIKYLSKFGV---STNSTPGLKYAYNQIFDMQGMRQHCNTED 284
                   L    + ++  ++ +S   V    T     +    N              + 
Sbjct: 130 GTAYTRVPLTLDHNVVRESLQDISFKSVNEEGTAIGMAISVGLN-----------RLKKS 178

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR------------- 331
            +  KI++ +TDG+N +   D  +      AK  G  +Y IG+   +             
Sbjct: 179 TSPSKIMILLTDGDNNAGSIDPNT--ASTLAKDSGIKIYTIGVGSDKTIIPGTNEFGQTV 236

Query: 332 ---------SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVT 367
                    + + L+  A  +   +Y  ++ +++   F++I K   T
Sbjct: 237 YQEYESGLLNEDLLKKIAETTNGQYYRAKDSNALSQVFANINKLEKT 283


>gi|34558787|gb|AAQ75132.1| BatA protein [Alvinella pompejana epibiont 6C6]
          Length = 300

 Score =  112 bits (279), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 43/248 (17%), Positives = 84/248 (33%), Gaps = 36/248 (14%)

Query: 143 TFIPWYTNSRHIVMPITSS----VKVNSQTDARLDMMIVLDVSRSMESFFDS----SITK 194
             I W      +++   +S          T    D+++ +DVS SM     S      ++
Sbjct: 48  NSILWIVTIYTLLVLALASPFTYEAKELSTKKGRDLILTIDVSGSMAQKGFSKEESEKSR 107

Query: 195 IDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIK---YLS 251
            ++A +     ++              G+V F +       L + +  L         + 
Sbjct: 108 YEVAKEIAKRFIKN-------RFSDNIGIVIFGSFSFSASPLTYDLKALLEMFDLMSDVG 160

Query: 252 KFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYY 311
             G +T     +  A                      K+I+ +TDG++   K  +     
Sbjct: 161 IAGNNTAIGDAIFEAIK-----------NLESGEAKSKVIILLTDGKHNFGK--KSPKEG 207

Query: 312 CNEAKKRGAIVYAIGIRVIRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVT-- 367
             EAKKRG  +Y +GI      + L   A  +    +  +N   + + F  I +   +  
Sbjct: 208 VVEAKKRGIKIYTVGIGTDYDKKLLEKMAKETNAKSFFAKNSKELEEVFKEIEELEPSPI 267

Query: 368 KRI-WYDK 374
           K I +Y++
Sbjct: 268 KSINYYNR 275


>gi|198274642|ref|ZP_03207174.1| hypothetical protein BACPLE_00794 [Bacteroides plebeius DSM 17135]
 gi|198272089|gb|EDY96358.1| hypothetical protein BACPLE_00794 [Bacteroides plebeius DSM 17135]
          Length = 332

 Score =  112 bits (279), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 40/258 (15%), Positives = 78/258 (30%), Gaps = 51/258 (19%)

Query: 141 FCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIK 200
           F   I  +     ++    ++    +     +D+M+ +DVS SM +       +I+ A +
Sbjct: 57  FVLRILTFVMIVLVLARPQTTDNWQNTEIEGIDIMLAVDVSTSMLAEDLK-PNRIEAAKQ 115

Query: 201 SINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFG------ 254
                +       +       GL  F+ +      L      L    + +S         
Sbjct: 116 VAAEFI-------NGRPNDNIGLTIFAGEAFTQCPLTVDHGVLLNLFQSVSCDMVQRGMI 168

Query: 255 -VSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCN 313
              T    GL  A +              +     K+++ +TDG N     D   L    
Sbjct: 169 EDGTALGMGLANAVS-----------RLKDSKAKSKVVILLTDGVNNRG--DISPLTAAE 215

Query: 314 EAKKRGAIVYAIGIRVI---------------------RSHEFLRACA--SPNSFYLVEN 350
            AK+ G  VY IG+                           + +   A  +  +++   +
Sbjct: 216 IAKQFGIRVYTIGVGTNGTAPYPMQTYAGVQYVQMPVEIDEQTMSQIAGTTNGNYFRATS 275

Query: 351 PHSMYDAFSHIGKDIVTK 368
              + + +  I K   TK
Sbjct: 276 NTKLKEVYREIDKLEKTK 293


>gi|28901309|ref|NP_800964.1| hypothetical protein VPA1454 [Vibrio parahaemolyticus RIMD 2210633]
 gi|308125557|ref|ZP_05775735.2| von Willebrand factor type A [Vibrio parahaemolyticus K5030]
 gi|28809856|dbj|BAC62797.1| conserved hypothetical protein [Vibrio parahaemolyticus RIMD
           2210633]
 gi|308112309|gb|EFO49849.1| von Willebrand factor type A [Vibrio parahaemolyticus K5030]
          Length = 328

 Score =  111 bits (278), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 31/224 (13%), Positives = 71/224 (31%), Gaps = 46/224 (20%)

Query: 168 TDARLDMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGL 223
                D+M+V+D+S SM+    +     I ++    K ++  + +           + G+
Sbjct: 87  QPKYRDLMLVVDLSGSMQKEDMNLDGEYIDRLSAVKKVLSDFVAK-------RKGDRLGV 139

Query: 224 VTFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCN 281
           V F +       L      + ++IK   +   G  T    G+                  
Sbjct: 140 VLFGDHAYLQTPLTADRQTVIQQIKQTVIGLVGQRTAIGDGIGLGTKTFV---------- 189

Query: 282 TEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV------------ 329
            +    +++++ ++DG N +       +     AKK  A +Y +G+              
Sbjct: 190 -DSDAPQRVMILLSDGSNTAG--VLDPIEAAEIAKKYNATIYTVGVGAGEMMVKDFFMTR 246

Query: 330 ------IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                     + L   A  +   ++   +   +   +  I K  
Sbjct: 247 KVDTAADLDEQTLTKIAEMTGGQYFRARDAEQLEKIYDTINKLE 290


>gi|268316013|ref|YP_003289732.1| von Willebrand factor type A [Rhodothermus marinus DSM 4252]
 gi|262333547|gb|ACY47344.1| von Willebrand factor type A [Rhodothermus marinus DSM 4252]
          Length = 329

 Score =  111 bits (278), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 35/223 (15%), Positives = 73/223 (32%), Gaps = 46/223 (20%)

Query: 170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229
              D+M+VLD+S SM +   S  ++ ++A ++    ++            + GLV F+ +
Sbjct: 86  EGRDLMLVLDLSSSMLAQDFS-PSRFEVARRTAIQFVQG-------RRADRIGLVVFAGQ 137

Query: 230 IEEFFLLEWGVSHLQRKIKYLS--KFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287
                        L   ++ L   +    T     +  A N                   
Sbjct: 138 AFTQVPPTLDYRFLLTMLQRLQVGRLEDGTAIGTAIATAIN-----------RLKNSEAR 186

Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIG--------------IRV---- 329
            K+I+ +TDG+N   + D   L     A++ G  +Y IG                     
Sbjct: 187 SKVIILLTDGQNNRGEID--PLTAAELARQAGIRIYTIGLSGRGEAPYPVQTPFGTRPQP 244

Query: 330 ---IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVT 367
                    +R  A  +   ++   +  ++   ++ I +   +
Sbjct: 245 VPVEIDEAMMREVAEKTGGRYFRATDARTLEAIYAEIDRLEKS 287


>gi|262381906|ref|ZP_06075044.1| conserved hypothetical protein [Bacteroides sp. 2_1_33B]
 gi|298375541|ref|ZP_06985498.1| BatA protein [Bacteroides sp. 3_1_19]
 gi|301310439|ref|ZP_07216378.1| BatA protein [Bacteroides sp. 20_3]
 gi|262297083|gb|EEY85013.1| conserved hypothetical protein [Bacteroides sp. 2_1_33B]
 gi|298268041|gb|EFI09697.1| BatA protein [Bacteroides sp. 3_1_19]
 gi|300832013|gb|EFK62644.1| BatA protein [Bacteroides sp. 20_3]
          Length = 328

 Score =  111 bits (278), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 40/224 (17%), Positives = 74/224 (33%), Gaps = 46/224 (20%)

Query: 170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229
             +D+M+ +D+S SM +       +++ A     + +       +       GLV FS +
Sbjct: 87  EGIDIMLAMDISGSMLAQDLK-PNRLEAAKDVAASFI-------NGRPNDNIGLVVFSAE 138

Query: 230 IEEFFLLEWGVSHLQRKIKYLSKFG--VSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287
                 L    + L    K +        T    GL  A ++I            +    
Sbjct: 139 SFTQCPLTTDHTVLLNLFKDIQSGMIQDGTAIGLGLANAVSRI-----------KDSHAK 187

Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV------------------ 329
            K+I+ +TDG N + +     +     AK  G  VY IG+                    
Sbjct: 188 SKVIILLTDGSNNAGEI--APVTAAEIAKTFGVRVYTIGVGTKGMAPYPFQTAFGVQYQN 245

Query: 330 ---IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                    L+  A  +   ++   +  S+ + +S I +   TK
Sbjct: 246 IPVEIDEATLKQIASTTGGQYFRATDNASLKEIYSEIDQMEKTK 289


>gi|90577284|ref|ZP_01233095.1| hypothetical protein VAS14_09574 [Vibrio angustum S14]
 gi|90440370|gb|EAS65550.1| hypothetical protein VAS14_09574 [Vibrio angustum S14]
          Length = 321

 Score =  111 bits (278), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 39/219 (17%), Positives = 75/219 (34%), Gaps = 47/219 (21%)

Query: 173 DMMIVLDVSRSMESFFD-----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFS 227
           DM++ +D+S SM           SI ++      ++  +E+           + GLV F+
Sbjct: 84  DMLLAVDLSGSMSIPDMVTKNGQSIDRLTAVKHVLSDFIEK-------RKGDRLGLVLFA 136

Query: 228 NKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDA 285
           +       L +    +++++    L   G ST    GL  A                   
Sbjct: 137 DHAYLQTPLTFDRKTVEQQLDRTVLGLIGQSTAIGEGLGIATKTFI-----------NSK 185

Query: 286 NYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR-------------- 331
             +++I+ ++DG N S   D   L     AK+ G  +Y +G+   +              
Sbjct: 186 APQRVIILLSDGANTSGVID--PLEAAKLAKESGVKIYTVGVGADQMVQQGFFGDRIVNP 243

Query: 332 ----SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKD 364
                 + L   A  +   ++   NP  +   +  I K 
Sbjct: 244 SQDLDEKTLTEIAKMTGGEYFRARNPQQLEKIYDIINKL 282


>gi|75675889|ref|YP_318310.1| hypothetical protein Nwi_1697 [Nitrobacter winogradskyi Nb-255]
 gi|74420759|gb|ABA04958.1| hypothetical protein Nwi_1697 [Nitrobacter winogradskyi Nb-255]
          Length = 605

 Score =  111 bits (278), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 29/236 (12%), Positives = 77/236 (32%), Gaps = 28/236 (11%)

Query: 3   SLNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAA 62
            +  +I  F  + +  +  + AI L  +   +G  ++ +     ++ + + +D +++  +
Sbjct: 9   RIRNSISRFDRDIRANIAPIFAIALLPVLGFVGAAVDYTRANAARSSMQAAMDSAVLMVS 68

Query: 63  TQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVP 122
                     ++          +I +     F      N   ND      S S       
Sbjct: 69  RDAAANPAMTSQ----------QITDAVQRYF------NSLYNDKSAFNVSVSAAYTPST 112

Query: 123 QNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSR 182
            +    I A  +  I   F            +    +S+   ++  ++R+ + +VLD + 
Sbjct: 113 SSAAAKILASGQGAIETDFM----KIAGFPQLSFGTSST---STWGNSRMRVALVLDNTG 165

Query: 183 SMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEW 238
           SM         K+    ++   M++ +       + V   ++ F+  +        
Sbjct: 166 SMRDNG-----KMAALQRAAKDMIDSLSAFAKTADDVYISIIPFAKDVNVDKSNYN 216



 Score = 62.9 bits (151), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 33/154 (21%), Positives = 60/154 (38%), Gaps = 16/154 (10%)

Query: 232 EFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQ-GMRQHCNTEDANYKKI 290
               +    S L+ +I  +S  G STN   GL + +  +             +   Y+  
Sbjct: 451 TITPVSSQSSTLKNQIDSMSPSG-STNQAIGLAWGWQTLSTTNGPFPAPAKDKAYVYQDY 509

Query: 291 IVFMTDGEN-----------LSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF---L 336
           +V ++DG N            S + D +    C + K  G +++ + + V         L
Sbjct: 510 LVLLSDGLNTRNRWSGNGSDHSPEVDVRQALLCQKVKDSGTVIFTVQVNVGNRDPLSQVL 569

Query: 337 RACASPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           + CAS  +F ++ + +   DAF +I   I   RI
Sbjct: 570 QDCASNGNFQMITSANQTADAFQNILTQISQLRI 603


>gi|325286051|ref|YP_004261841.1| von Willebrand factor type A [Cellulophaga lytica DSM 7489]
 gi|324321505|gb|ADY28970.1| von Willebrand factor type A [Cellulophaga lytica DSM 7489]
          Length = 332

 Score =  111 bits (278), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 36/241 (14%), Positives = 77/241 (31%), Gaps = 48/241 (19%)

Query: 154 IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
           +  P T  V   ++T   +D+++ +DVS SM +       ++    K     +++     
Sbjct: 73  LARPQTKDVSTRTKTTKGIDIVMAIDVSSSMLARDLK-PDRLTALKKVAADFIKK----- 126

Query: 214 DVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFG--VSTNSTPGLKYAYNQIF 271
                 + GLV ++ +      +    S +   ++ ++       T    GL  A N   
Sbjct: 127 --RPNDRIGLVAYAAESYTKTPITSDKSIVLSSLRQITHGQLEDGTAIGMGLATAVN--- 181

Query: 272 DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI- 330
                      +  +  K+I+ +TDG N S     +     + A +     Y IG+    
Sbjct: 182 --------RLKDSKSKSKVIILLTDGVNNSGFI--EPKTAADLAVEYKIKTYTIGLGTNG 231

Query: 331 ----------------------RSHEFLRACAS--PNSFYLVENPHSMYDAFSHIGKDIV 366
                                    + L   A+     ++   +   +   ++ I K   
Sbjct: 232 NALTPIAFNPDRTYRYGMRQVEIDEKLLEEIATVTGGQYFRATDNEKLSAIYNEINKLEK 291

Query: 367 T 367
           T
Sbjct: 292 T 292


>gi|83859216|ref|ZP_00952737.1| hypothetical protein OA2633_12465 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83852663|gb|EAP90516.1| hypothetical protein OA2633_12465 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 441

 Score =  111 bits (278), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 66/428 (15%), Positives = 142/428 (33%), Gaps = 66/428 (15%)

Query: 1   MFSLNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVH 60
           M SL   +R+F  + +G + ++ A+ L  + + +G  ++ S  F +   + S +D   + 
Sbjct: 20  MRSL---LRHFTQDVRGNVAMMFAMLLGPLVVSVGGALDYSRTFTIGAEIQSAMDAGTLA 76

Query: 61  AATQIMNEGNGNNRKKLKGGDILCR---IKNTWNMSFRNELRDNGFVNDIDDIVRSTSLD 117
           AA+ +    +     +      L     +    N+   ++L  N      D ++ S    
Sbjct: 77  AAS-LSQGEDPETIVRNYITAALSEHNGVLERLNVQVSSDLAINSREVTADAVI-SVPTL 134

Query: 118 IVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMI- 176
           ++ +   +  +++ +S     ++          S  +     ++++  ++    + M   
Sbjct: 135 MLGIIGYDALTLNRVSEANERVRNLEISLVLDISGSMSGSKITALRDAAEEFVGVMMDPD 194

Query: 177 -------------------------VLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKL 211
                                    ++  + +     +  ++       + N        
Sbjct: 195 LEGLTSLSVIPYNGGVRLPQTVTNDLVPGTPNDSGCLELGVSDPVTMDLAANGYDWLDWQ 254

Query: 212 IPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVS-----TNSTP-GLKY 265
             D      S      N+      LE   S L   I+ L   G +     T      L  
Sbjct: 255 DRDQRGWRSSAFCPEENEATV--FLEQTPSVLVNLIRDLDAGGNTGLDVATAWGARALDP 312

Query: 266 AYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGE---------NLSTKEDQQSLYYCNEAK 316
           A+          +    +D +  K++V MTDG          N         +Y  ++A+
Sbjct: 313 AWRGRLGGDFASRPAAYDDPSTMKVLVVMTDGAATAQIRRAQNWYGDWYSYEIYSASQAR 372

Query: 317 KR-----------GAIVYAIGIRVIR--SHEFLRACAS-PNSFYLVENPHSMYDAFSHIG 362
                        G  +Y I  +V    +   +R CAS P ++Y VEN   +  AF+ I 
Sbjct: 373 DNMADACDAAEAEGVHIYTIAFQVSGSTNRNLMRDCASRPENYYAVENLD-ISAAFNSIA 431

Query: 363 KDIVTKRI 370
            D+   R+
Sbjct: 432 ADLNNLRL 439


>gi|153835956|ref|ZP_01988623.1| von Willebrand factor, type A [Vibrio parahaemolyticus AQ3810]
 gi|260880154|ref|ZP_05892509.1| von Willebrand factor type A [Vibrio parahaemolyticus AN-5034]
 gi|260895271|ref|ZP_05903767.1| von Willebrand factor type A [Vibrio parahaemolyticus Peru-466]
 gi|260900622|ref|ZP_05909017.1| von Willebrand factor type A [Vibrio parahaemolyticus AQ4037]
 gi|149750710|gb|EDM61455.1| von Willebrand factor, type A [Vibrio parahaemolyticus AQ3810]
 gi|308085798|gb|EFO35493.1| von Willebrand factor type A [Vibrio parahaemolyticus Peru-466]
 gi|308091801|gb|EFO41496.1| von Willebrand factor type A [Vibrio parahaemolyticus AN-5034]
 gi|308107055|gb|EFO44595.1| von Willebrand factor type A [Vibrio parahaemolyticus AQ4037]
          Length = 334

 Score =  111 bits (277), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 31/224 (13%), Positives = 71/224 (31%), Gaps = 46/224 (20%)

Query: 168 TDARLDMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGL 223
                D+M+V+D+S SM+    +     I ++    K ++  + +           + G+
Sbjct: 93  QPKYRDLMLVVDLSGSMQKEDMNLDGEYIDRLSAVKKVLSDFVAK-------RKGDRLGV 145

Query: 224 VTFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCN 281
           V F +       L      + ++IK   +   G  T    G+                  
Sbjct: 146 VLFGDHAYLQTPLTADRQTVIQQIKQTVIGLVGQRTAIGDGIGLGTKTFV---------- 195

Query: 282 TEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV------------ 329
            +    +++++ ++DG N +       +     AKK  A +Y +G+              
Sbjct: 196 -DSDAPQRVMILLSDGSNTAG--VLDPIEAAEIAKKYNATIYTVGVGAGEMMVKDFFMTR 252

Query: 330 ------IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                     + L   A  +   ++   +   +   +  I K  
Sbjct: 253 KVDTAADLDEQTLTKIAEMTGGQYFRARDAEQLEKIYDTINKLE 296


>gi|283782262|ref|YP_003373017.1| von Willebrand factor type A [Pirellula staleyi DSM 6068]
 gi|283440715|gb|ADB19157.1| von Willebrand factor type A [Pirellula staleyi DSM 6068]
          Length = 395

 Score =  111 bits (277), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 48/391 (12%), Positives = 121/391 (30%), Gaps = 63/391 (16%)

Query: 15  YKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIM-NEGNGNN 73
            +G M +L A  L ++  +    I+VS++  +++ L +  D +       +   +G+  +
Sbjct: 16  RRGAMLVLIAFLLVVVVCMAAFAIDVSYMQLVRSELRAATDAAAKAGTLALAKTDGDAAS 75

Query: 74  RKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIV--VVPQNEGYSISA 131
            +                +    +    G      +   S + +       +       +
Sbjct: 76  ARTAAIQAAARNKVAGRALVLTTDQVQVGRSAAQANGTWSFTANQTPYTSVKILSSMSDS 135

Query: 132 ISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFF--- 188
            +   +PL   TF+   +             +  + +    ++ +V+D S SM       
Sbjct: 136 TAAGSVPLFLGTFMGRGSFQP---------AQSATASQMEQEICLVIDRSHSMCFNMSGV 186

Query: 189 -------------------DSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229
                               +++++      S+N  ++ +    +   V      +    
Sbjct: 187 EWSYPPGTKTTPHTICYPPHATLSRWAALQSSVNLFMDTILETNNTPRVALITWGSTIGT 246

Query: 230 IEEFFLLE--------------WGVSHLQRKIKYLSKFG--VSTNSTPGLKYAYNQIFDM 273
               +                    + ++ KI   +       TN + G+      +   
Sbjct: 247 NTAEYSYTKKTEVAVANELGLSTDYAAVKSKIAARTTKVMLGGTNMSAGIDAGRTLL--- 303

Query: 274 QGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSH 333
                + NT  A  KK ++ MTDG+    ++    +    +A   G  ++ I      + 
Sbjct: 304 -----NGNTVRALAKKTMILMTDGQWNQGRD---PIDAAEDAADEGIQIHTITFLSGSAQ 355

Query: 334 EFLRACA--SPNSFYLVENPHSMYDAFSHIG 362
             +R  A  +   +Y+  N   + +AF  + 
Sbjct: 356 NTMRQVAEITGGKYYVSSNQAELEEAFRDLA 386


>gi|294673502|ref|YP_003574118.1| BatA protein [Prevotella ruminicola 23]
 gi|294472594|gb|ADE81983.1| putative BatA protein [Prevotella ruminicola 23]
          Length = 332

 Score =  111 bits (277), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 40/262 (15%), Positives = 80/262 (30%), Gaps = 51/262 (19%)

Query: 137 IPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKID 196
           +PL     +  +     ++    +    +S+T   +D+M+ +DVS SM +       +I+
Sbjct: 53  MPLSMLLRLLVFVMIVMVLARPQTRNSWDSKTVEGIDIMLAMDVSTSMLAEDL-RPNRIE 111

Query: 197 MAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFG-- 254
            A +  +  +               GL  F+ +      +    + L   ++ +      
Sbjct: 112 AAKQVASEFIIG-------RPNDNIGLAIFAGESFTQCPMTTDHASLLNLLQNVRTDIAA 164

Query: 255 -----VSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSL 309
                  T    GL  A +              +     K+++ +TDG N        + 
Sbjct: 165 RGLIEDGTAIGMGLANAVS-----------RLKDSKAKSKVVILLTDGSNNRGDISPST- 212

Query: 310 YYCNEAKKRGAIVYAIGIRVI---------------------RSHEFLRACA--SPNSFY 346
                AK  G  VY IG+                           + L   A  +   FY
Sbjct: 213 -AAEIAKSLGIRVYTIGVGTNKVAPYPMPVAGGVQYVNVPVEIDTKTLSEIASITEGDFY 271

Query: 347 LVENPHSMYDAFSHIGKDIVTK 368
              N + +   +  I +   +K
Sbjct: 272 RATNTNELRKIYKEIDQLEKSK 293


>gi|269105138|ref|ZP_06157832.1| protein TadG associated with Flp pilus assembly [Photobacterium
           damselae subsp. damselae CIP 102761]
 gi|268160588|gb|EEZ39087.1| protein TadG associated with Flp pilus assembly [Photobacterium
           damselae subsp. damselae CIP 102761]
          Length = 436

 Score =  111 bits (277), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 48/440 (10%), Positives = 113/440 (25%), Gaps = 83/440 (18%)

Query: 9   RNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAAT--QIM 66
                  +G  +IL AI +P++F +  +  + +     K  +    + + +  A      
Sbjct: 1   MKLKKAQQGHASILFAIMIPVLFGIFTLASDGARAIQTKARIEDATEAASLAIAAHNDPN 60

Query: 67  NEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEG 126
              +G          I       +     +      +  + +DI   +S       +   
Sbjct: 61  VNSDGLGSGSKVNRRIATDYLKAYITDIDSISSLKIYRRNCEDIPECSSGLNKGKSRFFE 120

Query: 127 YSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMES 186
           Y + A++           I  + +                     +D++   D S+SME 
Sbjct: 121 YEVEALTTQNSWFPGNNVISGFGD----TFSTRGHSLARKYQSEAVDVVFAADFSKSMEE 176

Query: 187 FFDSSITKIDMAIKSINAM-----LEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWG-- 239
            +     K    ++ IN +           I D  N    G+  +++     F       
Sbjct: 177 PWTGGRQKYKDLVRVINDVTSELEKFNNINIADKKNQNTIGISPYNSNTYSKFDNYNSCF 236

Query: 240 -----------------VSHLQRKIKYLSKFGVS-------------------TNSTPGL 263
                               ++R +  +     +                   TN     
Sbjct: 237 MKQDYFEKNSRDHRKKKYVDIKRTLNNIFIEKGNDSCGFKSDDPDAVFHDIYLTNDFDTF 296

Query: 264 KYAYNQIFDMQG--------MRQHCNTEDANYKKIIVFMTDGENLSTKED---QQSLYYC 312
                +     G               +  N +++++ ++DG +         +      
Sbjct: 297 NKEIRKFRPGNGTASCQGIIRSAQMLRKGTNSRRLLIIISDGNDWYYPYSGYKETDKEIA 356

Query: 313 NEAKKRGA---------------------IVYAIGIRVIRSHE-FLRACASPNSFYLVEN 350
           N+    G                       +  IG     +    L  CA  ++ +  + 
Sbjct: 357 NKLVNAGMCNKIRETLNLDKTPSGQEIKTRIAVIGFDYDANKNKALLNCAGEDNVFKAQY 416

Query: 351 PHS-MYDAFSHIGKDIVTKR 369
               +    S I ++I   +
Sbjct: 417 RDELLDQILSLITEEIGHLK 436


>gi|116249091|ref|YP_764932.1| putative transmembrane protein [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115253741|emb|CAK12134.1| putative transmembrane protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 465

 Score =  111 bits (277), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 32/321 (9%), Positives = 106/321 (33%), Gaps = 15/321 (4%)

Query: 3   SLNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAA 62
            +    R    +  G + I+ A+ L  + + +G   +    + ++  + S +D +L+ A 
Sbjct: 23  RVFKAFRGLGRDRGGNVAIVVALTLVPMIVAVGASFDYIRTYNVRQRMQSDLDTALIAAV 82

Query: 63  TQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVP 122
            +I +  + +  K+        +++N++ +   +    N  +        +    ++ + 
Sbjct: 83  KEI-DTDDTDALKEKVADWFHAQVENSYTLGDIDIDTSNHKITATASG--TVPTTLMKIA 139

Query: 123 QNEGYSISAISRYKIP-LKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVS 181
             +   +S  S  K P   +         S  +++  T++ +    +            +
Sbjct: 140 NIDTVDVSVASAVKGPATSYLNVYIVIDTSPSMLLAATTAGQSAMYSGIGCQFACHTGDA 199

Query: 182 RSMESFFDSSITKIDMAI----------KSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
            ++     ++  +   A            ++  +L+ +      +  ++ GL +  + + 
Sbjct: 200 HTVGKTKYANNYEYSAAKTIKLRADVAGDAVRDVLDMIDDSDSNHQRIKVGLYSLGDTLT 259

Query: 232 EFFLLEWGVSHLQRKIKYLSKF-GVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKI 290
           E           + ++   S     +T+               +       T   +  K+
Sbjct: 260 EVLTPTLSTDTARNRLADASYGLTSATSKAATYFDVSLATLKQKVGTGGDGTSSGSPLKL 319

Query: 291 IVFMTDGENLSTKEDQQSLYY 311
           ++ +TDG     +     + +
Sbjct: 320 VLLLTDGVQSQREWVTDKVTW 340


>gi|89072369|ref|ZP_01158948.1| hypothetical protein SKA34_06335 [Photobacterium sp. SKA34]
 gi|89051901|gb|EAR57353.1| hypothetical protein SKA34_06335 [Photobacterium sp. SKA34]
          Length = 321

 Score =  111 bits (277), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 38/219 (17%), Positives = 75/219 (34%), Gaps = 47/219 (21%)

Query: 173 DMMIVLDVSRSMESFFD-----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFS 227
           DM++ +D+S SM           S+ ++      ++  +E+           + GLV F+
Sbjct: 84  DMLLAVDLSGSMSIPDMVTKNGQSVDRLTAVKHVLSDFIEK-------RKGDRLGLVLFA 136

Query: 228 NKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDA 285
           +       L +    +++++    L   G ST    GL  A                   
Sbjct: 137 DHAYLQTPLTFDRKTVEKQLDRTVLGLIGQSTAIGEGLGIATKTFI-----------NSK 185

Query: 286 NYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR-------------- 331
             +++I+ ++DG N S   D   L     AK+ G  +Y +G+   +              
Sbjct: 186 APQRVIILLSDGANTSGVID--PLEAAKLAKESGVKIYTVGVGADQMVQQGFFGDRIVNP 243

Query: 332 ----SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKD 364
                 + L   A  +   ++   NP  +   +  I K 
Sbjct: 244 SQDLDEKTLTDIAKMTGGEYFRARNPQQLEKIYDIINKL 282


>gi|269962784|ref|ZP_06177125.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269832474|gb|EEZ86592.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 353

 Score =  111 bits (277), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 31/224 (13%), Positives = 71/224 (31%), Gaps = 46/224 (20%)

Query: 168 TDARLDMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGL 223
                DMM+V+D+S SM+    +     I ++    + ++  +E+           + G+
Sbjct: 112 QPKYRDMMLVVDLSGSMQKEDMNDNGEYIDRLTTVKRVLSDFVEK-------RQGDRLGV 164

Query: 224 VTFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCN 281
           V F +       L      + ++I    +   G  T    G+                  
Sbjct: 165 VLFGDHAYLQTPLTADRKTVMQQINQTVIGLVGQRTAIGDGIGLGTKTFV---------- 214

Query: 282 TEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR------------- 328
            +    +++++ ++DG N +       L     AKK  A +Y +G+              
Sbjct: 215 -DSDAPQRVMILLSDGSNTAG--VLDPLEAAEIAKKYNATIYTVGVGAGEMMVKDFFMTR 271

Query: 329 -----VIRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                     + L   A  +   ++   +   +   +  I +  
Sbjct: 272 KVNTASDLDEQTLTKIAEMTGGKYFRARDAKELETIYDTINQLE 315


>gi|303235701|ref|ZP_07322308.1| von Willebrand factor type A domain protein [Prevotella disiens
           FB035-09AN]
 gi|302484148|gb|EFL47136.1| von Willebrand factor type A domain protein [Prevotella disiens
           FB035-09AN]
          Length = 322

 Score =  111 bits (277), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 39/219 (17%), Positives = 74/219 (33%), Gaps = 41/219 (18%)

Query: 170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229
             +++M+ +D+S SM S       +I++A       +               GL  F+ +
Sbjct: 86  EGINIMLAVDISASMLSDDVD-PNRIEVAKDVAKEFIAS-------RPNDNIGLTIFAGE 137

Query: 230 IEEFFLLEWGVSHLQRKIKYLSKF-------GVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
                 +    + L   +  +             T    GL  A  ++ D++        
Sbjct: 138 AFTQCPMTTDHASLLNLLAGIRADLSVNHLIQDGTAIGMGLANAVGRLKDVKEGS----- 192

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI-----------R 331
                 K+++ +TDG N     D   L   + A+K G  VY IG+               
Sbjct: 193 ------KVVILLTDGSNNVG--DISPLTAASIARKFGVRVYTIGLGTDGKDIQGRPVGEI 244

Query: 332 SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
            ++ L+  A  +   FY  ++   +   +  I K   TK
Sbjct: 245 DYKTLQDIAMQTDGEFYRAQSRAELSQIYKDIDKLEKTK 283


>gi|86749514|ref|YP_486010.1| hypothetical protein RPB_2394 [Rhodopseudomonas palustris HaA2]
 gi|86572542|gb|ABD07099.1| conserved hypothetical protein [Rhodopseudomonas palustris HaA2]
          Length = 456

 Score =  111 bits (277), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 32/306 (10%), Positives = 82/306 (26%), Gaps = 39/306 (12%)

Query: 9   RNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNE 68
             F     G + I+ AI L  +   +G  I+ S     +T + + +D + +  +  + + 
Sbjct: 15  SRFVKTDGGNVAIIFAIALLPMIGFIGAAIDYSRANKARTSMQAALDSAALMVSKDLASG 74

Query: 69  GNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYS 128
                +   K                          N+ +    + +            +
Sbjct: 75  VITAGQVSAKAQSYFAS-----------------LYNNTEAPNITVTATYTAKDSTGSST 117

Query: 129 ISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFF 188
           +       I  +F            + +    S    +    RL + I LDV+ SM S  
Sbjct: 118 VLLKGTGDISTEFMN----MFGFPTLGI---GSAATATWGGTRLRVAIALDVTGSMASAG 170

Query: 189 DSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIK 248
                K+     +   +++ ++      + +   ++ F+  +      +   +   +   
Sbjct: 171 -----KMPAMQSAAKTLVDNLRANAQTADDLYISIIPFAQMVNVGKSNKN--ASWIKW-- 221

Query: 249 YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQS 308
               +  +T    G    +                  N  +    +TD +  +       
Sbjct: 222 --DYWEDTT----GSCNWWWLTTKSSCESAGRTWSSTNQSQWGGCVTDRDQPADTTKDAP 275

Query: 309 LYYCNE 314
                 
Sbjct: 276 TTAATR 281


>gi|269965331|ref|ZP_06179451.1| hypothetical protein VMC_08810 [Vibrio alginolyticus 40B]
 gi|269829977|gb|EEZ84206.1| hypothetical protein VMC_08810 [Vibrio alginolyticus 40B]
          Length = 334

 Score =  111 bits (277), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 29/224 (12%), Positives = 70/224 (31%), Gaps = 46/224 (20%)

Query: 168 TDARLDMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGL 223
                D+M+V+D+S SM+          I ++    + ++  + +           + G+
Sbjct: 93  QPKYRDLMLVVDLSGSMQQEDMELNGEYIDRLTAVKQVLSDFVAK-------RKGDRLGV 145

Query: 224 VTFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCN 281
           V F +       L      + ++I    +   G  T    G+                  
Sbjct: 146 VLFGDHAYLQTPLTADRKSVMQQINQTVIGLVGQRTAIGDGIGLGTKTFV---------- 195

Query: 282 TEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV------------ 329
            +    +++++ ++DG N +     + L     AKK  A +Y +G+              
Sbjct: 196 -DSDAPQRVMILLSDGSNTAG--VLEPLEAAEIAKKYNATIYTVGVGAGEMMVKEFFMTR 252

Query: 330 ------IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                     + L   A  +   ++   +   +   +  I +  
Sbjct: 253 KVNTAADLDEQTLTKVAEVTGGQYFRARDTEELEKIYDTINQLE 296


>gi|312621090|ref|YP_003993818.1| protein tadg, associated with flp pilus assembly [Photobacterium
           damselae subsp. damselae]
 gi|311872811|emb|CBX86902.1| Protein TadG, associated with Flp pilus assembly [Photobacterium
           damselae subsp. damselae]
          Length = 436

 Score =  111 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 48/440 (10%), Positives = 114/440 (25%), Gaps = 83/440 (18%)

Query: 9   RNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAAT--QIM 66
                  +G  +IL AI +P++F +  +  + +     K  +    + + +  A      
Sbjct: 1   MKLKKAQQGHASILFAIMIPVLFGIFTLASDGARAIQTKARIEDATEAASLAIAAHNDPN 60

Query: 67  NEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEG 126
              +G          I       +     +      +  + +DI   +S       +   
Sbjct: 61  VNSDGLGSGSKVNRRIATDYLKAYITDIDSISSLKIYRRNCEDIPECSSGLNKGKSRFFE 120

Query: 127 YSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMES 186
           Y + A++           I  + +                     +D++   D S+SME 
Sbjct: 121 YEVEALTTQNSWFPGNNVISGFGD----TFSTRGHSLARKYQSEAVDVVFAADFSKSMEE 176

Query: 187 FFDSSITKIDMAIKSINAM-----LEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWG-- 239
            +     K    ++ IN +           I D  N    G+  +++     F       
Sbjct: 177 PWTGGRQKYKDLVRVINDVTSELEKFNNINIADKKNQNTIGISPYNSNTYSKFDNYNSCF 236

Query: 240 -----------------VSHLQRKIKYLSKFGVS-------------------TNSTPGL 263
                               ++R +  +     +                   TN     
Sbjct: 237 MKQDYFEKNSRDHRKKKYVDIKRTLNNIFIEKGNDSCGFKSDDPDAVFHDIYLTNDFDTF 296

Query: 264 KYAYNQIFDMQGMRQHCN--------TEDANYKKIIVFMTDGENLSTKED---QQSLYYC 312
                +     G   +           +  N +++++ ++DG +         +      
Sbjct: 297 NKEIMKFRPGNGTASYQGIIRSAQMLRKGTNSRRLLIIISDGNDWYYPYSGYKETDKEIA 356

Query: 313 NEAKKRGA---------------------IVYAIGIRVIRSHE-FLRACASPNSFYLVEN 350
           N+    G                       +  IG     +    L  CA  ++ +  + 
Sbjct: 357 NKLVNAGMCNKIRETLNLDKTPSGQEIKTRIAVIGFDYDANKNKALLNCAGEDNVFKAQY 416

Query: 351 PHS-MYDAFSHIGKDIVTKR 369
               +    S I ++I   +
Sbjct: 417 RDELLDQILSLITEEIGHLK 436


>gi|27367909|ref|NP_763436.1| aerotolerance operon protein BatA [Vibrio vulnificus CMCP6]
 gi|27359482|gb|AAO08426.1| BatA (Bacteroides aerotolerance operon) [Vibrio vulnificus CMCP6]
          Length = 323

 Score =  111 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 35/219 (15%), Positives = 71/219 (32%), Gaps = 46/219 (21%)

Query: 173 DMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
           D+M+V+D+S SM+          I ++      +   +E+           + GLV F++
Sbjct: 87  DLMLVVDLSGSMQQADILQDGDYIDRLSAVKNVVTQFIEQ-------RQGDRLGLVLFAD 139

Query: 229 KIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
                  L      +  ++    +   G  T    GL  A                +   
Sbjct: 140 HAYLQTPLTADRQTVANQLNQTIIGLIGQKTAIGDGLALATKTFV-----------DSEA 188

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR------------------ 328
            +++++ ++DG N +   D   +   N AKK G  +Y IGI                   
Sbjct: 189 PQRVVILLSDGSNTAGTLD--PIEAANIAKKYGVKIYTIGIGAGEMEVKQFFMTRKVNTS 246

Query: 329 VIRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                + L   A  +   ++   +   +   +  I +  
Sbjct: 247 ADLDEKTLTKVATMTGGQYFRARDAQELQTIYQAINQLE 285


>gi|218261917|ref|ZP_03476585.1| hypothetical protein PRABACTJOHN_02256 [Parabacteroides johnsonii
           DSM 18315]
 gi|218223693|gb|EEC96343.1| hypothetical protein PRABACTJOHN_02256 [Parabacteroides johnsonii
           DSM 18315]
          Length = 328

 Score =  111 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 40/234 (17%), Positives = 78/234 (33%), Gaps = 46/234 (19%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           S+    + +   +D+++ +D+S SM +       +++ +    +A +       +     
Sbjct: 77  STNSWQNSSTEGIDIVLAMDISTSMMAQDLK-PNRLEASKDVASAFI-------NGRPND 128

Query: 220 QSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSK--FGVSTNSTPGLKYAYNQIFDMQGMR 277
             GLV F+ +      L    + L    K +        T    GL  A ++I       
Sbjct: 129 NIGLVVFAAESFTQCPLTTDHTVLLNLFKDVQPGIIQDGTAIGLGLANAVSRI------- 181

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV-------- 329
                +     K+I+ +TDG N   +     +     AK  G  VY IG+          
Sbjct: 182 ----KDSQAKSKVIILLTDGVNNQGEI--APVTAAEIAKTFGVRVYTIGVGTQGKAPYPF 235

Query: 330 -------------IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                              L+  A  +   ++   +  S+ + +S I K   TK
Sbjct: 236 QTAFGVQYMDVDVEIDEPTLKQIAATTGGQYFRATDNASLKEIYSEIDKMEKTK 289


>gi|85859126|ref|YP_461328.1| von Willebrand factor type A domain-containing protein [Syntrophus
           aciditrophicus SB]
 gi|85722217|gb|ABC77160.1| von Willebrand factor type A domain protein [Syntrophus
           aciditrophicus SB]
          Length = 447

 Score =  111 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 45/439 (10%), Positives = 97/439 (22%), Gaps = 85/439 (19%)

Query: 12  FYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNG 71
             N KG + I+ A+ L ++     + ++V   +  ++ L   +D   +  A  I N   G
Sbjct: 5   IKNQKGAVLIIFALLLIVLLGFTALAVDVGRWYTTRSELSKSVDAGAIAGAKNISNPYLG 64

Query: 72  NNRKKLKGGDILCRI--KNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEG--- 126
            +       ++                E          +D        +       G   
Sbjct: 65  EDGHLRLAEEVARENFSAGYLMTPDSGERSATFTAYADEDHRIRVEGTVSSPGNLAGLFG 124

Query: 127 ------------------YSISAISRYKIPLKFCTFIPW----YTNSRHIVMPITSSVKV 164
                               +       +       +      + +             V
Sbjct: 125 VDWVATSAMGVAKKNEVEIMLVLDRSGSMDGTPMNDLKKAARSFVSFFEETQDQDKMGLV 184

Query: 165 NSQTDARLDM-----MIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           +  T  ++D+      +    S+        +    D   ++ N     +     V    
Sbjct: 185 SFATSVKVDVPLGNNYVSSMTSKINAMDAVGATNAEDSLSQAGNPAKGGLTDQSGVPGNK 244

Query: 220 QSG-LVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVS------TNSTPGLKYAYNQIFD 272
           +    V F +             +    I  +     +      T      +  +     
Sbjct: 245 RVQQFVIFFSDGNPTAFRGKFKYNGTDNIDAVVCGTGNDCGTVYTKLGKPEREEWLSYNP 304

Query: 273 MQGMRQHCNTEDANYKKII-------------VFMTDGE-----------------NLST 302
                           K                 + D +                     
Sbjct: 305 RFTGDGKPKPPGTGTSKCTTRYGGSYVNTTKWYVLDDPDYRLTYRGTTYNSESCFIPTVG 364

Query: 303 KEDQQS--------------LYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSF-YL 347
             +  +              + +  E K     +Y IG+      +FL   AS  SF + 
Sbjct: 365 SSNTTAPLSTYICTTARGMAVEHAQELKDNNVKIYTIGLG-NIDRDFLSQIASGPSFEFY 423

Query: 348 VENPHSMYDAFSHIGKDIV 366
                 +   F+ I KDI 
Sbjct: 424 APTSGELQAIFNKIAKDIK 442


>gi|262191198|ref|ZP_06049398.1| protein BatA [Vibrio cholerae CT 5369-93]
 gi|262032938|gb|EEY51476.1| protein BatA [Vibrio cholerae CT 5369-93]
          Length = 477

 Score =  111 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 29/219 (13%), Positives = 71/219 (32%), Gaps = 46/219 (21%)

Query: 173 DMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
           D+M+V+D+S SM           + ++    + ++  + +           + GL+ F++
Sbjct: 244 DLMLVVDLSYSMSQEDMQSGQQMVDRLTAVKQVLSEFIAK-------REGDRIGLILFAD 296

Query: 229 KIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
                  L      +  ++    L   G  T    G+  A                +   
Sbjct: 297 HAYLQTPLTLDRQTVANQLNQAVLKLIGTQTAIGEGIGLATKTFI-----------DSDA 345

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV----------------- 329
            +++++ ++DG N +       L   N AK+    +Y +G+                   
Sbjct: 346 PQRVMILLSDGSNTAG--VLDPLEAANIAKQYHTTIYTVGVGAGEMVVKDFLFSRKVNTA 403

Query: 330 -IRSHEFLRACAS--PNSFYLVENPHSMYDAFSHIGKDI 365
                + L+  A+     ++   N   + + +  I +  
Sbjct: 404 QDLDEKTLQTIATTTGGHYFRARNQQDLQNIYDTINQLE 442


>gi|154492261|ref|ZP_02031887.1| hypothetical protein PARMER_01895 [Parabacteroides merdae ATCC
           43184]
 gi|154087486|gb|EDN86531.1| hypothetical protein PARMER_01895 [Parabacteroides merdae ATCC
           43184]
          Length = 328

 Score =  111 bits (276), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 40/234 (17%), Positives = 78/234 (33%), Gaps = 46/234 (19%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           S+    + +   +D+++ +D+S SM +       +++ +    +A +       +     
Sbjct: 77  STNSWQNSSTEGIDIVLAMDISTSMMAQDLK-PNRLEASKDVASAFI-------NGRPND 128

Query: 220 QSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSK--FGVSTNSTPGLKYAYNQIFDMQGMR 277
             GLV F+ +      L    + L    K +        T    GL  A ++I       
Sbjct: 129 NIGLVVFAAESFTQCPLTTDHTVLLNLFKDVQPGIIQDGTAIGLGLANAVSRI------- 181

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV-------- 329
                +     K+I+ +TDG N   +     +     AK  G  VY IG+          
Sbjct: 182 ----KDSQAKSKVIILLTDGVNNQGEI--APVTAAEIAKTFGVRVYTIGVGTQGKAPYPF 235

Query: 330 -------------IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                              L+  A  +   ++   +  S+ + +S I K   TK
Sbjct: 236 QTAFGVQYMDVDVEIDEPTLKQIAATTGGQYFRATDNASLKEIYSEIDKMEKTK 289


>gi|328469247|gb|EGF40193.1| hypothetical protein VP10329_10201 [Vibrio parahaemolyticus 10329]
          Length = 334

 Score =  111 bits (276), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 31/224 (13%), Positives = 72/224 (32%), Gaps = 46/224 (20%)

Query: 168 TDARLDMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGL 223
                D+M+V+D+S SM+    +     I ++    K ++  + +           + G+
Sbjct: 93  QPKYRDLMLVVDLSGSMQKEDMNLDGEYIDRLSAVKKVLSDFVAK-------RKGDRLGV 145

Query: 224 VTFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCN 281
           V F +       L      + ++IK   +   G  T    G+                  
Sbjct: 146 VLFGDHAYLQTPLTADRQTVIQQIKQTVIGLVGQRTAIGDGIGLGTKTFV---------- 195

Query: 282 TEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV------------ 329
            +    +++++ ++DG N +       +     AKK  A +Y +G+              
Sbjct: 196 -DSDAPQRVMILLSDGSNTAG--VLDPIEAAEIAKKYNATIYTVGVGAGEMMVKDFFMTR 252

Query: 330 ------IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                     + L   A  +   ++   +   +   ++ I K  
Sbjct: 253 KVDTAADLDEQTLTKIAEMTGGQYFRARDAEQLEKIYNTINKLE 296


>gi|313203640|ref|YP_004042297.1| von willebrand factor type a [Paludibacter propionicigenes WB4]
 gi|312442956|gb|ADQ79312.1| von Willebrand factor type A [Paludibacter propionicigenes WB4]
          Length = 327

 Score =  111 bits (276), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 41/237 (17%), Positives = 76/237 (32%), Gaps = 46/237 (19%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           +S    +Q    +D+M+ LD+S +M +      T+++ A       +             
Sbjct: 76  ASNSWRTQNTEGIDIMMALDISSTMLAGDIK-PTRLEAAKSVATEFILS-------RPND 127

Query: 220 QSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFG--VSTNSTPGLKYAYNQIFDMQGMR 277
             GLV F+ +      L    + L      ++       T    GL  A N+I       
Sbjct: 128 NIGLVIFARESFTQCPLTTDHAVLVNLFNGVNNGMIEDGTAIGLGLANAVNRI------- 180

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV-------- 329
                +  +  K+I+ +TDG N S   D   +     AK  G  +Y IG+          
Sbjct: 181 ----KDGKSKSKVIILLTDGSNNSG--DIAPITAAEIAKTFGIRIYTIGVGTHGVINIPV 234

Query: 330 -------------IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKRIW 371
                            + L   A  +   ++   +   + + +  I K   T+   
Sbjct: 235 STPMGIQYQRVQSEFDAKSLENIANLTGGKYFGATDNSKLRNIYQEIDKLEKTRIKI 291


>gi|327313515|ref|YP_004328952.1| von Willebrand factor type A domain-containing protein [Prevotella
           denticola F0289]
 gi|326945266|gb|AEA21151.1| von Willebrand factor type A domain protein [Prevotella denticola
           F0289]
          Length = 318

 Score =  110 bits (275), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 37/218 (16%), Positives = 70/218 (32%), Gaps = 37/218 (16%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
           +    +D+M+ +DVS SM +       ++ +A +  +  +               GL  F
Sbjct: 83  KDTEGIDIMLTMDVSASMLTED-VYPNRMVVAKEVASEFISG-------RPNDNIGLTIF 134

Query: 227 SNKIEEFFLLEWGVSHLQRKIKYLSK-------FGVSTNSTPGLKYAYNQIFDMQGMRQH 279
           + +      +    + L   +  +             T    GL  A +           
Sbjct: 135 AGEAFTQCPMTLDHAALLNLLHGVRTDLVTSGLMQDGTAIGMGLANAVS----------- 183

Query: 280 CNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHE----- 334
              +     KI++ +TDG N +       +     A+K G  +Y IG       E     
Sbjct: 184 RLKDSKAKSKIVILLTDGSNNAGSIS--PMTAAAIARKFGIRIYTIGFGKETGEEIGAID 241

Query: 335 --FLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
              L+  A  +   FY  ++   +   +  I K   TK
Sbjct: 242 YKTLQDIAVSTNGEFYRAQSQAELSRIYQDIDKLEKTK 279


>gi|188994393|ref|YP_001928645.1| aerotolerance-related membrane protein BatA [Porphyromonas
           gingivalis ATCC 33277]
 gi|188594073|dbj|BAG33048.1| aerotolerance-related membrane protein BatA [Porphyromonas
           gingivalis ATCC 33277]
          Length = 327

 Score =  110 bits (275), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 35/224 (15%), Positives = 72/224 (32%), Gaps = 46/224 (20%)

Query: 170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229
             +D+M+ +DVS SM++       +++ A     + +       +       G+VTF+ +
Sbjct: 86  EGIDIMLAMDVSGSMQAMDFK-PNRLEAAKDVAISFI-------NNRPNDNIGMVTFAGE 137

Query: 230 IEEFFLLEWGVSHLQRKIKYLSKFG--VSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287
                 L    + L   ++ L        T    GL  A N              +    
Sbjct: 138 SFTQCPLTTDHTVLLNMVQDLQMGVLDDGTAIGMGLATAVN-----------RLKDSKAK 186

Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV------------------ 329
            ++++ +TDG N       +     + A+  G  VY +G+                    
Sbjct: 187 SRVVILLTDGSNNMGDITPRM--AADIARTFGIRVYTVGVGTRGEAPFPIQTEFGVRIQN 244

Query: 330 ---IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                    L   A  S   ++   +  ++ + +  I K   T+
Sbjct: 245 VPVDIDEPTLDGIAEVSGGKYFRAVDNETLNEIYKEIDKLEKTR 288


>gi|209809179|ref|YP_002264717.1| membrane associated secretion system protein [Aliivibrio
           salmonicida LFI1238]
 gi|208010741|emb|CAQ81132.1| membrane associated secretion system protein [Aliivibrio
           salmonicida LFI1238]
          Length = 422

 Score =  110 bits (275), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 49/426 (11%), Positives = 109/426 (25%), Gaps = 69/426 (16%)

Query: 9   RNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAAT--QIM 66
                + KG   IL A+ +P +F +  +  + +     K  +    + + +  +      
Sbjct: 1   MKLRRHQKGHAAILFAMMIPALFGIFTLASDGARAIQTKARIEDAAEVATLAVSAHNDPN 60

Query: 67  NEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEG 126
            +  G          I+    N +     +      +  + ++I    +   V  P+   
Sbjct: 61  QDYGGGGSPSSANQQIVTDYINAYISDVDSINEIKVYKRNCEEIPECKAGLAVGEPRYFE 120

Query: 127 YSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMES 186
           + +   +  K        I    +S       +            +D+M   D S SM  
Sbjct: 121 HEVGVTTSQKSWFPGNDAIVGMGDS----FSTSGHSLARKYQSEAVDVMFAADFSGSMGD 176

Query: 187 FFDSSITKIDMA--------IKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEW 238
            +     K +           +       E     +   +      T+S           
Sbjct: 177 RWTGGNKKYEDLIDIIDSISKELQKFNDLEHNDNDNTMGITAYNEYTYSQYSGSSGGWWG 236

Query: 239 GVSHLQRK--------------IKYL-------------------------SKFGVSTNS 259
              +L +               I  L                         +   V+ + 
Sbjct: 237 DDCYLSQAESDGFWGGVSISKTIDGLWNEKSKDHCNNSYNSGRFNDIPLTSNFDVVNQDV 296

Query: 260 TPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTK------------EDQQ 307
           +          +          T   N +++++ ++DG +                + QQ
Sbjct: 297 SRFWPEGGTSSYQALIRGAQLLTYGTNSRRLLIVLSDGMDTDNNLTSSLVNAGMCRDIQQ 356

Query: 308 SLYYCNEAKKRGAI--VYAIGIRVIRSH-EFLRACASPNSFYLVENPHS-MYDAFSHIGK 363
            L        R     +  IG     S  + L+ C    + Y  EN    +      I +
Sbjct: 357 GLESDKTLDNRPIRAQMAVIGFDYEPSENQALKDCVGAENVYKAENSDDILNTILELISE 416

Query: 364 DIVTKR 369
           +I   +
Sbjct: 417 EIGHLK 422


>gi|325860278|ref|ZP_08173400.1| von Willebrand factor type A domain protein [Prevotella denticola
           CRIS 18C-A]
 gi|325482157|gb|EGC85168.1| von Willebrand factor type A domain protein [Prevotella denticola
           CRIS 18C-A]
          Length = 318

 Score =  110 bits (275), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 38/218 (17%), Positives = 70/218 (32%), Gaps = 37/218 (16%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
           +    +D+M+ +DVS SM +       ++ +A +  +  +               GL  F
Sbjct: 83  KDTEGIDIMLTMDVSASMLTED-VYPNRMVVAKEVASEFISG-------RPNDNIGLTIF 134

Query: 227 SNKIEEFFLLEWGVSHLQRKIKYLSK-------FGVSTNSTPGLKYAYNQIFDMQGMRQH 279
           + +      +    + L   +  +             T    GL  A +           
Sbjct: 135 AGEAFTQCPMTLDHAALLNLLHGVRTDLVTSGLMQDGTAIGMGLANAVS----------- 183

Query: 280 CNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHE----- 334
              +     KI++ +TDG N +       +     A+K G  VY IG       E     
Sbjct: 184 RLKDSKAKSKIVILLTDGSNNAGSIS--PMTAAAIARKFGIRVYTIGFGKETGEEIGAID 241

Query: 335 --FLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
              L+  A  +   FY  ++   +   +  I K   TK
Sbjct: 242 YKTLQDIAVSTNGEFYRAQSQAELSRIYQDIDKLEKTK 279


>gi|34541234|ref|NP_905713.1| batA protein [Porphyromonas gingivalis W83]
 gi|34397550|gb|AAQ66612.1| batA protein [Porphyromonas gingivalis W83]
          Length = 327

 Score =  110 bits (275), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 35/224 (15%), Positives = 72/224 (32%), Gaps = 46/224 (20%)

Query: 170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229
             +D+M+ +DVS SM++       +++ A     + +       +       G+VTF+ +
Sbjct: 86  EGIDIMLAMDVSGSMQAMDFK-PNRLEAAKDVAISFI-------NNRPNDNIGMVTFAGE 137

Query: 230 IEEFFLLEWGVSHLQRKIKYLSKFG--VSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287
                 L    + L   ++ L        T    GL  A N              +    
Sbjct: 138 SFTQCPLTTDHTVLLNMVQDLQMGVLDDGTAIGMGLATAVN-----------RLKDSKAK 186

Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV------------------ 329
            ++++ +TDG N       +     + A+  G  VY +G+                    
Sbjct: 187 SRVVILLTDGSNNMGDITPRM--AADIARTFGIRVYTVGVGTRGEAPFPIQTEFGVRIQN 244

Query: 330 ---IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                    L   A  S   ++   +  ++ + +  I K   T+
Sbjct: 245 VPVDIDEPTLDGIAEVSGGKYFRAVDNETLNEIYKEIDKLEKTR 288


>gi|255535987|ref|YP_003096358.1| aerotolerance operon BatA [Flavobacteriaceae bacterium 3519-10]
 gi|255342183|gb|ACU08296.1| BatA (Bacteroides aerotolerance operon) [Flavobacteriaceae
           bacterium 3519-10]
          Length = 334

 Score =  110 bits (275), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 44/260 (16%), Positives = 81/260 (31%), Gaps = 50/260 (19%)

Query: 144 FIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSIN 203
           +I        +  P T ++  N+     +D+M+ +DVS SM +       ++        
Sbjct: 64  YILLSALIIAMARPRTFTISENNDDTKGIDIMMSVDVSLSMLARDL-EPDRLTALKNIAK 122

Query: 204 AMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKF--GVSTNSTP 261
             +       D     + GLVT+S +      +    + L  +++ L+       T    
Sbjct: 123 KFV-------DKRPGDRIGLVTYSGEAFTKVPVTSDHAVLLEELENLNPLELQPGTAIGE 175

Query: 262 GLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAI 321
           GL  A +                    KII+ MTDG N         +     AK     
Sbjct: 176 GLSVAVSH-----------LRHSKAKSKIIILMTDGVNTIENAMPAQVG-AQLAKSNDIR 223

Query: 322 VYAIGIRVI-----------------------RSHEFLRACA--SPNSFYLVENPHSMYD 356
           VY+IGI                               LR  A  +   ++   +  S+ +
Sbjct: 224 VYSIGIGTNGYALMPTQTDIFGDLVFTEVEVKIDEPVLREIAQTTGGKYFRATSNQSLEE 283

Query: 357 AFSHIGKDIVTK---RIWYD 373
            +  I +   ++      Y+
Sbjct: 284 VYEEINQLEKSELQSSKLYN 303


>gi|91223292|ref|ZP_01258558.1| hypothetical protein V12G01_05596 [Vibrio alginolyticus 12G01]
 gi|91192105|gb|EAS78368.1| hypothetical protein V12G01_05596 [Vibrio alginolyticus 12G01]
          Length = 334

 Score =  110 bits (275), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 30/224 (13%), Positives = 70/224 (31%), Gaps = 46/224 (20%)

Query: 168 TDARLDMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGL 223
                D+M+V+D+S SM+          I ++    K ++  + +           + G+
Sbjct: 93  QPKYRDLMLVVDLSGSMQQEDMELNGEYIDRLTAVKKVLSDFVAK-------RKGDRLGV 145

Query: 224 VTFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCN 281
           V F +       L      + ++I    +   G  T    G+                  
Sbjct: 146 VLFGDHAYLQTPLTADRKTVMQQINQTVIGLVGQRTAIGDGIGLGTKTFV---------- 195

Query: 282 TEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV------------ 329
            +    +++++ ++DG N +     + L     AKK  A +Y +G+              
Sbjct: 196 -DSDAPQRVMILLSDGSNTAG--VLEPLEAAEIAKKYNATIYTVGVGAGEMMVKEFFMTR 252

Query: 330 ------IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                     + L   A  +   ++   +   +   +  I +  
Sbjct: 253 KVNTAADLDEQTLTKVAEVTGGQYFRARDTEELEKIYDTINQLE 296


>gi|212635916|ref|YP_002312441.1| Von Willebrand factor type A domain-containing protein [Shewanella
           piezotolerans WP3]
 gi|212557400|gb|ACJ29854.1| Von Willebrand factor type A domain protein [Shewanella
           piezotolerans WP3]
          Length = 333

 Score =  110 bits (274), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 30/218 (13%), Positives = 66/218 (30%), Gaps = 38/218 (17%)

Query: 170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229
              D+M+ +D+S SM+        K          +   +    +     + GL+ F++ 
Sbjct: 83  KGRDLMLSVDLSGSMQIEDMVIDGK---VTDRFTLIQHVISQFIERRKGDRIGLILFADH 139

Query: 230 IEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287
                 L      + + +    +   G  T     +     +   +            N 
Sbjct: 140 AYLQSPLTQDRRTVAQYLNEAEIGLVGRQTAIGEAIALGVKRFDQV-----------ENS 188

Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR---------------- 331
            ++++ +TDG N +     +     + A KRG  +Y +G+                    
Sbjct: 189 NRVLILLTDGSNNAGSISPE--QATDIAAKRGITIYTVGVGAEVMERRTLFGKERVNPSM 246

Query: 332 --SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                 L+  A  +  S++   N   +   +  I K  
Sbjct: 247 DLDETQLKQIAEKTGGSYFRARNTEELERIYQEIDKLE 284


>gi|323138519|ref|ZP_08073587.1| hypothetical protein Met49242DRAFT_2975 [Methylocystis sp. ATCC
           49242]
 gi|322396153|gb|EFX98686.1| hypothetical protein Met49242DRAFT_2975 [Methylocystis sp. ATCC
           49242]
          Length = 458

 Score =  110 bits (274), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 53/451 (11%), Positives = 120/451 (26%), Gaps = 96/451 (21%)

Query: 2   FSLNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHA 61
             +   +RNF  N +G + ++  + L  +F+++G  ++ +    +++ L+ + DR     
Sbjct: 13  SRVRKRLRNFRANERGSIAMIFGLALIPMFMMMGAAVDYTQAVTVRSRLNHLADR----- 67

Query: 62  ATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIV---------- 111
                           K  D +         +F+   + +     +   V          
Sbjct: 68  -----AALAAVKAAAQKESDCVANPAGNNVSNFQGCGQKDIIKAGVAAGVQYMNGDPLMR 122

Query: 112 -RSTSLDIVVVPQNEGYSISAISRYKIPLK--------------------------FCTF 144
                  I +      +S +      IP                            +  F
Sbjct: 123 GADRKPTIELSSSEGSWSATVNYSADIPTNIARLMGVQTIPVNGKVTSNIALGTHMYLNF 182

Query: 145 IPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDV---SRSMESFFDSSITKIDMAIKS 201
                 S  + +  TS      Q           +        +        +ID    +
Sbjct: 183 HLLLDRSMSMGIGATSDDISRLQALTGCAFACHSEGYEAQYYDQPKAQGIRFRIDDLRDA 242

Query: 202 INAMLEE--VKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNS 259
             A++ +  +    +    +Q G+  F++ +     +   ++++   +K L     + + 
Sbjct: 243 TGALVAQAKMVASANAREHIQMGVYAFNHHVSPLVEMTSDLTNVANAVKNLDLP--THDD 300

Query: 260 TPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQ------------ 307
                 A   +   +          A   +I+  +TDG                      
Sbjct: 301 GTQAADAVTWLVANKIKGNGTGLTSAAPLEIVFLVTDGVEDGIYTGWNKMVGPTGLPLPW 360

Query: 308 -------------SLYYCNEAKKRGAIV---YA--------------IGIRVIRSHEFLR 337
                         +  C+  K +GAIV   Y               IG         L+
Sbjct: 361 WPSWMTKAPTSAFPVTACDALKSKGAIVAVVYTTYVPFPGTVQYDRLIGPFAPNISPNLQ 420

Query: 338 ACASPNSFYLVENPHSMYDAFSHIGKDIVTK 368
            CAS   F+    P  +      +    + +
Sbjct: 421 GCASQGYFFTASEPGDITRGMQSLFNRALQE 451


>gi|254228714|ref|ZP_04922137.1| IMP dehydrogenase/GMP reductase:von Willebrand factor, type A
           [Vibrio sp. Ex25]
 gi|262396564|ref|YP_003288417.1| protein BatA [Vibrio sp. Ex25]
 gi|151938661|gb|EDN57496.1| IMP dehydrogenase/GMP reductase:von Willebrand factor, type A
           [Vibrio sp. Ex25]
 gi|262340158|gb|ACY53952.1| protein BatA [Vibrio sp. Ex25]
          Length = 334

 Score =  110 bits (274), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 30/224 (13%), Positives = 70/224 (31%), Gaps = 46/224 (20%)

Query: 168 TDARLDMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGL 223
                D+M+V+D+S SM+          I ++    K ++  + +           + G+
Sbjct: 93  QPKYRDLMLVVDLSGSMQQEDMELNGEYIDRLTAVKKVLSDFVAK-------RKGDRLGV 145

Query: 224 VTFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCN 281
           V F +       L      + ++I    +   G  T    G+                  
Sbjct: 146 VLFGDHAYLQTPLTADRKTVMQQINQTVIGLVGQRTAIGDGIGLGTKTFV---------- 195

Query: 282 TEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV------------ 329
            +    +++++ ++DG N +     + L     AKK  A +Y +G+              
Sbjct: 196 -DSDAPQRVMILLSDGSNTAG--VLEPLEAAEIAKKYNATIYTVGVGAGEMMVKEFFMTR 252

Query: 330 ------IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                     + L   A  +   ++   +   +   +  I +  
Sbjct: 253 KVNTAADLDEQTLTKVAEMTGGQYFRARDTDQLEKIYDTINQLE 296


>gi|254501086|ref|ZP_05113237.1| hypothetical protein SADFL11_1122 [Labrenzia alexandrii DFL-11]
 gi|222437157|gb|EEE43836.1| hypothetical protein SADFL11_1122 [Labrenzia alexandrii DFL-11]
          Length = 465

 Score =  110 bits (274), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 61/468 (13%), Positives = 128/468 (27%), Gaps = 107/468 (22%)

Query: 4   LNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAAT 63
           +   I  F  N  G +  + A  + ++ ++ G  I++S     +  L   ID + +  AT
Sbjct: 2   IKALISKFNRNQDGSILPIFAGMVLVLVVIGGAAIDISRAVNAREKLAYAIDAAALSVAT 61

Query: 64  QIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQ 123
            +      +N+ K +  +      +        +   +    D+D    + ++       
Sbjct: 62  DLSTTVLRDNQIKTRIENSFRANLSDAEFL---DQAIDNLDFDVDSNAGTVTVSSSAGLN 118

Query: 124 NEGYSISAISR-------YKIPLKFCTFIPWYTNSRHIVMPITSSVKVNS-----QTDAR 171
           N   +I    +       +            +     +V+ +T S+  +        +  
Sbjct: 119 NYFLNIPGFGKDGLGPDVFNFGTSAEVNYSRFDVELALVVDVTGSMAGDMGALRDAAEEV 178

Query: 172 LDMMIVLDVS----------------------RSMESFFDSSITKIDMAIKSINAMLEEV 209
           +D++I  D S                       S  +   +S        +      + V
Sbjct: 179 VDILIEDDASNSASKVRISLVPYSQGVNLGSYASTVTNGSTSWRNCVNEREGQQKYTDAV 238

Query: 210 KLIPDVNNVVQSGLVTFSNKIEEFFLLEW----------------GVSHLQRKIKYLS-- 251
                 N+    GL ++                              + L   I+ LS  
Sbjct: 239 YNYDGTNSEYFHGLQSYFIWDYGSSENWSSARDDCPSSSLQPLTSDKNTLISDIRNLSSG 298

Query: 252 ---------KFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENL-- 300
                     +G  T S     +      D         T D + KK  + MTDG+    
Sbjct: 299 GGTGGQTGVAWGWYTLS---PNWTSLWPTDSDPEPYGNGTPDDDVKKFALIMTDGDFNAQ 355

Query: 301 ----------------------------------STKEDQQSLYYCNEAKKRGAIVYAIG 326
                                             +     ++   C+  K     ++ + 
Sbjct: 356 YGKEERTTCTGRGRNRVCTTNEYWVERYHRYSDYNDPPATRARTLCDAMKAENIEIFTVF 415

Query: 327 I---RVIRSHEFLRACASP-NSFYLVENPHSMYDAFSHIGKDIVTKRI 370
                     + +  CAS  + +Y  +N   +  AFS+I K I    +
Sbjct: 416 FDTGGSAFGDDLMSYCASGSDYYYEADNKDELITAFSNIAKRIQQIYL 463


>gi|149176865|ref|ZP_01855475.1| BatA [Planctomyces maris DSM 8797]
 gi|148844302|gb|EDL58655.1| BatA [Planctomyces maris DSM 8797]
          Length = 356

 Score =  110 bits (274), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 36/266 (13%), Positives = 80/266 (30%), Gaps = 47/266 (17%)

Query: 142 CTFIPWYTNSRHIVMPITSSV------KVNSQTDARLDMMIVLDVSRSMESFFDS----S 191
             ++P       I+  I          +    T   + + +V+D S SM++         
Sbjct: 49  LNWLPRLLTLGAILFMILGLARPREGREQQVTTSEGIAIEMVVDRSGSMQAMDFKIDGEH 108

Query: 192 ITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLS 251
           + ++          +E  + +         GL+TF+   +          +L  ++  + 
Sbjct: 109 VDRLTAIKNVAGKFVEGKEELEG-RFNDLVGLMTFAGYADGITPPTLDHPYLVSQLNNIQ 167

Query: 252 KFG----VSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQ 307
                    T     +  A  ++            ++    K+I+ +TDGEN + +   +
Sbjct: 168 IVTNRSEDGTAIGDAISLAVEKLN-----ALDARRDEKVKSKVIILLTDGENNAGE--VE 220

Query: 308 SLYYCNEAKKRGAIVYAIGIRV-----------------------IRSHEFLRACA--SP 342
            +     A+  G  VY IG+                               L+  A  + 
Sbjct: 221 PIQAAELAETLGIKVYTIGVGTKGEAPVPVTDPFSGKQVVQWMPVNIDEATLQKVADLTH 280

Query: 343 NSFYLVENPHSMYDAFSHIGKDIVTK 368
             ++   +  S+   +  I     TK
Sbjct: 281 GKYFRATDTDSLEKIYHEIDALEKTK 306


>gi|156976371|ref|YP_001447277.1| hypothetical protein VIBHAR_05144 [Vibrio harveyi ATCC BAA-1116]
 gi|156527965|gb|ABU73050.1| hypothetical protein VIBHAR_05144 [Vibrio harveyi ATCC BAA-1116]
          Length = 334

 Score =  110 bits (274), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 31/224 (13%), Positives = 71/224 (31%), Gaps = 46/224 (20%)

Query: 168 TDARLDMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGL 223
                DMM+V+D+S SM+    +     I ++    + ++  +E+           + G+
Sbjct: 93  QPKYRDMMLVVDLSGSMQKEDMNDNGEYIDRLTAVKRVLSDFVEK-------RQGDRLGV 145

Query: 224 VTFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCN 281
           V F +       L      + ++I    +   G  T    G+                  
Sbjct: 146 VLFGDHAYLQTPLTADRKTVMQQINQTVIGLVGQRTAIGDGIGLGTKTFV---------- 195

Query: 282 TEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR---------- 331
            +    +++++ ++DG N +       L     AKK  A +Y +G+              
Sbjct: 196 -DSDAPQRVMILLSDGSNTAG--VLDPLEAAEIAKKYNATIYTVGVGAGEMMVKDFFMTR 252

Query: 332 --------SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                     + L   A  +   ++   +   +   +  I +  
Sbjct: 253 KVNTASELDEQTLTKIAEMTGGKYFRARDAKELETIYDTINQLE 296


>gi|126731914|ref|ZP_01747718.1| BatB protein, putative [Sagittula stellata E-37]
 gi|126707741|gb|EBA06803.1| BatB protein, putative [Sagittula stellata E-37]
          Length = 323

 Score =  110 bits (274), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 31/208 (14%), Positives = 69/208 (33%), Gaps = 32/208 (15%)

Query: 170 ARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVT 225
              D+M+ +D+S SME           T++ +  ++ +  +          +  + GLV 
Sbjct: 89  EGRDIMMAIDLSGSMEERDFAVGGRPATRLSIVKETADDFI-------SRRDGDRLGLVL 141

Query: 226 FSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           FS++      L +    +++ +    +   G  T                  +      +
Sbjct: 142 FSDRAYLQAPLTFDREAVRKLLDQAQVGLTGQKTAIGDA-----------IAVSVKRLKD 190

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV----IRSHEFLRAC 339
                +++V +TDG N             + A K G  +Y IG+            LR  
Sbjct: 191 RPEDGRVLVLLTDGANNEG--VMSPDKAADLAAKLGIRIYTIGVGSARSRDLDERTLRQI 248

Query: 340 --ASPNSFYLVENPHSMYDAFSHIGKDI 365
             A+  +++   +   +   +  I +  
Sbjct: 249 ADATGGAYFRATDVQGLAQIYRAIDRLE 276


>gi|153831781|ref|ZP_01984448.1| von Willebrand factor, type A [Vibrio harveyi HY01]
 gi|148872291|gb|EDL71108.1| von Willebrand factor, type A [Vibrio harveyi HY01]
          Length = 334

 Score =  110 bits (274), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 31/224 (13%), Positives = 71/224 (31%), Gaps = 46/224 (20%)

Query: 168 TDARLDMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGL 223
                DMM+V+D+S SM+    +     I ++    + ++  +E+           + G+
Sbjct: 93  QPKYRDMMLVVDLSGSMQKEDMNDNGEYIDRLTAVKRVLSDFVEK-------RQGDRLGV 145

Query: 224 VTFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCN 281
           V F +       L      + ++I    +   G  T    G+                  
Sbjct: 146 VLFGDHAYLQTPLTADRKTVMQQINQTVIGLVGQRTAIGDGIGLGTKTFV---------- 195

Query: 282 TEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR------------- 328
            +    +++++ ++DG N +       L     AKK  A +Y +G+              
Sbjct: 196 -DSDAPQRVMILLSDGSNTAG--VLDPLEAAEIAKKYNATIYTVGVGAGEMMVKDFFMTR 252

Query: 329 -----VIRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                     + L   A  +   ++   +   +   +  I +  
Sbjct: 253 KVNTASDLDEQTLTKIAEMTGGKYFRARDAKELETIYDTINQLE 296


>gi|317502942|ref|ZP_07961034.1| aerotolerance protein BatA [Prevotella salivae DSM 15606]
 gi|315665941|gb|EFV05516.1| aerotolerance protein BatA [Prevotella salivae DSM 15606]
          Length = 332

 Score =  109 bits (273), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 36/232 (15%), Positives = 71/232 (30%), Gaps = 51/232 (21%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
           +    +D+M+ +DVS SM +       +++ A    +  +               GL  F
Sbjct: 83  KQVEGIDIMLAMDVSTSMLAEDLK-PNRLEAAKNVASEFI-------SDRPNDNIGLTIF 134

Query: 227 SNKIEEFFLLEWGVSHLQRKIKYLSKF-------GVSTNSTPGLKYAYNQIFDMQGMRQH 279
           + +      +    + L   ++ +             T    GL  A +           
Sbjct: 135 AGEAFTQCPMTTDHASLINMLRSVRTDIAARGLISDGTAIGMGLANAVS----------- 183

Query: 280 CNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI--------- 330
              +     K+++ +TDG N     D   L     AK  G  VY IG+            
Sbjct: 184 RLKDSKAKSKVVILLTDGSNNMG--DISPLTSAQIAKSLGIRVYTIGVGTNKVAPYPMPV 241

Query: 331 ------------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                          + L+  A  +  ++Y   + + +   +  I K   +K
Sbjct: 242 AGGVQYVNIPVEIDSKTLKNIAETTDGNYYRATSNNQLKQIYKDIDKLEKSK 293


>gi|281420095|ref|ZP_06251094.1| BatA protein [Prevotella copri DSM 18205]
 gi|281405895|gb|EFB36575.1| BatA protein [Prevotella copri DSM 18205]
          Length = 332

 Score =  109 bits (273), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 38/226 (16%), Positives = 71/226 (31%), Gaps = 39/226 (17%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
           +T   +D+M+ +DVS SM +       +++ A       +               GL  F
Sbjct: 83  KTVEGIDIMLAMDVSTSMLAEDL-RPNRMEAAKDVATEFISG-------RPNDNIGLTIF 134

Query: 227 SNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTP-GLKYAYNQIFDMQGMRQHCNTEDA 285
           + +      +    + L R ++        T+    GL      +            +  
Sbjct: 135 AGEAFTQCPMTTDHASLLRLLQATR-----TDIAARGLIDDGTAVGMGLANAVSRLKDSK 189

Query: 286 NYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI--------------- 330
           +  K+++ +TDG N   +     +     AK  G  VY IG+                  
Sbjct: 190 SKSKVVILLTDGSNNMGEIS--PMTAAEIAKSYGIRVYTIGVGTNKVAPYPMPVAGGVQY 247

Query: 331 ------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                    + L   A  +  +FY   N + +   +  I K   TK
Sbjct: 248 VNIPVEIDTKTLSDIAQTTDGNFYRATNNNELKKIYRDIDKLEKTK 293


>gi|301165481|emb|CBW25052.1| putative membrane protein (von Willebrand factor type A)
           [Bacteriovorax marinus SJ]
          Length = 329

 Score =  109 bits (272), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 45/276 (16%), Positives = 93/276 (33%), Gaps = 56/276 (20%)

Query: 132 ISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSS 191
            S  ++ +     + W   +  +  P +      ++ +   D+  V+DVSRSM +     
Sbjct: 46  NSAKRLLVWLVGAVGWLLIAYSLTQPRSPQGFAKNKIEVN-DIFFVIDVSRSMLADDF-R 103

Query: 192 ITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLS 251
             ++++A   I+  +             + GL+ FS +      L   +  +++ +  ++
Sbjct: 104 PNRLEVAKDKISDFVAL-------RPTDRIGLIMFSERAFTLLPLSTDLKLIKQMVGEIN 156

Query: 252 ---KFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQS 308
                G  TN    L  A  +                   K+I+ +TDG +         
Sbjct: 157 VGGMLGSGTNIGDALGLAVARGAQSLAKN-----------KVIILLTDGVSNVG--FLTP 203

Query: 309 LYYCNEAKKRGAIVYAIGI------------------------RVIRSHEFLRACA--SP 342
           +    EAKK+G  VY IGI                              + L+  A  + 
Sbjct: 204 IQAAEEAKKQGIKVYTIGIGGRGDAKIPYGKNIFGRQRYQNIPGGSIDFKTLKEIADKTN 263

Query: 343 NSFYLVENPHSMYDAFSHIGKDIVTK-----RIWYD 373
              +  ++  ++ +  S I K   ++     +I Y 
Sbjct: 264 GQTFEAQDEKALAEVLSEIEKLEKSEIDSSAKIIYK 299


>gi|330995094|ref|ZP_08319011.1| von Willebrand factor type A domain protein [Paraprevotella
           xylaniphila YIT 11841]
 gi|329576670|gb|EGG58173.1| von Willebrand factor type A domain protein [Paraprevotella
           xylaniphila YIT 11841]
          Length = 332

 Score =  109 bits (272), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 46/261 (17%), Positives = 79/261 (30%), Gaps = 40/261 (15%)

Query: 134 RYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDA---RLDMMIVLDVSRSMESFFDS 190
            YK  L    FI        +V+ +      NS  +     +D+M+ +DVS SM +    
Sbjct: 47  SYKNHLIHAPFILRLFTFVMVVIILARPQTSNSWKNTQVEGIDIMLAVDVSTSMLAEDLK 106

Query: 191 SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYL 250
              +++ A +  +  +               GL  F+ +      +    + L      +
Sbjct: 107 -PNRLEAAKQVASEFIAG-------RPNDNIGLTIFAAEAFTQCPMTTDHAVLLNLFHGI 158

Query: 251 SKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLY 310
                      G+      +            +     K+I+ +TDG N +   D   L 
Sbjct: 159 KTDMA----QRGMIQDGTAVGMGIANAVSRLKDSKAKSKVIILLTDGTNNAG--DISPLT 212

Query: 311 YCNEAKKRGAIVYAIGIRVI---------------------RSHEFLRACA--SPNSFYL 347
               AK  G  VY IG+                           + L A A  +   FY 
Sbjct: 213 AAEIAKSFGIRVYTIGVGTNGLAPYPMPVAGGVQYLNVPVEIDTKTLAAIAGKTDGEFYR 272

Query: 348 VENPHSMYDAFSHIGKDIVTK 368
             +   + D +  I K   TK
Sbjct: 273 ATDNKKLEDVYKDIDKLEKTK 293


>gi|114798549|ref|YP_759188.1| hypothetical protein HNE_0458 [Hyphomonas neptunium ATCC 15444]
 gi|114738723|gb|ABI76848.1| conserved domain protein [Hyphomonas neptunium ATCC 15444]
          Length = 460

 Score =  109 bits (271), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 56/454 (12%), Positives = 113/454 (24%), Gaps = 93/454 (20%)

Query: 9   RNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTV---------------LHSM 53
           RNFF N  G + ++ A+ +  I  + G  I+       K                 +   
Sbjct: 6   RNFFRNESGNVAMIAALTIIPIVGIAGFAIDFQVTTTQKARVQQAVDSAVLAATKSMQDG 65

Query: 54  IDRS-LVHAATQI--------MNEGNGNNRKKLKGGDILCRIKNTWNMSFRNE------- 97
            DR+  +  A            N G       L   D    ++     S           
Sbjct: 66  KDRAYSLKEANDYFKGILNQSNNSGLNCTNIDLVYIDETEELEGHVECSQNTTLSKVAGI 125

Query: 98  -----LRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSR 152
                   +     I  +  +   D+     N+    +     +  +     +  Y    
Sbjct: 126 RHLDFNVSSAATYGIGKLEIAFVFDVSGSMANDNRMGNLKVAAREAVNTLLPVEGYAGDP 185

Query: 153 HIVMPITSSVKVNSQTDARLDMMIVLD------------------------VSRSMESFF 188
             V     S             +   D                          R     +
Sbjct: 186 EDVRLAMVSYDTMVNAGPYFKAVTNQDPERTEPFYGYIRERTTCRRYRNNGTCREWNYEW 245

Query: 189 DSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGL-------------------VTFSNK 229
                +      +     E  +   D +      L                         
Sbjct: 246 RGPYHRSYTIKSTCVWEREGAERYTDASPGHNRWLPPVSATFDSYNDSWSTDHQTDPWCN 305

Query: 230 IEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYN-----QIFDMQGMRQHCNTED 284
                 L +  + L   I  ++    +T    G  + +               +    ++
Sbjct: 306 DNTPIPLTYNRNKLHDFIDDMTPR-RNTAGHIGQAWGWYLVSPEWNSVWPAGSKALPYDE 364

Query: 285 ANYKKIIVFMTDGENL-------STKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
            +  K+++ M+DG+               Q+   C++ K++  ++Y +G       + L 
Sbjct: 365 PDATKVVIMMSDGQYNETRHNNAYPSSVTQAEAICDKMKEKEVVIYTVGFDAGYGQDVLN 424

Query: 338 ACASPNSF-YLVENPHSMYDAFSHIGKDIVTKRI 370
            CAS  +F Y   N   + +A+  I + I   RI
Sbjct: 425 YCASNPAFAYKPTNGQELTEAYKSIARSISDLRI 458


>gi|261250853|ref|ZP_05943427.1| protein BatA [Vibrio orientalis CIP 102891]
 gi|260937726|gb|EEX93714.1| protein BatA [Vibrio orientalis CIP 102891]
          Length = 322

 Score =  108 bits (270), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 37/226 (16%), Positives = 71/226 (31%), Gaps = 46/226 (20%)

Query: 166 SQTDARLDMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQS 221
           +      D+M+VLD+S SM           I ++      ++  +++           + 
Sbjct: 79  TTQPKHRDLMLVLDLSYSMSQEDMQEGDQYIDRLSAVKNVVSDFVKQ-------REGDRL 131

Query: 222 GLVTFSNKIEEFFLLEWGVSHLQRKIKYL--SKFGVSTNSTPGLKYAYNQIFDMQGMRQH 279
           GLV F++       L      +  ++  L     G  T    G+  A             
Sbjct: 132 GLVLFADHAYLQTPLTLDRETISDQVNSLVLRLIGDKTAIGEGIGLATKTFV-------- 183

Query: 280 CNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV---------- 329
              +    ++++V ++DG N S     + L     AKK  A +Y IGI            
Sbjct: 184 ---DSEAPQRVMVLLSDGSNTSG--VLEPLEAARIAKKYNATIYTIGIGAGEMMVKEFFM 238

Query: 330 --------IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                       + L+  A  +   ++   N   +   +  I    
Sbjct: 239 TRKVNTAKDLDEKTLKQIADLTGGQYFRARNADELATIYDTINNLE 284


>gi|332879552|ref|ZP_08447247.1| von Willebrand factor type A domain protein [Capnocytophaga sp.
           oral taxon 329 str. F0087]
 gi|332682518|gb|EGJ55420.1| von Willebrand factor type A domain protein [Capnocytophaga sp.
           oral taxon 329 str. F0087]
          Length = 332

 Score =  108 bits (270), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 45/261 (17%), Positives = 79/261 (30%), Gaps = 40/261 (15%)

Query: 134 RYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDA---RLDMMIVLDVSRSMESFFDS 190
            YK  L    FI        +++ +      NS  +     +D+M+ +DVS SM +    
Sbjct: 47  SYKNHLIHAPFILRLFTFVMVIIILARPQTSNSWKNTQVEGIDIMLAVDVSTSMLAEDLK 106

Query: 191 SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYL 250
              +++ A +  +  +               GL  F+ +      +    + L      +
Sbjct: 107 -PNRLEAAKQVASEFIAG-------RPNDNIGLTIFAAEAFTQCPMTTDHAVLLNLFHGI 158

Query: 251 SKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLY 310
                      G+      +            +     K+I+ +TDG N +   D   L 
Sbjct: 159 KTDMA----QRGMIQDGTAVGMGIANAVSRLKDSKAKSKVIILLTDGTNNAG--DISPLT 212

Query: 311 YCNEAKKRGAIVYAIGIRVI---------------------RSHEFLRACA--SPNSFYL 347
               AK  G  VY IG+                           + L A A  +   FY 
Sbjct: 213 AAEIAKSFGIRVYTIGVGTNGLAPYPMPVAGGVQYLNVPVEIDTKTLAAIAGKTDGEFYR 272

Query: 348 VENPHSMYDAFSHIGKDIVTK 368
             +   + D +  I K   TK
Sbjct: 273 ATDNKKLEDVYKDIDKLEKTK 293


>gi|260912478|ref|ZP_05919014.1| aerotolerance protein BatA [Prevotella sp. oral taxon 472 str.
           F0295]
 gi|260633397|gb|EEX51551.1| aerotolerance protein BatA [Prevotella sp. oral taxon 472 str.
           F0295]
          Length = 332

 Score =  108 bits (270), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 38/232 (16%), Positives = 72/232 (31%), Gaps = 51/232 (21%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
           +    +D+M+ +DVS SM +    +  +++ A       + +             GL  F
Sbjct: 83  KQVEGIDIMLAMDVSTSMLAEDL-TPNRMEAAKDVAAEFIAD-------RPNDNIGLTIF 134

Query: 227 SNKIEEFFLLEWGVSHLQRKIKYLSKF-------GVSTNSTPGLKYAYNQIFDMQGMRQH 279
           + +      +    + L   ++ +             T    GL  A +           
Sbjct: 135 AGEAFTQCPMTTDHTSLLNMLQTVRTDIAAKGLIQDGTAIGMGLANAVS----------- 183

Query: 280 CNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI--------- 330
              +     K+++ +TDG N     D   +   N AK  G  VY IG+            
Sbjct: 184 RLKDSKAKSKVVILLTDGSNNMG--DLSPMTSANIAKSLGIRVYTIGVGTNKVARYPMPV 241

Query: 331 ------------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                          + L+  A  +  +FY   N   +   +  I K   +K
Sbjct: 242 AGGVQYVNMPVEIDTKVLKDIAASTDGNFYRATNNQELKQIYKDIDKLEKSK 293


>gi|114589213|ref|XP_516745.2| PREDICTED: hypothetical protein [Pan troglodytes]
          Length = 1859

 Score =  108 bits (270), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 40/273 (14%), Positives = 90/273 (32%), Gaps = 28/273 (10%)

Query: 109 DIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQT 168
           +    T L+ +     E Y     +   +     TF+    N     + + S      ++
Sbjct: 588 EGASDTQLEKIASHPAEQYVSKLKTFADLAAHNQTFLKKLRNQITHTVSVFSERTETLKS 647

Query: 169 D----ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
                   D+ +++D S S ++     +       + +         +       + G V
Sbjct: 648 GCVDTEEADIYLLIDGSGSTQATDFHEMK--TFLSEVVGMFNIAPHKV-------RVGAV 698

Query: 225 TFSNKIEEFF--LLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +++  +  F          L + I+ + + G +TN+   L +  + +      +     
Sbjct: 699 QYADSWDLEFEINKYSNKQDLGKAIENIRQMGGNTNTGAALNFTLSLL-----QKAKKQR 753

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
            +     ++V        +       L   N  ++    VYAIGI    +   LR  A  
Sbjct: 754 GNKVPCHLVVL------TNGMSKDSILEPANRLREEHIRVYAIGI-KEANQTQLREIAGE 806

Query: 343 N-SFYLVENPHSMYDAFSHIGKDIVTKRIWYDK 374
               Y V N  ++ D  + + ++I T+    +K
Sbjct: 807 EKRVYYVHNFDALKDIRNQVVQEICTEEADLNK 839



 Score = 83.4 bits (204), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 36/334 (10%), Positives = 97/334 (29%), Gaps = 26/334 (7%)

Query: 39   EVSHIFFMKTVLHSMIDRS---LVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFR 95
            +      + +VL +  D++     + A  +    +     +    +              
Sbjct: 1097 DFGTKLEVISVLQN--DQAMGGSTYTAEALGFSDHMFTEARGSRLNKGVPQVLIVITDGE 1154

Query: 96   NELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIV 155
            +   D           +   +  V +       + A++       F             V
Sbjct: 1155 SHDADKLNATAKALRDKGILVLAVGIDGANPMELLAMAGSSDKYFFVETFGGLKGIFSDV 1214

Query: 156  MPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDV 215
                 +         ++D++ ++D S S++              K    +   V+     
Sbjct: 1215 TASVCNSSKVDCEIDKVDLVFLMDGSTSIQPNDF---------KKMKEFLASVVQDFDVS 1265

Query: 216  NNVVQSGLVTFSNKIEEFFL--LEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM 273
             N V+ G   FS+     F      G   +  +I+ + +   +T+          +  + 
Sbjct: 1266 LNRVRIGAAQFSDTYHPEFPLGTFIGEKEISFQIENIKQIFGNTHIGAA-----LREVEH 1320

Query: 274  QGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSH 333
                   +  +    ++++ +TD      +   +        + RG  +Y++GI  +   
Sbjct: 1321 YFRPDMGSRINTGTPQVLLVLTD-----GQSQDEVAQAAEALRHRGIDIYSVGIGDVDDQ 1375

Query: 334  EFLRACASPNSFYLVENPHSMYDAFSHIGKDIVT 367
            + ++   +      V N   +      I ++I T
Sbjct: 1376 QLIQITGTAEKKLTVHNFDELKKVNKRIVRNICT 1409



 Score = 81.4 bits (199), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 48/334 (14%), Positives = 107/334 (32%), Gaps = 30/334 (8%)

Query: 44   FFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGF 103
            F  ++ + + ID+  +    Q    G+  +              N           +   
Sbjct: 911  FMSQSDISNAIDQ--MAHIGQTTLTGSALSFVSQYFSPTKGARPNIRKFLILITDGEAQD 968

Query: 104  VNDIDDIVRSTSLDIVVVPQNEGYSIS----AISRYKIPLKFCTFIPWYTNSRHIVMPIT 159
            +     +V      I+      G +++       R ++      F         +V  I 
Sbjct: 969  IVKEPAVVLRQEGVIIYSVGVFGSNVTQLEEISGRPEMVFYVENFDILQRIEDDLVFGI- 1027

Query: 160  SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSI--TKIDMAIKSINAMLEEVKLIPDVNN 217
             S +   +    LD++ V+D S S++    + +    I +  K+               N
Sbjct: 1028 CSPREECKRIEVLDVVFVIDSSGSIDYDEYNIMKDFMIGLVKKA-----------DVGKN 1076

Query: 218  VVQSGLVTFSNKIEEFFL--LEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQG 275
             V+ G + +++  E  F          +   ++     G ST +   L +      D   
Sbjct: 1077 QVRFGALKYADDPEVLFYLDDFGTKLEVISVLQNDQAMGGSTYTAEALGF-----SDHMF 1131

Query: 276  MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF 335
                 +  +    ++++ +TDGE+    +  +        + +G +V A+GI      E 
Sbjct: 1132 TEARGSRLNKGVPQVLIVITDGESH---DADKLNATAKALRDKGILVLAVGIDGANPMEL 1188

Query: 336  LRACASPNSFYLVENPHSMYDAFSHIGKDIVTKR 369
            L    S + ++ VE    +   FS +   +    
Sbjct: 1189 LAMAGSSDKYFFVETFGGLKGIFSDVTASVCNSS 1222



 Score = 65.3 bits (157), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 27/207 (13%), Positives = 66/207 (31%), Gaps = 23/207 (11%)

Query: 165  NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
             +  D + D+M ++D S S+                 +  ++ + ++ PD   +      
Sbjct: 846  AACKDMKADIMFLVDSSGSI------GPENFSKMKTFMKNLVSKSQIGPDRVQIGVVQFS 899

Query: 225  TFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
              + +  +        S +   I  ++  G +T +          +  +           
Sbjct: 900  DINKEEFQLNRFMS-QSDISNAIDQMAHIGQTTLTGSA-------LSFVSQYFSPTKGAR 951

Query: 285  ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIG-IRVIRSHEFLRACAS-P 342
             N +K ++ +TD      +            ++ G I+Y++G      +   L   +  P
Sbjct: 952  PNIRKFLILITD-----GEAQDIVKEPAVVLRQEGVIIYSVGVFGSNVTQ--LEEISGRP 1004

Query: 343  NSFYLVENPHSMYDAFSHIGKDIVTKR 369
               + VEN   +      +   I + R
Sbjct: 1005 EMVFYVENFDILQRIEDDLVFGICSPR 1031



 Score = 56.8 bits (135), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 36/313 (11%), Positives = 93/313 (29%), Gaps = 32/313 (10%)

Query: 31  FLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTW 90
           F  +G  +++          +           +   N  +      +         ++  
Sbjct: 318 FGFIGGSLQIGKALQEAHRTY----------FSAPTNGRDKKQFPPILVVLASSESEDDV 367

Query: 91  NMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTN 150
             + +   +D   +  +     S      +      +++  +    +  +  T I     
Sbjct: 368 EEASKALRKDGVKIISVGVQKASEENLKAMATSQFHFNLRTVRDLSMFSQNMTHIIKDVT 427

Query: 151 SRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVK 210
                  +        Q  +  D++ +LD+S       + S    D        + E V 
Sbjct: 428 KYK-EGAVDDIFVEACQGPSMADVVFLLDMS------INGSEENFDYLK---GFLEESVS 477

Query: 211 LIPDVNNVVQSGLVTFSNKIEEFFL--LEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYN 268
            +    N ++ GLV +SN+ +      +    S + + I+ LS       +      A  
Sbjct: 478 ALDIKENCMRVGLVAYSNETKVINSLSMGINKSEVLQHIQNLSPRTGKAYTGA----AIK 533

Query: 269 QIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR 328
           ++       ++ + ++    +I V +T         +          ++ G  ++ +GI 
Sbjct: 534 KLRKEVFSARNGSRKNQGVPQIAVLVTH-----RDSEDNVTKAAVNLRREGVTIFTLGIE 588

Query: 329 VIRSHEFLRACAS 341
                + L   AS
Sbjct: 589 GASDTQ-LEKIAS 600



 Score = 46.8 bits (109), Expect = 0.006,   Method: Composition-based stats.
 Identities = 33/207 (15%), Positives = 69/207 (33%), Gaps = 25/207 (12%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
           Q     D++ ++D S                       + + +  +P   +  +  L  +
Sbjct: 241 QGPEYADVVFLVDSS------DRLGSKSFPFVKM---FITKMISSLPIEADKYRVALAQY 291

Query: 227 SNKIEEFFL--LEWGVSHLQRKI-KYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           S+K+   F      G S +   + K     G S      L+ A+   F           +
Sbjct: 292 SDKLHSEFHLSTFKGRSPMLNHLRKNFGFIGGSLQIGKALQEAHRTYF----SAPTNGRD 347

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPN 343
              +  I+V +      S++ +          +K G  + ++G++   S E L+A A+  
Sbjct: 348 KKQFPPILVVLA-----SSESEDDVEEASKALRKDGVKIISVGVQK-ASEENLKAMATSQ 401

Query: 344 SFYL---VENPHSMYDAFSHIGKDIVT 367
             +    V +        +HI KD+  
Sbjct: 402 FHFNLRTVRDLSMFSQNMTHIIKDVTK 428


>gi|24374613|ref|NP_718656.1| von Willebrand factor type A domain-containing protein [Shewanella
           oneidensis MR-1]
 gi|24349233|gb|AAN56100.1|AE015746_4 von Willebrand factor type A domain protein [Shewanella oneidensis
           MR-1]
          Length = 338

 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 31/217 (14%), Positives = 64/217 (29%), Gaps = 38/217 (17%)

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
             D+M+ +D+S SM+        K    +     +   V    +     + GL+ F++  
Sbjct: 83  GRDLMLAVDLSGSMQIEDMVIDGK---VVDRFTLIQHVVSEFIERRKGDRIGLILFADHA 139

Query: 231 EEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
                L      + + +K   +   G  T     +  A  +   M               
Sbjct: 140 YLQAPLTQDRRSVAQFLKEAQIGLVGKQTAIGESIALAVKRFDKMDESN----------- 188

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR----------------- 331
           +++V +TDG N +     +       A  R   +Y +G+                     
Sbjct: 189 RVLVLLTDGSNNAGNI--EPQQAAQIAANRKVTIYTVGVGADVMERRTLFGRERVNPSMD 246

Query: 332 -SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                L+  A  +   ++   N   +   +  I K  
Sbjct: 247 LDENQLQQIADATHGRYFRARNSEELEQIYQEIDKLE 283


>gi|288928458|ref|ZP_06422305.1| BatA protein [Prevotella sp. oral taxon 317 str. F0108]
 gi|288331292|gb|EFC69876.1| BatA protein [Prevotella sp. oral taxon 317 str. F0108]
          Length = 332

 Score =  108 bits (269), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 38/232 (16%), Positives = 72/232 (31%), Gaps = 51/232 (21%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
           +    +D+M+ +DVS SM +    +  +++ A       + +             GL  F
Sbjct: 83  KQVEGIDIMLAMDVSTSMLAEDL-TPNRMEAAKDVAAEFIAD-------RPNDNIGLTIF 134

Query: 227 SNKIEEFFLLEWGVSHLQRKIKYLSKF-------GVSTNSTPGLKYAYNQIFDMQGMRQH 279
           + +      +    + L   ++ +             T    GL  A +           
Sbjct: 135 AGEAFTQCPMTTDHTSLLNMLQTVRTDIAAKGLIQDGTAIGMGLANAVS----------- 183

Query: 280 CNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI--------- 330
              +     K+++ +TDG N     D   +   N AK  G  VY IG+            
Sbjct: 184 RLKDSKAKSKVVILLTDGSNNMG--DLSPMTSANIAKSLGIRVYTIGVGTNKVARYPMPV 241

Query: 331 ------------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                          + L+  A  +  +FY   N   +   +  I K   +K
Sbjct: 242 AGGVQYVNMPVEIDTKVLKDIAATTDGNFYRATNNQELKQIYKDIDKLEKSK 293


>gi|255261929|ref|ZP_05341271.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
 gi|255104264|gb|EET46938.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
          Length = 478

 Score =  108 bits (269), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 56/465 (12%), Positives = 124/465 (26%), Gaps = 102/465 (21%)

Query: 2   FSLNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHA 61
            S    ++ F  +  G   I +     ++ L  GM +++      +  L   +DR+++ A
Sbjct: 18  RSAKRFVKEFARDEDGAFIIFSLFMFVLMLLTAGMALDLMRYETHRARLQGTLDRAVLAA 77

Query: 62  ATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVV 121
           A     + +          D   +   +  ++     +   +         +     + +
Sbjct: 78  A-----DLDQTLSPAAVVTDYFAKAGLSSFLTSTTVDQGLNYRIISAQGNMTMPTTFMRL 132

Query: 122 PQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMP-------------ITSSVKVNSQT 168
                 +I   +  +  +           S  +                I + ++  ++ 
Sbjct: 133 SGQTELAIRGDATAEERVSNVEISLVVDISGSMGRNNKLSTLRTASHTFIDTVIRPETED 192

Query: 169 DARLDMM---------------IVLDVSRSMESFFDSSITKID-MAIKSINAMLEEVKLI 212
              L+++               + +D   +     D      +  A+          K +
Sbjct: 193 LISLNIIPYTAQVNAGPDIFDQLTVDQKHNFSHCIDFEPADFNTAALDVPPVSTRTYKQM 252

Query: 213 PDVNNVVQSGLVTFSNKI----EEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYN 268
                   S  V          E         + L+  +  L     +T    G+K+  +
Sbjct: 253 QHFQYGWSSSYVNNPGCPMQSYERIVPFSQDATSLKSTVTSLRAR-ANTAIHLGMKWGVS 311

Query: 269 QIFD----------------MQGMRQHCNTEDANYKKIIVFMTDGEN------------- 299
            +                   +   +     D    K IV MTDG+N             
Sbjct: 312 MLDPTFRPIVTAMIANNKVDPEFAGRPVAYNDPETLKTIVLMTDGQNVDTYRISDEFYST 371

Query: 300 ---------------------------------LSTKEDQQSLYYCNEAKKRGAIVYAIG 326
                                             +T+ D      C+ AK  G +V+ IG
Sbjct: 372 PSQIAHWDRYQLFFFTNNYIDRDIDQNYYYKKFTATQADTMLQSICDAAKAEGILVWTIG 431

Query: 327 IR-VIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
                 +   +  CAS  S +       + +AF+ I + I   R+
Sbjct: 432 FEVSNHAAGEMLDCASSPSHFFRVEGVELSEAFASIARQINQLRL 476


>gi|313207255|ref|YP_004046432.1| von willebrand factor type a [Riemerella anatipestifer DSM 15868]
 gi|312446571|gb|ADQ82926.1| von Willebrand factor type A [Riemerella anatipestifer DSM 15868]
 gi|315023479|gb|EFT36485.1| aerotolerance operon BatA [Riemerella anatipestifer RA-YM]
 gi|325335298|gb|ADZ11572.1| Uncharacterized protein containing a von Willebrand factor type A
           (vWA) domain [Riemerella anatipestifer RA-GD]
          Length = 330

 Score =  108 bits (269), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 45/282 (15%), Positives = 84/282 (29%), Gaps = 54/282 (19%)

Query: 124 NEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTD---ARLDMMIVLDV 180
           +   ++  IS +   L       +   S  I+          S+       +D+++ +DV
Sbjct: 37  SSTKNMQVISYFGAVLWLLKISKYIILSALILAIARPRTFSISEDRDETKGMDIVLSIDV 96

Query: 181 SRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGV 240
           S SM +       ++    +     +++           + GLV +S +      L    
Sbjct: 97  SLSMLAKDL-EPDRLTALKEIARTFIKQ-------RTTDRIGLVEYSGEALMRVPLTSDH 148

Query: 241 SHLQRKIKYLSKF--GVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGE 298
             ++ ++   +       TN   GL  A +              +     KII+ MTDG 
Sbjct: 149 RVVEEELMSFNPMDLEGGTNIGDGLAVAVSH-----------LRKSKAKSKIIILMTDGV 197

Query: 299 NLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI-----------------------RSHEF 335
           N         L     A+     VY IGI                               
Sbjct: 198 NTIDN-AMSPLTAAELARNNDIKVYTIGIGSNGLALMPTQQDIFGNLVFTEEQVKIDEYL 256

Query: 336 LRACA--SPNSFYLVENPHSMYDAFSHIGKD----IVTKRIW 371
           LR  A  +   ++   +  S+   +  I       I T +I+
Sbjct: 257 LRDVAQITGGKYFRATSNESLKQIYEEIDTLEKSNIKTSKIY 298


>gi|90417299|ref|ZP_01225225.1| batB protein, putative [marine gamma proteobacterium HTCC2207]
 gi|90330884|gb|EAS46147.1| batB protein, putative [marine gamma proteobacterium HTCC2207]
          Length = 330

 Score =  108 bits (269), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 31/221 (14%), Positives = 68/221 (30%), Gaps = 46/221 (20%)

Query: 171 RLDMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+++ +D+S SME         ++ ++      +   + E           + GL+ F
Sbjct: 89  GRDILLAVDISGSMEREDMQLSGQTVNRLMAVKAVVGNFVTE-------REGDRLGLILF 141

Query: 227 SNKIEEFFLLEWGVSHLQRKI--KYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
             K      L +    +Q  +    L   G  T     +  +  ++              
Sbjct: 142 GEKAYLQTPLTFDRKTMQTLLYEAQLGFAGNGTAIGDAIGLSVKRLQQ-----------R 190

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV--------------- 329
               ++++ +TDG N + + D   L     A      +Y IG+                 
Sbjct: 191 PENHRVVILLTDGANNAGELD--PLKAAELASSAKVKIYTIGVGAETQEAWGLFGKRVTN 248

Query: 330 ---IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                  + L A A  +   ++   NP  +   +  + +  
Sbjct: 249 PSADLDEQTLTAIAEATGGQYFRARNPEELMAIYQELNRLE 289


>gi|323493530|ref|ZP_08098652.1| hypothetical protein VIBR0546_14455 [Vibrio brasiliensis LMG 20546]
 gi|323312353|gb|EGA65495.1| hypothetical protein VIBR0546_14455 [Vibrio brasiliensis LMG 20546]
          Length = 322

 Score =  108 bits (269), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 34/230 (14%), Positives = 73/230 (31%), Gaps = 46/230 (20%)

Query: 162 VKVNSQTDARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNN 217
            +  +      D+M+V+D+S SM           I ++    K ++   ++         
Sbjct: 75  GEPVTTQPKHRDLMLVVDLSYSMSQKDMLSQDDYIDRLTAVKKVVSDFAQQ-------RE 127

Query: 218 VVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYL--SKFGVSTNSTPGLKYAYNQIFDMQG 275
             + GLV F++       L    + + ++++ L     G  T    G+  A         
Sbjct: 128 GDRLGLVLFADHAYLQTPLTLDRNTIAKQVESLVLRLIGDKTAIGEGIGLATKTFI---- 183

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV------ 329
                  +    +++++ ++DG N S       +     AKK  A +Y IG+        
Sbjct: 184 -------DSDAPQRVMILLSDGSNTSG--VLDPIEAAKIAKKYNATIYTIGVGAGEMMVK 234

Query: 330 ------------IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                             L+  A  +   ++   N   +   +  I    
Sbjct: 235 EFFMTRKVNTAKDLDENTLQEIADLTGGQYFRARNADELATIYDTINSLE 284


>gi|300776751|ref|ZP_07086609.1| aerotolerance protein BatA [Chryseobacterium gleum ATCC 35910]
 gi|300502261|gb|EFK33401.1| aerotolerance protein BatA [Chryseobacterium gleum ATCC 35910]
          Length = 330

 Score =  108 bits (268), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 39/241 (16%), Positives = 77/241 (31%), Gaps = 47/241 (19%)

Query: 154 IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
           +  P T ++  +      +D+M+ +DVS SM +   +   +I          +++     
Sbjct: 70  MARPRTFTISQDRDDTKGVDIMLSIDVSLSMLAKDLN-PDRITALKDIAVKFVQK----- 123

Query: 214 DVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGV--STNSTPGLKYAYNQIF 271
                 + G+V ++ +      +      +  +IK L+  G+   T    GL  A N + 
Sbjct: 124 --RPNDRIGVVAYAAEAFTKVPVTSDHQVVIDEIKNLNSAGLEPGTAIGEGLSVAVNHLV 181

Query: 272 DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI- 330
                            K+++ MTDG +               AK     VYAIGI    
Sbjct: 182 K-----------SKAKSKVVILMTDGVSNIQNAIP-PQVAAELAKNNNIKVYAIGIGTNG 229

Query: 331 ----------------------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIV 366
                                      LR  A  +   ++   +  S+ + +  I +   
Sbjct: 230 YALMPTSQDIFGDLVFTETEVTIDENTLREIAQTTGGKYFRATSNSSLEEVYDEINQLEK 289

Query: 367 T 367
           +
Sbjct: 290 S 290


>gi|282858824|ref|ZP_06267969.1| von Willebrand factor type A domain protein [Prevotella bivia
           JCVIHMP010]
 gi|282588393|gb|EFB93553.1| von Willebrand factor type A domain protein [Prevotella bivia
           JCVIHMP010]
          Length = 318

 Score =  108 bits (268), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 38/220 (17%), Positives = 71/220 (32%), Gaps = 37/220 (16%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           N++    +D+M+ +D+S SM +    +  ++ +A    +  +       +       GL 
Sbjct: 81  NNKETEGIDIMLAMDISASMLTND-VTPNRLIVAKNVASDFI-------NGRPNDNIGLT 132

Query: 225 TFSNKIEEFFLLEWGVSHLQRKIKYLSKF-------GVSTNSTPGLKYAYNQIFDMQGMR 277
            F+ +      L    + L   +  +             T    GL  A           
Sbjct: 133 IFAGEAFTQCPLTIDHATLINLLNNVRADLVVKGLIQDGTAIGMGLANAVG--------- 183

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV-------I 330
                      KI++ +TDG N         +     AKK    VY IG+          
Sbjct: 184 --RLKASNAKSKIVILLTDGSNNVGSIS--PMTAATIAKKFNIRVYTIGLGTEQSGNYND 239

Query: 331 RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
             +  L+  A  +   FY  ++   +   ++ I K   TK
Sbjct: 240 IDYTTLKQIALTTNGEFYRAQSQTELLQIYNDINKLEKTK 279


>gi|261880541|ref|ZP_06006968.1| BatA protein [Prevotella bergensis DSM 17361]
 gi|270332764|gb|EFA43550.1| BatA protein [Prevotella bergensis DSM 17361]
          Length = 332

 Score =  108 bits (268), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 38/223 (17%), Positives = 65/223 (29%), Gaps = 39/223 (17%)

Query: 170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229
             +D+M+ +DVS SM +       +++ A    +  +               GL  F+ +
Sbjct: 86  EGIDIMLAMDVSTSMLAEDLK-PNRLEAAKDVASEFVSG-------RPSDNIGLTIFAGE 137

Query: 230 IEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTP-GLKYAYNQIFDMQGMRQHCNTEDANYK 288
                 L      L   +  +      T+    GL      +                  
Sbjct: 138 SFTQCPLTIDHGSLLNLLNNVR-----TDIAARGLIQDGTAVGMGLANAVSRLKGSKAKS 192

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI------------------ 330
           K+++ +TDG N     D   L     A+  G  VY IG+                     
Sbjct: 193 KVVILLTDGSNNMG--DISPLTAAQIARSLGIRVYTIGVGTNKVAPYPMPVAGGVQYVNM 250

Query: 331 ---RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                 + L   A  +  +FY   N   +   +  I K   TK
Sbjct: 251 PVEIDTKTLSDIAAITEGNFYRATNNRELKQIYRDIDKLEKTK 293


>gi|316933619|ref|YP_004108601.1| hypothetical protein Rpdx1_2276 [Rhodopseudomonas palustris DX-1]
 gi|315601333|gb|ADU43868.1| hypothetical protein Rpdx1_2276 [Rhodopseudomonas palustris DX-1]
          Length = 483

 Score =  108 bits (268), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 36/311 (11%), Positives = 84/311 (27%), Gaps = 39/311 (12%)

Query: 11  FFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGN 70
           F     G + ++  I L  +   +G  ++ S     +T + S +D + +  A  + +   
Sbjct: 17  FPAASGGNIAVIFGIALLPLLGFVGAAVDYSRASRARTAMQSALDSTALMVAKDLTSGKI 76

Query: 71  GNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSIS 130
                +                             + D      +        +E   ++
Sbjct: 77  TAENVQSAANTYFTS-----------------LYKNTDAPSIDVTATYTPKTSSENAKLT 119

Query: 131 AISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDS 190
                 I  +F   +       +I      +    +    RL + + LDV+ SM+S    
Sbjct: 120 VGGTGSINTEFMKVM-------NISQMSLGASSTTTWGGTRLRVALALDVTGSMDSAG-- 170

Query: 191 SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE------FFLLEWGVSH-- 242
              K+     +   +++ +K        V   +V F+  +           L+W  S+  
Sbjct: 171 ---KLSAMKTAAKQLIDTLKATSTTKEDVYISIVPFNVMVNVGPGNKNATWLDWDTSYGS 227

Query: 243 --LQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENL 300
              +   K   + G  + +         +               +N       +TD    
Sbjct: 228 CKSKYTTKNACQAGGDSWNYWSNTCQSQKTLKSACQAGGHTWTASNVNSWKGCVTDRTQN 287

Query: 301 STKEDQQSLYY 311
                 +    
Sbjct: 288 YDTTKTEPTSA 298



 Score = 64.1 bits (154), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 38/207 (18%), Positives = 67/207 (32%), Gaps = 20/207 (9%)

Query: 183 SMESFFDSSITKIDMAIKSI-NAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVS 241
           S +          D       +A  + + L  + ++ + S L   S             +
Sbjct: 276 SWKGCVTDRTQNYDTTKTEPTSATPDTLFLAQNYSDCMASLLPMKSAYEATESDSSTDAT 335

Query: 242 HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENL- 300
            L+ +I  L   G  TN   G+ +A+  +     +       +  Y   IV ++DG N  
Sbjct: 336 TLKGRINTLDAQG-GTNQGIGMFWAWMTLQATAPLYTPAKDSEYKYTDAIVLLSDGMNTK 394

Query: 301 ----------STKEDQQSLYYCNEA--KKRGA---IVYAIGIRVIRSHE--FLRACASPN 343
                     S + D +    C+    K  G     +Y I +      E   L+ C S  
Sbjct: 395 NRWYGNGSNWSPQVDDRQKILCDNITTKVNGVPETTIYTIQVNTSGDPESSVLKYCGSTG 454

Query: 344 SFYLVENPHSMYDAFSHIGKDIVTKRI 370
            F+       +  AF  +G  +   RI
Sbjct: 455 GFFSTTTASGIQSAFQEVGASLTKLRI 481


>gi|323495646|ref|ZP_08100717.1| membrane associated secretion system protein [Vibrio sinaloensis
           DSM 21326]
 gi|323319281|gb|EGA72221.1| membrane associated secretion system protein [Vibrio sinaloensis
           DSM 21326]
          Length = 419

 Score =  108 bits (268), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 45/423 (10%), Positives = 112/423 (26%), Gaps = 66/423 (15%)

Query: 9   RNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNE 68
                   G   IL A+ +P +F +  +  + +     K  +    + +++  A    + 
Sbjct: 1   MKALRKQSGHAAILFAMIIPGLFGLFTLASDGARAIQTKARIEDASEIAVLAIAAHNDDN 60

Query: 69  GNG--NNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEG 126
            N   +         I       +     +         + D I    +      P+   
Sbjct: 61  KNSQGSGSGSAVNRKIATDYLEAYLHDVDSVNNLKIHKYNCDQIPECVAGLARGEPRFFQ 120

Query: 127 YSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMES 186
           Y + A SR+       + IP +            +          +D++ V D S SM  
Sbjct: 121 YEVEATSRHVSWFPGDSSIPGFGK----TFDAKGAATARKYQSEAVDILFVADYSGSMAG 176

Query: 187 FFDSSITK--------IDMAIKSINAMLEEVKLIPDVNNVVQSGLV-------------- 224
            ++    +        I +    +    +      +   +                    
Sbjct: 177 GWNGGSNRKYIDLRNIIKVVTDELQKFNDLNNTDNNTVGMTGFNYYTKTKPTNRSNSCFM 236

Query: 225 -------------------TFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKY 265
                               F+ K  ++ +     S  +      +    +T        
Sbjct: 237 TQLVYNNNYNINYTKTVNNIFNEKNNKYCVSHSDSSRFRDIDLTDNYSSFNTTVNGFYPN 296

Query: 266 AYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYY-----CNEAKKR-- 318
                +           +  N +++++ ++DG++  T +            C + K+   
Sbjct: 297 HGTASYQGIMRGAQMLKKGTNPRRLLIVLSDGDDSGTSQKNIHKQLVNAGMCTKIKQELS 356

Query: 319 -GA---------IVYAIGIRVIRSHEF-LRACASPNSFYLVENPHS-MYDAFSHIGKDIV 366
            G           +  +G     ++   LR CA   + +  +N    +      I ++I 
Sbjct: 357 TGISSSGQSIKARLAVVGFDYNVNNNTALRDCAGAENVFKAQNTDDILNKILELITEEIG 416

Query: 367 TKR 369
             +
Sbjct: 417 HLK 419


>gi|73669697|ref|YP_305712.1| BatA [Methanosarcina barkeri str. Fusaro]
 gi|72396859|gb|AAZ71132.1| BatA [Methanosarcina barkeri str. Fusaro]
          Length = 317

 Score =  108 bits (268), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 40/249 (16%), Positives = 91/249 (36%), Gaps = 39/249 (15%)

Query: 144 FIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSIN 203
           F         +++   +      QT   +++++V+DVS SM++    + ++++ A  S  
Sbjct: 61  FYLSLVAISLMIIGFANPHIPLEQTKEGVNVVLVMDVSGSMQAQDY-TPSRLEAAKSSAE 119

Query: 204 AMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGL 263
            +      I  + +   +G+VTF +       L      +  K++ ++    ST    GL
Sbjct: 120 IL------INSLKSKDYAGIVTFESGATTAAYLSPYKEKVIEKLRNVAPKEGSTAIGDGL 173

Query: 264 KYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVY 323
               +    +            N KK+I+ ++DG N +             AK     VY
Sbjct: 174 SLGIDMASSI-----------PNKKKVIILLSDGVNNAGYISPD--EAIQYAKANNIQVY 220

Query: 324 AIGIRVIR-----------------SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKD 364
            IG+                         L+A A  +   ++   +  ++ + + +I ++
Sbjct: 221 TIGMGSNGNVLLGYDWFGNPQYAELDEATLQAIANDTGGKYFKSIDDKTLDEIYKNISEN 280

Query: 365 IVTKRIWYD 373
           I  ++   +
Sbjct: 281 IKREKEETN 289


>gi|270158235|ref|ZP_06186892.1| von Willebrand factor type A domain protein [Legionella longbeachae
           D-4968]
 gi|289163509|ref|YP_003453647.1| hypothetical protein LLO_0165 [Legionella longbeachae NSW150]
 gi|269990260|gb|EEZ96514.1| von Willebrand factor type A domain protein [Legionella longbeachae
           D-4968]
 gi|288856682|emb|CBJ10493.1| putative unknown protein [Legionella longbeachae NSW150]
          Length = 342

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 32/225 (14%), Positives = 74/225 (32%), Gaps = 46/225 (20%)

Query: 168 TDARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGL 223
           +    ++M+ LD+S SME           +++++   +    + E        +  + GL
Sbjct: 86  SREGYNIMMALDLSGSMEIPDMILHGRPTSRLNIVKSAAEQFVRE-------RSGDKIGL 138

Query: 224 VTFSNKIEEFFLLEWGVSHLQRKIKYLSK--FGVSTNSTPGLKYAYNQIFDMQGMRQHCN 281
           + F  +      L +    +  +++  +    G +T+    +  A               
Sbjct: 139 ILFGTRAYLQTPLTYDRHSILLRLEDATAGLAGKTTSIGDAVGLAVK-----------RL 187

Query: 282 TEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV------------ 329
                  ++I+ +TDG N S       L     AK+ G  +Y IG+              
Sbjct: 188 DSAPKKGRVIILLTDGANNSG--VLAPLKAAELAKEEGIKIYTIGLGSEGDSRALVGDFL 245

Query: 330 ------IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIV 366
                     E L+  +  +   ++   +  S++  +  I +   
Sbjct: 246 MQSPAADLDEETLKKMSDMTGGRYFRATDTESLHLIYKTINQLET 290


>gi|325676908|ref|ZP_08156581.1| von Willebrand factor [Rhodococcus equi ATCC 33707]
 gi|325552456|gb|EGD22145.1| von Willebrand factor [Rhodococcus equi ATCC 33707]
          Length = 326

 Score =  107 bits (267), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 31/246 (12%), Positives = 72/246 (29%), Gaps = 30/246 (12%)

Query: 139 LKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMA 198
            +             + + +            R  +++V+DVS SM++      +++  A
Sbjct: 56  TRHLPTALLLVGLVFLTVALAGPTADKRVPRNRATVVLVIDVSLSMKATD-VEPSRLAAA 114

Query: 199 IKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTN 258
            ++  +  + +    +       GLV F+                +  I  L+     T 
Sbjct: 115 QEAAKSFADGLTPGIN------LGLVAFAGTASVLVSPTPNRDETKAAIDNLTLSER-TA 167

Query: 259 STPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSL---YYCNEA 315
           +   +  +   I     +       +      IV ++DG+    +             +A
Sbjct: 168 TGEAIFTSLQSIDT---LAAVLGGSEQAPPARIVLLSDGKQTVPESPDDPRGGFTAARQA 224

Query: 316 KKRGAIVYAIGIRV--------------IRSHEFLRACA--SPNSFYLVENPHSMYDAFS 359
           K +G  +  I                        LR  A  S  +F+   +   + D + 
Sbjct: 225 KDKGVPISTISFGTGYGTVEIEGDRIPVPVDDPSLREIANLSGGNFFTASSLEELRDVYD 284

Query: 360 HIGKDI 365
            + + I
Sbjct: 285 TLEEQI 290


>gi|304382530|ref|ZP_07365025.1| aerotolerance protein BatA [Prevotella marshii DSM 16973]
 gi|304336361|gb|EFM02602.1| aerotolerance protein BatA [Prevotella marshii DSM 16973]
          Length = 332

 Score =  107 bits (267), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 38/222 (17%), Positives = 67/222 (30%), Gaps = 37/222 (16%)

Query: 170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229
             +D+M+ +DVS SM +       +++ A       +               GL  F+ +
Sbjct: 86  EGIDIMLAMDVSTSMLAEDLK-PNRMEAAKDVAAEFISG-------RPNDNIGLTIFAGE 137

Query: 230 IEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
                 +      L   ++ +        S  GL      +            +     K
Sbjct: 138 AFTQCPMTTDHQSLLNLLQNVRTD----LSARGLIEDGTAVGMGLANAVSRLKDSKAKSK 193

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI------------------- 330
           +++ +TDG N     D   +   N AK  G  VY IG+                      
Sbjct: 194 VVILLTDGSNNRG--DLSPMTSANIAKSLGIRVYTIGVGTNKVAPYPMPVAGGIQYVNIP 251

Query: 331 --RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                + L   A  +  +FY   N + +   +  I K   TK
Sbjct: 252 VEIDTKTLSGIASVTHGNFYRATNNNELKQIYKDIDKLEKTK 293


>gi|54303502|ref|YP_133495.1| hypothetical protein PBPRB1845 [Photobacterium profundum SS9]
 gi|46916932|emb|CAG23695.1| conserved hypothetical protein [Photobacterium profundum SS9]
          Length = 321

 Score =  107 bits (267), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 35/220 (15%), Positives = 72/220 (32%), Gaps = 47/220 (21%)

Query: 173 DMMIVLDVSRSMESFFD-----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFS 227
           DM++V+D+S SM           SI ++      +   +E+           + GLV F+
Sbjct: 84  DMLLVVDLSGSMSIEDMIIKNGESIDRLAAVKDVLAEFIEQ-------RKGDRLGLVLFA 136

Query: 228 NKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDA 285
                   L +  + ++++++   L   G ST    GL  A                   
Sbjct: 137 QHAYLQTPLTFDRNTVKQQLERTVLGLIGQSTAIGEGLGIATKTFI-----------NSE 185

Query: 286 NYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV---------------- 329
             +++I+ ++DG N +     + L     A +    +Y +G+                  
Sbjct: 186 APQRVIILLSDGANTAGVI--EPLEAAKLAAESNVTIYTVGVGAEEMIQKSFFGNRKVNP 243

Query: 330 --IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                   L   A  +   ++   NP  +   +  I +  
Sbjct: 244 SQDLDERMLTKIADMTGGQYFRARNPQELEHIYQLIDQLE 283


>gi|312139646|ref|YP_004006982.1| integral membrane protein [Rhodococcus equi 103S]
 gi|311888985|emb|CBH48298.1| putative integral membrane protein [Rhodococcus equi 103S]
          Length = 326

 Score =  107 bits (267), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 31/246 (12%), Positives = 72/246 (29%), Gaps = 30/246 (12%)

Query: 139 LKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMA 198
            +             + + +            R  +++V+DVS SM++      +++  A
Sbjct: 56  TRHLPTALLLVGLVFLTVALAGPTADKRVPRNRATVVLVIDVSLSMKATD-VEPSRLAAA 114

Query: 199 IKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTN 258
            ++  +  + +    +       GLV F+                +  I  L+     T 
Sbjct: 115 QEAAKSFADGLTPGIN------LGLVAFAGTASVLVSPTPNRDETKAAIDNLTLSER-TA 167

Query: 259 STPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSL---YYCNEA 315
           +   +  +   I     +       +      IV ++DG+    +             +A
Sbjct: 168 TGEAIFTSLQSIDT---LAAVLGGSEQAPPARIVLLSDGKQTVPESPDDPRGGFTAARQA 224

Query: 316 KKRGAIVYAIGIRV--------------IRSHEFLRACA--SPNSFYLVENPHSMYDAFS 359
           K +G  +  I                        LR  A  S  +F+   +   + D + 
Sbjct: 225 KDKGVPISTISFGTGYGTVEIEGDRIPVPVDDPSLREIANLSGGNFFTASSLEELRDVYD 284

Query: 360 HIGKDI 365
            + + I
Sbjct: 285 TLEEQI 290


>gi|91216721|ref|ZP_01253686.1| batA protein [Psychroflexus torquis ATCC 700755]
 gi|91185190|gb|EAS71568.1| batA protein [Psychroflexus torquis ATCC 700755]
          Length = 334

 Score =  107 bits (267), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 38/275 (13%), Positives = 80/275 (29%), Gaps = 49/275 (17%)

Query: 122 PQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVS 181
              +G+ +S +++ +  L     +     +  +  P T  V    +    +D+++ +D+S
Sbjct: 42  SSTQGFKMSTLAKLRPLLFILKMLALVLLTIAMARPRTVDVTTKVKKTEGIDIIMAVDIS 101

Query: 182 RSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVS 241
            SM +       +++   K     +E            + GLV ++ +      L    S
Sbjct: 102 ASMLARDL-EPNRLEALKKVAINFIEG-------RPNDRIGLVIYAGESYTKTPLTTDKS 153

Query: 242 HLQRKIKYLSKFG---VSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGE 298
            +   I  L         T    G                +   +     K+I+ +TDGE
Sbjct: 154 IIFNAINDLEYSQNIEGGTAIGMG-----------LATSVNKLKDSKAESKVIILLTDGE 202

Query: 299 NLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI-----------------------RSHEF 335
           N +   D         A +     Y IG+                               
Sbjct: 203 NNAGFID--PKTATQLATEYDIKTYTIGVGSNGMALSPVGIKANGQFEYRNIEVKIDEAL 260

Query: 336 LRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
           L+  A  +   ++   +       +  I     T+
Sbjct: 261 LKTIAESNGGKYFRATDNQKFEAIYEEIDALEKTE 295


>gi|254506100|ref|ZP_05118244.1| von Willebrand factor type A domain protein [Vibrio
           parahaemolyticus 16]
 gi|219550918|gb|EED27899.1| von Willebrand factor type A domain protein [Vibrio
           parahaemolyticus 16]
          Length = 415

 Score =  107 bits (267), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 45/419 (10%), Positives = 106/419 (25%), Gaps = 62/419 (14%)

Query: 9   RNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAAT--QIM 66
                   G   +L A+ +P +F +  +  + +     K  +    + +++  A      
Sbjct: 1   MRKIKKQSGHAALLFAMIIPGLFGIFTLATDGARALQTKARIEDASEIAVLAIAAHNDDN 60

Query: 67  NEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEG 126
            +  G          I     N +               + D I    +      P+   
Sbjct: 61  QDSQGAGSGSRVNRQIATDYLNAYLRDSTQLTGLKVKKYNCDQIAECRAGLARGEPRFFQ 120

Query: 127 YSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMES 186
           Y I   S           I  + +          +          +D++ V D S SM  
Sbjct: 121 YEIEVSSVQDTWFPGNDSIEGFGD----TFSAKGAAVARKYQSEAVDIIFVSDYSGSMAW 176

Query: 187 FFDSSITK-IDMAIKSINAMLE--EVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHL 243
            +     +        I  + +  +     +  +    GL  F+   +           +
Sbjct: 177 NWSGGRNRKYIDLRNIIQEVTDELQKFNDLNNTDNNTVGLTAFNYYTKTVPSNRSNHCFM 236

Query: 244 QRKIK---------------------YLSKFGVS--------TNSTPGLKYAYNQIFDMQ 274
            + +                      Y    G S        T++      +    +   
Sbjct: 237 TQLVNPNGRFSASQTVRNIFVEKNNRYCVNHGDSSRFQDLPLTDNYSSFNNSVRSFYPNH 296

Query: 275 GMRQHCN--------TEDANYKKIIVFMTDGEN----------LSTKEDQQSLYYCNEAK 316
           G               +  N +++++ ++DGE+           +            +  
Sbjct: 297 GTASFQGIIRGAQMLRKGRNPRRLLIVLSDGEDGDPSRHMQLVNAGMCSTIVNTLSGDLT 356

Query: 317 KRG----AIVYAIGIRVIRSHE-FLRACASPNSFYLVENPHS-MYDAFSHIGKDIVTKR 369
             G    A +  +G     +    L+ C    + Y  +N    +      I ++I   +
Sbjct: 357 PDGHKVKARLAVVGFDYDVNKNRALQKCVGAENVYKAQNRDDILNKILELITEEIGHLK 415


>gi|113969745|ref|YP_733538.1| von Willebrand factor, type A [Shewanella sp. MR-4]
 gi|113884429|gb|ABI38481.1| von Willebrand factor, type A [Shewanella sp. MR-4]
          Length = 338

 Score =  107 bits (266), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 31/217 (14%), Positives = 64/217 (29%), Gaps = 38/217 (17%)

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
             D+M+ +D+S SM+        K    +     +   V    +     + GL+ F++  
Sbjct: 83  GRDLMLAVDLSGSMQIEDMVINGK---VVDRFTLIQHVVSEFIERRKGDRIGLILFADHA 139

Query: 231 EEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
                L      + + +K   +   G  T     +  A  +   M               
Sbjct: 140 YLQAPLTQDRRSVAQFLKEAQIGLVGKQTAIGESIALAVKRFDKMDESN----------- 188

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR----------------- 331
           ++++ +TDG N +   D         A  R   +Y +G+                     
Sbjct: 189 RVLILLTDGSNNAGNIDPD--QAAQIAANRKVTIYTVGVGADVMERRTLFGRERVNPSMD 246

Query: 332 -SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                L+  A  +   ++   N   +   +  I K  
Sbjct: 247 LDENQLKHIAEVTHGRYFRARNSQELEQIYQEIDKLE 283


>gi|269968855|ref|ZP_06182838.1| hypothetical protein VMC_42680 [Vibrio alginolyticus 40B]
 gi|269826535|gb|EEZ80886.1| hypothetical protein VMC_42680 [Vibrio alginolyticus 40B]
          Length = 356

 Score =  107 bits (266), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 39/227 (17%), Positives = 78/227 (34%), Gaps = 26/227 (11%)

Query: 159 TSSVKVNSQTDARLDMMIVLDVSRSMESFFD-----SSITKIDMAIKSINAMLEEVKLIP 213
           T   +   +     D+M+V+D+S SM            I+++D A + ++  ++      
Sbjct: 93  TVLGEPQVRESLGRDVMVVVDLSGSMAEPDFTSRTGEKISRLDAAKEVLSEFVQS----- 147

Query: 214 DVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIF 271
                 + GLV F +                  +    ++  G ST+    +  A  ++F
Sbjct: 148 --RKGDRLGLVLFGDAAFVQTPFTADQKVWLELLNQTDVAMAGQSTHLGDAIGLAI-KVF 204

Query: 272 DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR 331
           +          +D N +K+ + +TDG +       + +     AK +G  V+ I +    
Sbjct: 205 EQSDKSSGALEQDQNREKVAIVLTDGNDTG--SFVEPIDAAKVAKAKGVRVHVIAMGDPE 262

Query: 332 -------SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKR 369
                    E +   A  S    +   N   +  A+  IGK      
Sbjct: 263 TIGETALDMETIHRIAKESGGEAFEALNRDELSAAYDEIGKLEPQLY 309


>gi|241667423|ref|ZP_04755001.1| IMP dehydrogenase/GMP reductase:von Willebrand factor, type A
           [Francisella philomiragia subsp. philomiragia ATCC
           25015]
          Length = 333

 Score =  107 bits (266), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 36/217 (16%), Positives = 68/217 (31%), Gaps = 37/217 (17%)

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
             D+M+ +D+S SM                  + ++       D     + GL+ F    
Sbjct: 91  GRDLMMAIDLSGSMAIQDMQKSN--GKMESRFDLVMRVANEFLDTRQGDRVGLILFGTWA 148

Query: 231 EEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
                L + +  +++ +    ++  G  T     +  A  ++    G             
Sbjct: 149 YLQTPLTFDIPTVKKMLDDASIALPGPQTAIGDAIGLAVKKLKRYPGDS----------- 197

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV------------------I 330
           K +V +TDGEN S     Q L     AK+    +Y IG+                     
Sbjct: 198 KALVLLTDGENNSG--ALQPLQAAELAKQYHIKIYTIGLGGGQMMVKTTFGERLVNTSED 255

Query: 331 RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
              E L+  A  +   F+  +N   +   +  I +  
Sbjct: 256 LDTEVLQKIATMTGGKFFRAQNSTDLKQVYESIDQLE 292


>gi|254875972|ref|ZP_05248682.1| conserved hypothetical protein [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254841993|gb|EET20407.1| conserved hypothetical protein [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 339

 Score =  107 bits (266), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 36/217 (16%), Positives = 68/217 (31%), Gaps = 37/217 (17%)

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
             D+M+ +D+S SM                  + ++       D     + GL+ F    
Sbjct: 97  GRDLMMAIDLSGSMAIQDMQKSN--GKMESRFDLVMRVANEFLDTRQGDRVGLILFGTWA 154

Query: 231 EEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
                L + +  +++ +    ++  G  T     +  A  ++    G             
Sbjct: 155 YLQTPLTFDIPTVKKMLDDASIALPGPQTAIGDAIGLAVKKLKRYPGDS----------- 203

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV------------------I 330
           K +V +TDGEN S     Q L     AK+    +Y IG+                     
Sbjct: 204 KALVLLTDGENNSG--ALQPLQAAELAKQYHIKIYTIGLGGGQMMVKTTFGERLVNTSED 261

Query: 331 RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
              E L+  A  +   F+  +N   +   +  I +  
Sbjct: 262 LDTEVLQKIATMTGGKFFRAQNSTDLKQVYESIDQLE 298


>gi|15600942|ref|NP_232572.1| hypothetical protein VCA0172 [Vibrio cholerae O1 biovar eltor str.
           N16961]
 gi|229510539|ref|ZP_04400019.1| protein BatA [Vibrio cholerae B33]
 gi|229517329|ref|ZP_04406774.1| protein BatA [Vibrio cholerae RC9]
 gi|229605140|ref|YP_002875844.1| protein BatA [Vibrio cholerae MJ-1236]
 gi|254286663|ref|ZP_04961618.1| conserved hypothetical protein [Vibrio cholerae AM-19226]
 gi|254850438|ref|ZP_05239788.1| conserved hypothetical protein [Vibrio cholerae MO10]
 gi|255746016|ref|ZP_05419963.1| protein BatA [Vibrio cholera CIRS 101]
 gi|262162145|ref|ZP_06031160.1| protein BatA [Vibrio cholerae INDRE 91/1]
 gi|9657562|gb|AAF96085.1| conserved hypothetical protein [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|150423247|gb|EDN15193.1| conserved hypothetical protein [Vibrio cholerae AM-19226]
 gi|229345365|gb|EEO10338.1| protein BatA [Vibrio cholerae RC9]
 gi|229352984|gb|EEO17924.1| protein BatA [Vibrio cholerae B33]
 gi|229371626|gb|ACQ62048.1| protein BatA [Vibrio cholerae MJ-1236]
 gi|254846143|gb|EET24557.1| conserved hypothetical protein [Vibrio cholerae MO10]
 gi|255735770|gb|EET91168.1| protein BatA [Vibrio cholera CIRS 101]
 gi|262028220|gb|EEY46878.1| protein BatA [Vibrio cholerae INDRE 91/1]
          Length = 318

 Score =  107 bits (266), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 29/219 (13%), Positives = 71/219 (32%), Gaps = 46/219 (21%)

Query: 173 DMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
           D+M+V+D+S SM           + ++    + ++  + +           + GL+ F++
Sbjct: 85  DLMLVVDLSYSMSQEDMQSGQQMVDRLTAVKQVLSEFIAK-------REGDRIGLILFAD 137

Query: 229 KIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
                  L      +  ++    L   G  T    G+  A                +   
Sbjct: 138 HAYLQTPLTLDRQTVANQLNQTVLKLIGTQTAIGEGIGLATKTFI-----------DSDA 186

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV----------------- 329
            +++++ ++DG N +       L   N AK+    +Y +G+                   
Sbjct: 187 PQRVMILLSDGSNTAG--VLDPLEAANIAKQYNTTIYTVGVGAGEMVVKDFLFSRKVNTA 244

Query: 330 -IRSHEFLRACAS--PNSFYLVENPHSMYDAFSHIGKDI 365
                + L+  A+     ++   N   + + +  I +  
Sbjct: 245 QDLDEKTLQTIATTTGGHYFRARNQQDLQNIYDTINQLE 283


>gi|254225237|ref|ZP_04918850.1| conserved hypothetical protein [Vibrio cholerae V51]
 gi|125622336|gb|EAZ50657.1| conserved hypothetical protein [Vibrio cholerae V51]
          Length = 318

 Score =  107 bits (266), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 29/219 (13%), Positives = 72/219 (32%), Gaps = 46/219 (21%)

Query: 173 DMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
           D+M+V+D+S SM           + ++    + ++  + +           + GL+ F++
Sbjct: 85  DLMLVVDLSYSMSQEDMQSGQQMVDRLTAVKQVLSEFIAK-------REGDRIGLILFAD 137

Query: 229 KIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
                  L      +  ++    L   G  T    G+  A                +   
Sbjct: 138 HAYLQTPLTLDRQTVANQLNQAVLKLIGTQTAIGEGIGLATKTFI-----------DSDA 186

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV----------------- 329
            +++++ ++DG N +       L   N AK+    +Y +G+                   
Sbjct: 187 PQRVMILLSDGSNTAG--VLDPLEAANIAKQYHTTIYTVGVGAGEMVVKDFLFSRKVNTS 244

Query: 330 -IRSHEFLRACAS--PNSFYLVENPHSMYDAFSHIGKDI 365
                + L++ A+     ++   N   + + +  I +  
Sbjct: 245 QDLDEKTLQSIATTTGGHYFRARNQQDLQNIYDTINQLE 283


>gi|108799422|ref|YP_639619.1| hypothetical protein Mmcs_2455 [Mycobacterium sp. MCS]
 gi|119868535|ref|YP_938487.1| hypothetical protein Mkms_2500 [Mycobacterium sp. KMS]
 gi|126435076|ref|YP_001070767.1| hypothetical protein Mjls_2492 [Mycobacterium sp. JLS]
 gi|122976988|sp|Q1B971|Y2455_MYCSS RecName: Full=UPF0353 protein Mmcs_2455
 gi|166987492|sp|A3PZE9|Y2492_MYCSJ RecName: Full=UPF0353 protein Mjls_2492
 gi|166987495|sp|A1UFT9|Y2500_MYCSK RecName: Full=UPF0353 protein Mkms_2500
 gi|108769841|gb|ABG08563.1| von Willebrand factor, type A [Mycobacterium sp. MCS]
 gi|119694624|gb|ABL91697.1| von Willebrand factor, type A [Mycobacterium sp. KMS]
 gi|126234876|gb|ABN98276.1| von Willebrand factor, type A [Mycobacterium sp. JLS]
          Length = 335

 Score =  107 bits (266), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 34/249 (13%), Positives = 75/249 (30%), Gaps = 30/249 (12%)

Query: 141 FCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIK 200
               I    +   + + +    +       R  +M+V+DVS+SM +    S +++  A +
Sbjct: 66  HLPAILLVASLVLLTVAMAGPTRDVRVPRNRAVVMLVIDVSQSMRATD-VSPSRLAAAQE 124

Query: 201 SINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNST 260
           +     +E+    +       GL+ ++                +  I  L      T + 
Sbjct: 125 ASKQFADELTPGIN------LGLIAYAGTATVLVSPTTNREATKTAIDKLQ-LADRTATG 177

Query: 261 PGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSL---YYCNEAKK 317
            G+  A   I  +          D      IV  +DG+                   AK 
Sbjct: 178 EGIFTALQAIATV---GAVIGGGDEPPPARIVLFSDGKETVPSNPDNPKGAFTAARTAKD 234

Query: 318 RGAIVYAIGIRVIR--------------SHEFLRACA--SPNSFYLVENPHSMYDAFSHI 361
           +G  +  I                      + L+  A  S    +   +   + + ++++
Sbjct: 235 QGVPISTISFGTPYGYVEINEQRQPVPVDDQMLKKIADLSEGEAFTASSLEQLREVYANL 294

Query: 362 GKDIVTKRI 370
            + I  + I
Sbjct: 295 QQQIGYETI 303


>gi|254229828|ref|ZP_04923234.1| von Willebrand factor, type A [Vibrio sp. Ex25]
 gi|262395606|ref|YP_003287459.1| protein BatA [Vibrio sp. Ex25]
 gi|151937664|gb|EDN56516.1| von Willebrand factor, type A [Vibrio sp. Ex25]
 gi|262339200|gb|ACY52994.1| protein BatA [Vibrio sp. Ex25]
          Length = 356

 Score =  107 bits (266), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 38/227 (16%), Positives = 78/227 (34%), Gaps = 26/227 (11%)

Query: 159 TSSVKVNSQTDARLDMMIVLDVSRSMESFFD-----SSITKIDMAIKSINAMLEEVKLIP 213
           T   +   +     D+M+V+D+S SM            I+++D A + +   ++      
Sbjct: 93  TVLGEPQVRESLGRDVMVVVDLSGSMAEPDFTSRTGEKISRLDAAKEVLTEFVQS----- 147

Query: 214 DVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIF 271
                 + GLV F +                  +    ++  G ST+    +  A  ++F
Sbjct: 148 --RKGDRLGLVLFGDAAFVQTPFTVDQKVWLELLNQTDVAMAGQSTHLGDAIGLAI-KVF 204

Query: 272 DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR 331
           +     +    +D N +K+ + +TDG +       + +     AK +G  V+ I +    
Sbjct: 205 EQSDKSRGALEQDQNREKVAIVLTDGNDTG--SFVEPIDAAKVAKAKGVRVHVIAMGDPE 262

Query: 332 -------SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKR 369
                    + +   A  S    +   N   +  A+  IGK      
Sbjct: 263 TIGETALDMDTIHRIAKESGGEAFEALNRDELSAAYDEIGKLEPQLY 309


>gi|167626845|ref|YP_001677345.1| IMP dehydrogenase/GMP reductase:von Willebrand factor, type A
           [Francisella philomiragia subsp. philomiragia ATCC
           25017]
 gi|167596846|gb|ABZ86844.1| IMP dehydrogenase/GMP reductase:von Willebrand factor, type A
           [Francisella philomiragia subsp. philomiragia ATCC
           25017]
          Length = 333

 Score =  107 bits (266), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 36/217 (16%), Positives = 68/217 (31%), Gaps = 37/217 (17%)

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
             D+M+ +D+S SM                  + ++       D     + GL+ F    
Sbjct: 91  GRDLMMAIDLSGSMAIQDMQKSN--GKMESRFDLVMRVANEFLDTRQGDRVGLILFGTWA 148

Query: 231 EEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
                L + +  +++ +    ++  G  T     +  A  ++    G             
Sbjct: 149 YLQTPLTFDIPTVKKMLDDASIALPGPQTAIGDAIGLAVKKLKRYPGDS----------- 197

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV------------------I 330
           K +V +TDGEN S     Q L     AK+    +Y IG+                     
Sbjct: 198 KALVLLTDGENNSG--ALQPLQAAELAKQYHIKIYTIGLGGGQMMVKTTFGERLVNTSED 255

Query: 331 RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
              E L+  A  +   F+  +N   +   +  I +  
Sbjct: 256 LDTEVLQKIATMTGGKFFRAQNSADLKQVYESIDQLE 292


>gi|260901770|ref|ZP_05910165.1| von Willebrand factor type A domain protein [Vibrio
           parahaemolyticus AQ4037]
 gi|308108909|gb|EFO46449.1| von Willebrand factor type A domain protein [Vibrio
           parahaemolyticus AQ4037]
 gi|328470487|gb|EGF41398.1| protein BatA [Vibrio parahaemolyticus 10329]
          Length = 356

 Score =  106 bits (265), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 38/227 (16%), Positives = 78/227 (34%), Gaps = 26/227 (11%)

Query: 159 TSSVKVNSQTDARLDMMIVLDVSRSMESFFD-----SSITKIDMAIKSINAMLEEVKLIP 213
           T   +   +     D+M+V+D+S SM            I+++D A + +   ++      
Sbjct: 93  TVLGEPQVRESLGRDVMVVVDLSGSMAEPDFTSRTGEKISRLDAAKEVLTEFVQS----- 147

Query: 214 DVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIF 271
                 + GLV F +                  +    ++  G ST+    +  A  ++F
Sbjct: 148 --RKGDRLGLVLFGDAAFVQTPFTADQKVWLELLNQTDVAMAGQSTHLGDAIGLAI-KVF 204

Query: 272 DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR 331
           +     +    +D N +K+ + +TDG +       + +     AK +G  V+ I +    
Sbjct: 205 EQSDKSRGALEQDQNREKVAIVLTDGNDTG--SFVEPIDAAKVAKAKGVRVHVIAMGDPE 262

Query: 332 -------SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKR 369
                    + +   A  S    +   N   +  A+  IGK      
Sbjct: 263 TIGETALDMDTIHRIAKESGGEAFEALNRDELSAAYDEIGKLEPQLY 309


>gi|312621140|ref|YP_004022753.1| yd repeat protein [Caldicellulosiruptor kronotskyensis 2002]
 gi|312201607|gb|ADQ44934.1| YD repeat protein [Caldicellulosiruptor kronotskyensis 2002]
          Length = 2994

 Score =  106 bits (265), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 47/206 (22%), Positives = 78/206 (37%), Gaps = 32/206 (15%)

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
           ++D++ VLD S SM S   +   +I+   K I  + E            + GLV F + +
Sbjct: 766 KVDIVFVLDNSGSMSSNDPNY-YRIEATKKFIQNIDEL---------NNRVGLVDFDSSV 815

Query: 231 EEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKI 290
                L    + L + +  +   G STN   GLK A                +    KKI
Sbjct: 816 YVRSNLTSDKNKLLQALNAMRWTGGSTNIGGGLKAALELF------------DQEQSKKI 863

Query: 291 IVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA--SPNSFYLV 348
           IV ++DG + +       L    E  K+  +V  I +      E L   A  +   ++ V
Sbjct: 864 IVLLSDGYHNTGIHPNDVL---PELIKQEIVVNTIALGKDCDRELLHDIADKTKGDYFYV 920

Query: 349 ENPHSMYDAFSHIGKDIVTKRIWYDK 374
           +N   +      + K I    + Y+K
Sbjct: 921 DNTGGLSQ--EDVDKQI---ELIYEK 941


>gi|114046974|ref|YP_737524.1| von Willebrand factor, type A [Shewanella sp. MR-7]
 gi|113888416|gb|ABI42467.1| von Willebrand factor, type A [Shewanella sp. MR-7]
          Length = 338

 Score =  106 bits (265), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 30/217 (13%), Positives = 64/217 (29%), Gaps = 38/217 (17%)

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
             D+M+ +D+S SM+        K    +     +   V    +     + GL+ F++  
Sbjct: 83  GRDLMLAVDLSGSMQIEDMVINGK---VVDRFTLIQHVVSEFIERRKGDRIGLILFADHA 139

Query: 231 EEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
                L      + + +K   +   G  T     +  A  +   M               
Sbjct: 140 YLQAPLTQDRRSVAQFLKEAQIGLVGKQTAIGESIALAVKRFDKMDESN----------- 188

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR----------------- 331
           ++++ +TDG N +     +       A  R   +Y +G+                     
Sbjct: 189 RVLILLTDGSNNAGNI--EPEQAAQIAANRKVTIYTVGVGADVMERRTLFGRERVNPSMD 246

Query: 332 -SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                L+  A  +   ++   N   +   +  I K  
Sbjct: 247 LDENQLKHIADVTHGRYFRARNSQELEQIYQEIDKLE 283


>gi|301058342|ref|ZP_07199375.1| von Willebrand factor type A domain protein [delta proteobacterium
           NaphS2]
 gi|300447578|gb|EFK11310.1| von Willebrand factor type A domain protein [delta proteobacterium
           NaphS2]
          Length = 331

 Score =  106 bits (265), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 43/286 (15%), Positives = 87/286 (30%), Gaps = 53/286 (18%)

Query: 117 DIVVVPQNEGYSISAISRY--KIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQT------ 168
             +  P+   YS++A               IP    +  +++ I  + +           
Sbjct: 24  SFLKKPEGITYSMAASMAAFSDGGSNLVPRIPKILRACTLLLLIVVAARPQLYNVSRDVH 83

Query: 169 DARLDMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
              +D+M+ LD S SM++        S+T+++   K +   + +           + GLV
Sbjct: 84  SPGVDIMLCLDTSGSMQALDFKVEGKSVTRLEAVKKVVADFIGK-------RETDRIGLV 136

Query: 225 TFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
            F  +      L      L   +  +        +  G   A                + 
Sbjct: 137 VFGEEAFTQSPLTIDKGLLLELVNRMKIGMAGDRTAIGSAIAI---------GGKRLKDL 187

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR---------------- 328
            +  KI++ +TDG N + +   Q        ++ G  +Y IG+                 
Sbjct: 188 KSKSKILILLTDGRNNAGEISPQ--AAARAVREFGIKLYTIGVGGKGPAPFRMKTLFGTR 245

Query: 329 -----VIRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVT 367
                V      LR  A      ++   N   + + +  I +   T
Sbjct: 246 LVPQHVDLDEVTLRNVAKTGGGKYFRAANSQELQEIYDIIDRAEKT 291


>gi|261251589|ref|ZP_05944163.1| hypothetical protein VIA_001610 [Vibrio orientalis CIP 102891]
 gi|260938462|gb|EEX94450.1| hypothetical protein VIA_001610 [Vibrio orientalis CIP 102891]
          Length = 396

 Score =  106 bits (265), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 46/386 (11%), Positives = 101/386 (26%), Gaps = 34/386 (8%)

Query: 6   LNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQI 65
           ++         G + I     L  + +     I + +   +        D + +      
Sbjct: 1   MHFNQSISKQHGSVAISYLAMLIPMIIAAASTIVIGYQVQLSNRGMQATDAASLACEFSG 60

Query: 66  MNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDD--IVRSTSLDIVVVPQ 123
             +G             + ++           +  +  ++ I     +   S  +     
Sbjct: 61  EYDGTMAQGYLDYYRPKIDKVSGQIGTHSGCNVSLSYSLSTIFTSLTLSDASFVVSSTAN 120

Query: 124 NEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPI----------TSSVKVNSQTDARLD 173
            + Y    ++   + L     I     S    +                   S+   ++ 
Sbjct: 121 EKAYVTEDVASEPLELILVLDISGSMASDLDDLKAILKRGLASLKEQQNNALSKDHIKVS 180

Query: 174 MMIVLDVSRSMESFFDSSI------------TKIDMAIKSINAMLEEVKLIPDVNNVVQS 221
           ++   D      + + +               K   A    N +       P        
Sbjct: 181 IVPFSDGVSVNNAPWLNETGTFCVEGITESGGKFSAAHTVAN-LDITHDQTPVKTFQPDK 239

Query: 222 GLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQH-- 279
            L+  S       L    ++ +   +  L   G  T S  GL +   Q+           
Sbjct: 240 WLMDCSAMSVTLPLTA-DLNQVTNAVDSLRTEG-GTASYQGLIWGLRQLTPNWQKAWEVG 297

Query: 280 CNTEDANYKKIIVFMTDGENLSTKEDQQSLYY--CNEAKKRGAIVYAIGIRVIRSH-EFL 336
            N      ++ +V MTDG +       + +    C+ AK  G  +  +G  V  +  E  
Sbjct: 298 PNRNFDKVERKLVLMTDGAD-YGSHFDELINAGLCDRAKDYGVALNFVGFGVYGARLEQF 356

Query: 337 RACASPNS-FYLVENPHSMYDAFSHI 361
             CA   +  +   N   +   FS +
Sbjct: 357 TRCAGDANGVFSASNTQELDSYFSQL 382


>gi|163800205|ref|ZP_02194106.1| hypothetical protein 1103602000595_AND4_05979 [Vibrio sp. AND4]
 gi|159175648|gb|EDP60442.1| hypothetical protein AND4_05979 [Vibrio sp. AND4]
          Length = 334

 Score =  106 bits (265), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 29/224 (12%), Positives = 72/224 (32%), Gaps = 46/224 (20%)

Query: 168 TDARLDMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGL 223
                DMM+++D+S SM+    +     I ++    + ++  +E+           + G+
Sbjct: 93  QPKYRDMMLLVDLSGSMQKEDMNDNGEYIDRLTAVKRVLSDFVEK-------RQGDRLGV 145

Query: 224 VTFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCN 281
           V F +       L      + ++I    +   G  T    G+                  
Sbjct: 146 VLFGDHAYLQTPLTADRRTVMQQINQAVIGLVGERTAIGDGIGLGTKTFV---------- 195

Query: 282 TEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR------------- 328
            +    +++++ ++DG N +     + L     A+K  A +Y +G+              
Sbjct: 196 -DSDAPQRVMILLSDGSNTAG--VLEPLEATEIAQKYNATIYTVGVGAGEMMVKDFFMTR 252

Query: 329 -----VIRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                     + L   A  +   ++   +   +   +  I +  
Sbjct: 253 KVNTASDLDEQTLTKIAEMTGGKYFRARDAKELEAIYDTINQLE 296


>gi|90414549|ref|ZP_01222523.1| hypothetical protein P3TCK_02206 [Photobacterium profundum 3TCK]
 gi|90324356|gb|EAS40922.1| hypothetical protein P3TCK_02206 [Photobacterium profundum 3TCK]
          Length = 321

 Score =  106 bits (265), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 34/220 (15%), Positives = 71/220 (32%), Gaps = 47/220 (21%)

Query: 173 DMMIVLDVSRSMESFFD-----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFS 227
           DM++ +D+S SM           SI ++      +   +E+           + GLV F+
Sbjct: 84  DMLLAVDLSGSMSIEDMITQSGESIDRLAAVKDVLAEFIEQ-------RKGDRLGLVLFA 136

Query: 228 NKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDA 285
                   L +  + ++++++   L   G ST    GL  A                   
Sbjct: 137 QHAYLQTPLTFDRNTVKQQLERTVLGLIGQSTAIGEGLGIATKTFI-----------NSE 185

Query: 286 NYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV---------------- 329
             +++I+ ++DG N +     + L     A +    +Y +G+                  
Sbjct: 186 APQRVIILLSDGANTAGVI--EPLEAAKLAAESNVTIYTVGVGAEEMIQKSFFGNRKVNP 243

Query: 330 --IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                   L   A  +   ++   NP  +   +  I +  
Sbjct: 244 SQDLDERMLTKIADMTGGQYFRARNPQELEHIYQLIDQLE 283


>gi|153836342|ref|ZP_01989009.1| von Willebrand factor, type A [Vibrio parahaemolyticus AQ3810]
 gi|149750244|gb|EDM60989.1| von Willebrand factor, type A [Vibrio parahaemolyticus AQ3810]
          Length = 356

 Score =  106 bits (265), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 38/227 (16%), Positives = 78/227 (34%), Gaps = 26/227 (11%)

Query: 159 TSSVKVNSQTDARLDMMIVLDVSRSMESFFD-----SSITKIDMAIKSINAMLEEVKLIP 213
           T   +   +     D+M+V+D+S SM            I+++D A + +   ++      
Sbjct: 93  TVLGEPQVRESLGRDVMVVVDLSGSMAEPDFTSRTGEKISRLDAAKEVLTEFVQS----- 147

Query: 214 DVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIF 271
                 + GLV F +                  +    ++  G ST+    +  A  ++F
Sbjct: 148 --RKGDRLGLVLFGDAAFVQTPFTADQKVWLELLNQTDVAMAGQSTHLGDAIGLAI-KVF 204

Query: 272 DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR 331
           +     +    +D N +K+ + +TDG +       + +     AK +G  V+ I +    
Sbjct: 205 EQSDKSRGALEQDQNREKVAIVLTDGNDTG--SFVEPIDAAKVAKAKGVRVHVIAMGDPE 262

Query: 332 -------SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKR 369
                    + +   A  S    +   N   +  A+  IGK      
Sbjct: 263 TIGETALDMDTIHRIAKESGGEAFEALNRDELSAAYDEIGKLEPQLY 309


>gi|153802375|ref|ZP_01956961.1| conserved hypothetical protein [Vibrio cholerae MZO-3]
 gi|124122094|gb|EAY40837.1| conserved hypothetical protein [Vibrio cholerae MZO-3]
          Length = 318

 Score =  106 bits (265), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 28/219 (12%), Positives = 71/219 (32%), Gaps = 46/219 (21%)

Query: 173 DMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
           D+M+V+D+S SM           + ++    + ++  + +           + GL+ F++
Sbjct: 85  DLMLVVDLSYSMSQEDMQSGQQMVDRLTAVKQVLSEFIAK-------REGDRIGLILFAD 137

Query: 229 KIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
                  L      +  ++    L   G  T    G+  A                +   
Sbjct: 138 HAYLQTPLTLDRQTVANQLNQAVLKLIGTQTAIGEGIGLATKTFI-----------DSDA 186

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV----------------- 329
            +++++ ++DG N +       L   + AK+    +Y +G+                   
Sbjct: 187 PQRVMILLSDGSNTAG--VLDPLEAADIAKQYHTTIYTVGVGAGEMVVKDFLFSRKVNTA 244

Query: 330 -IRSHEFLRACAS--PNSFYLVENPHSMYDAFSHIGKDI 365
                + L+  A+     ++   N   + + +  I +  
Sbjct: 245 QDLDEKTLQTIATTTGGHYFRARNQQDLQNIYDTINQLE 283


>gi|87310694|ref|ZP_01092822.1| BatA [Blastopirellula marina DSM 3645]
 gi|87286675|gb|EAQ78581.1| BatA [Blastopirellula marina DSM 3645]
          Length = 355

 Score =  106 bits (265), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 36/238 (15%), Positives = 77/238 (32%), Gaps = 40/238 (16%)

Query: 163 KVNSQTDARLDMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNV 218
           +     +  + + +V+D S SM++         + ++    K     +     + D    
Sbjct: 76  EQAIVENDGIAIEMVVDRSGSMQAMDFQLGDEHVDRLTAIKKVAGDFVTGGDNL-DGRLS 134

Query: 219 VQSGLVTFSNKIEEFFLLEWGVSHLQRKIKY----LSKFGVSTNSTPGLKYAYNQIFDMQ 274
              GL+TF+   +         + L  ++ +     ++    T     +  A       +
Sbjct: 135 DLVGLITFAGYADGVTPPTLDHAFLVSQLNHSQIVTNRSEDGTAIGDAISLAVE-----K 189

Query: 275 GMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV----- 329
                   ++    KII+ +TDGEN +   D + +     A+  G  VY IG+       
Sbjct: 190 LNALDARRKEKIQSKIIILLTDGENNAG--DLEPIQAAELAQTMGIKVYTIGVGTKGRAP 247

Query: 330 -----------------IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                                E L+  A  +   ++   +  S+   +  I +   TK
Sbjct: 248 MPVTDMFGRQSMQWMSVNIDEETLQKVASITGGKYFRATDTDSLAKIYGEIDQLEKTK 305


>gi|91225506|ref|ZP_01260628.1| hypothetical protein V12G01_09265 [Vibrio alginolyticus 12G01]
 gi|91189869|gb|EAS76142.1| hypothetical protein V12G01_09265 [Vibrio alginolyticus 12G01]
          Length = 356

 Score =  106 bits (265), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 38/227 (16%), Positives = 79/227 (34%), Gaps = 26/227 (11%)

Query: 159 TSSVKVNSQTDARLDMMIVLDVSRSMESFFD-----SSITKIDMAIKSINAMLEEVKLIP 213
           T   +   +     D+M+V+D+S SM            I+++D A + ++  ++      
Sbjct: 93  TVLGEPQVRESLGRDVMVVVDLSGSMAEPDFTSRTGEKISRLDAAKEVLSEFVQS----- 147

Query: 214 DVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIF 271
                 + GLV F +                  +    ++  G ST+    +  A  ++F
Sbjct: 148 --RKGDRLGLVLFGDAAFVQTPFTADQKVWLELLNQTDVAMAGQSTHLGDAIGLAI-KVF 204

Query: 272 DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR 331
           +     +    +D N +K+ + +TDG +       + +     AK +G  V+ I +    
Sbjct: 205 EQSDQSRGALEQDQNREKVAIVLTDGNDTG--SFVEPIDAAKVAKAKGVRVHVIAMGDPE 262

Query: 332 -------SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKR 369
                    + +   A  S    +   N   +  A+  IGK      
Sbjct: 263 TIGETALDMDTIHRIAKESGGEAFEALNRDELSAAYDEIGKLEPQLY 309


>gi|117919904|ref|YP_869096.1| von Willebrand factor, type A [Shewanella sp. ANA-3]
 gi|117612236|gb|ABK47690.1| von Willebrand factor, type A [Shewanella sp. ANA-3]
          Length = 338

 Score =  106 bits (265), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 30/217 (13%), Positives = 64/217 (29%), Gaps = 38/217 (17%)

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
             D+M+ +D+S SM+        K    +     +   V    +     + GL+ F++  
Sbjct: 83  GRDLMLAVDLSGSMQIEDMVINGK---VVDRFTLIQHVVSEFIERRKGDRIGLILFADHA 139

Query: 231 EEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
                L      + + +K   +   G  T     +  A  +   M               
Sbjct: 140 YLQAPLTQDRRSVAQFLKEAQIGLVGKQTAIGESIALAVKRFDKMDESN----------- 188

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR----------------- 331
           ++++ +TDG N +     +       A  R   +Y +G+                     
Sbjct: 189 RVLILLTDGSNNAGNI--EPEQAAQIAANRKVTIYTVGVGADVMERRTLFGRERVNPSMD 246

Query: 332 -SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                L+  A  +   ++   N   +   +  I K  
Sbjct: 247 LDENQLKHIADVTHGRYFRARNSQELEQIYQEIDKLE 283


>gi|28900543|ref|NP_800198.1| hypothetical protein VPA0688 [Vibrio parahaemolyticus RIMD 2210633]
 gi|260365425|ref|ZP_05777962.1| von Willebrand factor type A domain protein [Vibrio
           parahaemolyticus K5030]
 gi|260877490|ref|ZP_05889845.1| von Willebrand factor type A domain protein [Vibrio
           parahaemolyticus AN-5034]
 gi|260894838|ref|ZP_05903334.1| von Willebrand factor type A domain protein [Vibrio
           parahaemolyticus Peru-466]
 gi|28808923|dbj|BAC62031.1| conserved hypothetical protein [Vibrio parahaemolyticus RIMD
           2210633]
 gi|308085296|gb|EFO34991.1| von Willebrand factor type A domain protein [Vibrio
           parahaemolyticus Peru-466]
 gi|308090935|gb|EFO40630.1| von Willebrand factor type A domain protein [Vibrio
           parahaemolyticus AN-5034]
 gi|308114289|gb|EFO51829.1| von Willebrand factor type A domain protein [Vibrio
           parahaemolyticus K5030]
          Length = 356

 Score =  106 bits (265), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 38/227 (16%), Positives = 78/227 (34%), Gaps = 26/227 (11%)

Query: 159 TSSVKVNSQTDARLDMMIVLDVSRSMESFFD-----SSITKIDMAIKSINAMLEEVKLIP 213
           T   +   +     D+M+V+D+S SM            I+++D A + +   ++      
Sbjct: 93  TVLGEPQVRESLGRDVMVVVDLSGSMAEPDFTSRTGEKISRLDAAKEVLTEFVQS----- 147

Query: 214 DVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIF 271
                 + GLV F +                  +    ++  G ST+    +  A  ++F
Sbjct: 148 --RKGDRLGLVLFGDAAFVQTPFTADQKVWLELLNQTDVAMAGQSTHLGDAIGLAI-KVF 204

Query: 272 DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR 331
           +     +    +D N +K+ + +TDG +       + +     AK +G  V+ I +    
Sbjct: 205 EQSDKSRGALEQDQNREKVAIVLTDGNDTG--SFVEPIDAAKVAKAKGVRVHVIAMGDPE 262

Query: 332 -------SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKR 369
                    + +   A  S    +   N   +  A+  IGK      
Sbjct: 263 TIGETALDMDTIHRIAKESGGEAFEALNRDELSAAYDEIGKLEPQLY 309


>gi|332817903|ref|XP_003310057.1| PREDICTED: collagen alpha-6(VI) chain [Pan troglodytes]
          Length = 2263

 Score =  106 bits (264), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 40/272 (14%), Positives = 89/272 (32%), Gaps = 28/272 (10%)

Query: 109 DIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQT 168
           +    T L+ +     E Y     +   +     TF+    N     + + S      ++
Sbjct: 368 EGASDTQLEKIASHPAEQYVSKLKTFADLAAHNQTFLKKLRNQITHTVSVFSERTETLKS 427

Query: 169 D----ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
                   D+ +++D S S ++     +       + +         +       + G V
Sbjct: 428 GCVDTEEADIYLLIDGSGSTQATDFHEMK--TFLSEVVGMFNIAPHKV-------RVGAV 478

Query: 225 TFSNKIEEFF--LLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +++  +  F          L + I+ + + G +TN+   L +  + +      +     
Sbjct: 479 QYADSWDLEFEINKYSNKQDLGKAIENIRQMGGNTNTGAALNFTLSLL-----QKAKKQR 533

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
            +     ++V        +       L   N  ++    VYAIGI    +   LR  A  
Sbjct: 534 GNKVPCHLVVL------TNGMSKDSILEPANRLREEHIRVYAIGI-KEANQTQLREIAGE 586

Query: 343 N-SFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
               Y V N  ++ D  + + ++I T+    D
Sbjct: 587 EKRVYYVHNFDALKDIRNQVVQEICTEEACKD 618



 Score = 83.4 bits (204), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 36/334 (10%), Positives = 97/334 (29%), Gaps = 26/334 (7%)

Query: 39   EVSHIFFMKTVLHSMIDRS---LVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFR 95
            +      + +VL +  D++     + A  +    +     +    +              
Sbjct: 865  DFGTKLEVISVLQN--DQAMGGSTYTAEALGFSDHMFTEARGSRLNKGVPQVLIVITDGE 922

Query: 96   NELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIV 155
            +   D           +   +  V +       + A++       F             V
Sbjct: 923  SHDADKLNATAKALRDKGILVLAVGIDGANPMELLAMAGSSDKYFFVETFGGLKGIFSDV 982

Query: 156  MPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDV 215
                 +         ++D++ ++D S S++              K    +   V+     
Sbjct: 983  TASVCNSSKVDCEIDKVDLVFLMDGSTSIQPNDF---------KKMKEFLASVVQDFDVS 1033

Query: 216  NNVVQSGLVTFSNKIEEFFL--LEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM 273
             N V+ G   FS+     F      G   +  +I+ + +   +T+          +  + 
Sbjct: 1034 LNRVRIGAAQFSDTYHPEFPLGTFIGEKEISFQIENIKQIFGNTHIGAA-----LREVEH 1088

Query: 274  QGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSH 333
                   +  +    ++++ +TD      +   +        + RG  +Y++GI  +   
Sbjct: 1089 YFRPDMGSRINTGTPQVLLVLTD-----GQSQDEVAQAAEALRHRGIDIYSVGIGDVDDQ 1143

Query: 334  EFLRACASPNSFYLVENPHSMYDAFSHIGKDIVT 367
            + ++   +      V N   +      I ++I T
Sbjct: 1144 QLIQITGTAEKKLTVHNFDELKKVNKRIVRNICT 1177



 Score = 81.4 bits (199), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 48/334 (14%), Positives = 107/334 (32%), Gaps = 30/334 (8%)

Query: 44  FFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGF 103
           F  ++ + + ID+  +    Q    G+  +              N           +   
Sbjct: 679 FMSQSDISNAIDQ--MAHIGQTTLTGSALSFVSQYFSPTKGARPNIRKFLILITDGEAQD 736

Query: 104 VNDIDDIVRSTSLDIVVVPQNEGYSIS----AISRYKIPLKFCTFIPWYTNSRHIVMPIT 159
           +     +V      I+      G +++       R ++      F         +V  I 
Sbjct: 737 IVKEPAVVLRQEGVIIYSVGVFGSNVTQLEEISGRPEMVFYVENFDILQRIEDDLVFGI- 795

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSI--TKIDMAIKSINAMLEEVKLIPDVNN 217
            S +   +    LD++ V+D S S++    + +    I +  K+               N
Sbjct: 796 CSPREECKRIEVLDVVFVIDSSGSIDYDEYNIMKDFMIGLVKKA-----------DVGKN 844

Query: 218 VVQSGLVTFSNKIEEFFL--LEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQG 275
            V+ G + +++  E  F          +   ++     G ST +   L +      D   
Sbjct: 845 QVRFGALKYADDPEVLFYLDDFGTKLEVISVLQNDQAMGGSTYTAEALGF-----SDHMF 899

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF 335
                +  +    ++++ +TDGE+    +  +        + +G +V A+GI      E 
Sbjct: 900 TEARGSRLNKGVPQVLIVITDGESH---DADKLNATAKALRDKGILVLAVGIDGANPMEL 956

Query: 336 LRACASPNSFYLVENPHSMYDAFSHIGKDIVTKR 369
           L    S + ++ VE    +   FS +   +    
Sbjct: 957 LAMAGSSDKYFFVETFGGLKGIFSDVTASVCNSS 990



 Score = 56.8 bits (135), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 36/313 (11%), Positives = 93/313 (29%), Gaps = 32/313 (10%)

Query: 31  FLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTW 90
           F  +G  +++          +           +   N  +      +         ++  
Sbjct: 98  FGFIGGSLQIGKALQEAHRTY----------FSAPTNGRDKKQFPPILVVLASSESEDDV 147

Query: 91  NMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTN 150
             + +   +D   +  +     S      +      +++  +    +  +  T I     
Sbjct: 148 EEASKALRKDGVKIISVGVQKASEENLKAMATSQFHFNLRTVRDLSMFSQNMTHIIKDVT 207

Query: 151 SRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVK 210
                  +        Q  +  D++ +LD+S       + S    D        + E V 
Sbjct: 208 KYK-EGAVDDIFVEACQGPSMADVVFLLDMS------INGSEENFDYLK---GFLEESVS 257

Query: 211 LIPDVNNVVQSGLVTFSNKIEEFFL--LEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYN 268
            +    N ++ GLV +SN+ +      +    S + + I+ LS       +      A  
Sbjct: 258 ALDIKENCMRVGLVAYSNETKVINSLSMGINKSEVLQHIQNLSPRTGKAYTGA----AIK 313

Query: 269 QIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR 328
           ++       ++ + ++    +I V +T         +          ++ G  ++ +GI 
Sbjct: 314 KLRKEVFSARNGSRKNQGVPQIAVLVTH-----RDSEDNVTKAAVNLRREGVTIFTLGIE 368

Query: 329 VIRSHEFLRACAS 341
                + L   AS
Sbjct: 369 GASDTQ-LEKIAS 380



 Score = 46.0 bits (107), Expect = 0.009,   Method: Composition-based stats.
 Identities = 32/201 (15%), Positives = 68/201 (33%), Gaps = 25/201 (12%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D++ ++D S                       + + +  +P   +  +  L  +S+K+  
Sbjct: 27  DVVFLVDSS------DRLGSKSFPFVKM---FITKMISSLPIEADKYRVALAQYSDKLHS 77

Query: 233 FFL--LEWGVSHLQRKI-KYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
            F      G S +   + K     G S      L+ A+   F           +   +  
Sbjct: 78  EFHLSTFKGRSPMLNHLRKNFGFIGGSLQIGKALQEAHRTYF----SAPTNGRDKKQFPP 133

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYL-- 347
           I+V +      S++ +          +K G  + ++G++   S E L+A A+    +   
Sbjct: 134 ILVVLA-----SSESEDDVEEASKALRKDGVKIISVGVQK-ASEENLKAMATSQFHFNLR 187

Query: 348 -VENPHSMYDAFSHIGKDIVT 367
            V +        +HI KD+  
Sbjct: 188 TVRDLSMFSQNMTHIIKDVTK 208


>gi|229522840|ref|ZP_04412254.1| protein BatA [Vibrio cholerae TM 11079-80]
 gi|229340057|gb|EEO05065.1| protein BatA [Vibrio cholerae TM 11079-80]
          Length = 318

 Score =  106 bits (264), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 29/219 (13%), Positives = 71/219 (32%), Gaps = 46/219 (21%)

Query: 173 DMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
           D+M+V+D+S SM           + ++    + ++  + +           + GL+ F++
Sbjct: 85  DLMLVVDLSYSMSQEDMQSGQQMVDRLTAVKQVLSEFIAK-------REGDRIGLILFAD 137

Query: 229 KIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
                  L      +  ++    L   G  T    G+  A                +   
Sbjct: 138 HAYLQTPLTLDRQTVANQLNQAVLKLIGTQTAIGEGIGLATKTFI-----------DSDA 186

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV----------------- 329
            +++++ ++DG N +       L   N AK+    +Y +G+                   
Sbjct: 187 PQRVMILLSDGSNTAG--VLDPLEAANIAKQYHTTIYTVGVGAGEMVVKDFLFSRKVNTA 244

Query: 330 -IRSHEFLRACAS--PNSFYLVENPHSMYDAFSHIGKDI 365
                + L+  A+     ++   N   + + +  I +  
Sbjct: 245 QDLDEKTLQTIATTTGGHYFRARNQQDLQNIYDTINQLE 283


>gi|88704964|ref|ZP_01102676.1| conserved hypothetical protein [Congregibacter litoralis KT71]
 gi|88700659|gb|EAQ97766.1| conserved hypothetical protein [Congregibacter litoralis KT71]
          Length = 344

 Score =  106 bits (264), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 32/223 (14%), Positives = 73/223 (32%), Gaps = 42/223 (18%)

Query: 169 DARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
           ++  D+M+ +D+S SM         ++   I ++  +  +        +  + GL+ F +
Sbjct: 81  NSGRDLMLAVDISGSMRVEDMQVGNRMARRIDAVKQLGSDFM---SRRSGDRLGLILFGS 137

Query: 229 KIEEFFLLEWGVSHLQRKI--KYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
           +      L + +  +QR +    +   G  T     +  A  ++            E   
Sbjct: 138 RAYLQSPLSFDIQTVQRFLLEAQIGFAGQETAIGDAIGLAVKRLQ-----------ERPA 186

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR--------------- 331
             +++V +TDG++ +       L   N A   G  +Y IGI                   
Sbjct: 187 SSRVLVLLTDGQDTA--STVDPLEAANLAADLGVRIYTIGIGADSLTLPGLLGSPLGART 244

Query: 332 -------SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                      L   A  +   ++   +P  +   +  + +  
Sbjct: 245 VNPSADLDESTLIEIARSTGGQYFRARDPEELATVYRLLDQLE 287


>gi|149187170|ref|ZP_01865468.1| hypothetical protein VSAK1_16642 [Vibrio shilonii AK1]
 gi|148838706|gb|EDL55645.1| hypothetical protein VSAK1_16642 [Vibrio shilonii AK1]
          Length = 324

 Score =  106 bits (264), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 34/218 (15%), Positives = 69/218 (31%), Gaps = 46/218 (21%)

Query: 173 DMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
           DMM+V+D+S SM           I ++      ++  +       D     + GLV F++
Sbjct: 86  DMMLVIDLSYSMSQQDMAYQDDYIDRLTAVKHVVSDFV-------DRRKGDRVGLVYFAD 138

Query: 229 KIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
                  L +    ++ ++    L   G  T    G+  A                +   
Sbjct: 139 HAYLQTPLTFDRETVKTQLNQTVLKLIGTQTAIGDGIGLATKTFV-----------DSNA 187

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV----------------- 329
            +++++ ++DG N +       +     AKK G  +Y IG+                   
Sbjct: 188 PQRVMILLSDGSNNAG--VLDPVQAAEIAKKYGTTIYTIGVGAGEMQVKDFFMTRTVNTA 245

Query: 330 -IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKD 364
                + L   A  +   ++   N   +   +  I   
Sbjct: 246 EDLDEKTLIKIANITGGQYFRARNADELATIYDTINAL 283


>gi|315444579|ref|YP_004077458.1| Mg-chelatase subunit ChlD [Mycobacterium sp. Spyr1]
 gi|315262882|gb|ADT99623.1| Mg-chelatase subunit ChlD [Mycobacterium sp. Spyr1]
          Length = 335

 Score =  106 bits (264), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 33/260 (12%), Positives = 77/260 (29%), Gaps = 30/260 (11%)

Query: 130 SAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFD 189
           S   +    ++    +    +     + +         +  R  +M+V+DVS+SM +   
Sbjct: 55  SVAPKQPSRMRHLPAVLMILSLVSFTIAMAGPTHDVRISRNRAVVMLVIDVSQSMRATD- 113

Query: 190 SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKY 249
            +  ++  A ++     +++    +       GL+ ++                +  I  
Sbjct: 114 VAPNRLTAAQEAAKQFADQLTPGIN------LGLIAYAGTATVLVSPTTNRESTKTAIDK 167

Query: 250 LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSL 309
           L      T +  G+  A   I  +          D      +V M+DG+           
Sbjct: 168 LQ-LADRTATGEGIFTALQAIATV---GAVIGGGDEPPPARVVLMSDGKETVPSNPDNPK 223

Query: 310 ---YYCNEAKKRGAIVYAIGIRVIR--------------SHEFLRACA--SPNSFYLVEN 350
                   AK +G  +  +                      E L+  A  S    +   +
Sbjct: 224 GAYTAARTAKDQGVPISTVSFGTPYGYVEINEQRQPVPVDDEMLKKIADLSGGEAFTASS 283

Query: 351 PHSMYDAFSHIGKDIVTKRI 370
              +   F+++ + I  + I
Sbjct: 284 LEQLKQVFTNLQEQIGYETI 303


>gi|53802771|ref|YP_115472.1| batB protein [Methylococcus capsulatus str. Bath]
 gi|53756532|gb|AAU90823.1| putative batB protein [Methylococcus capsulatus str. Bath]
          Length = 328

 Score =  106 bits (264), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 32/229 (13%), Positives = 78/229 (34%), Gaps = 46/229 (20%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSS----ITKIDMAIKSINAMLEEVKLIPDVNNVVQSG 222
           QT +  D+M+ +D+S SM+            +++   +  +A +E         +  + G
Sbjct: 85  QTVSGRDLMLAVDLSGSMDIEDFVVDGEVSNRLEAVKRVASAFIER-------RSGDRIG 137

Query: 223 LVTFSNKIEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHC 280
           L+ F  +      L +    +++ +    +   G  T     +  A              
Sbjct: 138 LILFGEQAYLQVPLTFDRKTVEKLLDEAAIGLAGDKTAIGDAIGLAIK-----------R 186

Query: 281 NTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR--------- 331
             ++   +++++ ++DG N + +   Q L     A + G  +Y IG+             
Sbjct: 187 LRDNPADQRVLILLSDGANTAGQ--VQPLQAAELAAREGLKIYTIGVGADEMIVRDFFGT 244

Query: 332 ---------SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKR 369
                        + A A  +   ++   N   +   ++ + +   T R
Sbjct: 245 RRVNPSEDLDEAAMTAIAEKTGGRYFRARNTEELDRIYALLDRLEPTAR 293


>gi|297579701|ref|ZP_06941628.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|297535347|gb|EFH74181.1| conserved hypothetical protein [Vibrio cholerae RC385]
          Length = 318

 Score =  106 bits (264), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 29/219 (13%), Positives = 71/219 (32%), Gaps = 46/219 (21%)

Query: 173 DMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
           D+M+V+D+S SM           + ++    + ++  + +           + GL+ F++
Sbjct: 85  DLMLVVDLSYSMSQEDMQSGQQMVDRLTAVKQVLSEFIAK-------REGDRIGLILFAD 137

Query: 229 KIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
                  L      +  ++    L   G  T    G+  A                +   
Sbjct: 138 HAYLQTPLTLDRQTVASQLNQAVLKLIGTQTAIGEGIGLATKTFI-----------DSDA 186

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV----------------- 329
            +++++ ++DG N +       L   N AK+    +Y +G+                   
Sbjct: 187 PQRVMILLSDGSNTAG--VLDPLEAANIAKQYHTTIYTVGVGAGEMVVKDFLFSRKVNTA 244

Query: 330 -IRSHEFLRACAS--PNSFYLVENPHSMYDAFSHIGKDI 365
                + L+  A+     ++   N   + + +  I +  
Sbjct: 245 QDLDEKTLQTIATTTGGHYFRARNQQDLQNIYDTINQLE 283


>gi|153214389|ref|ZP_01949360.1| conserved hypothetical protein [Vibrio cholerae 1587]
 gi|124115338|gb|EAY34158.1| conserved hypothetical protein [Vibrio cholerae 1587]
          Length = 318

 Score =  106 bits (264), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 29/219 (13%), Positives = 71/219 (32%), Gaps = 46/219 (21%)

Query: 173 DMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
           D+M+V+D+S SM           + ++    + ++  + +           + GL+ F++
Sbjct: 85  DLMLVVDLSYSMSQEDMQSGQQMVDRLTAVKQVLSEFIAK-------REGDRIGLILFAD 137

Query: 229 KIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
                  L      +  ++    L   G  T    G+  A                +   
Sbjct: 138 HAYLQTPLTLDRQTVANQLNQAVLKLIGTQTAIGEGIGLATKTFI-----------DSDA 186

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV----------------- 329
            +++++ ++DG N +       L   N AK+    +Y +G+                   
Sbjct: 187 PQRVMILLSDGSNTAG--VLDPLEAANIAKQYHTTIYTVGVGAGEMVVKDFLFSRKVNTA 244

Query: 330 -IRSHEFLRACAS--PNSFYLVENPHSMYDAFSHIGKDI 365
                + L+  A+     ++   N   + + +  I +  
Sbjct: 245 QDLDEKTLQTIATTTGGHYFRARNQQDLQNIYDTINQLE 283


>gi|126174972|ref|YP_001051121.1| von Willebrand factor type A [Shewanella baltica OS155]
 gi|125998177|gb|ABN62252.1| von Willebrand factor, type A [Shewanella baltica OS155]
          Length = 339

 Score =  106 bits (264), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 31/217 (14%), Positives = 64/217 (29%), Gaps = 38/217 (17%)

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
             D+M+ +D+S SM+        K    +     +   V    +     + GL+ F++  
Sbjct: 83  GRDLMMAVDLSGSMQIEDMVVNGK---TVDRFTLIQHVVSDFIERRKGDRIGLILFADHA 139

Query: 231 EEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
                L      + + +K   +   G  T     +  A  +   M               
Sbjct: 140 YLQAPLTQDRRSVAQFLKEAQIGLVGKQTAIGEAIGLAVKRFDKMDESN----------- 188

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR----------------- 331
           ++++ +TDG N S     +       A  R   +Y +G+                     
Sbjct: 189 RVLILLTDGSNNSGNI--EPEQAAQIAANRKVTIYTVGVGADVMERRTLFGRERVNPSMD 246

Query: 332 -SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                L+  A  +   ++   N   +   +  I K  
Sbjct: 247 LDENQLKHIAEVTHGRYFRARNSQELDQIYQEIDKLE 283


>gi|262172998|ref|ZP_06040675.1| protein BatA [Vibrio mimicus MB-451]
 gi|261890356|gb|EEY36343.1| protein BatA [Vibrio mimicus MB-451]
          Length = 318

 Score =  106 bits (264), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 29/219 (13%), Positives = 70/219 (31%), Gaps = 46/219 (21%)

Query: 173 DMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
           D+M+V+D+S SM           + ++    + ++  + +           + GL+ F++
Sbjct: 85  DLMLVVDLSYSMSQEDMQSGQQMVDRLTAVKQVLSEFITK-------REGDRVGLILFAD 137

Query: 229 KIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
                  L      +  ++    L   G  T    G+  A                +   
Sbjct: 138 HAYLQTPLTMDRQTVISQLNQAVLKLIGTQTAIGEGIGLATKTFI-----------DSDA 186

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV----------------- 329
            +++++ ++DG N +       L   N AK+    +Y +G+                   
Sbjct: 187 PQRVMILLSDGSNTAG--VLDPLEAANIAKQYQTTIYTVGVGAGEMIVKDFLFSRKVNTA 244

Query: 330 -IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                + L+  A  +   ++   N   +   +  I +  
Sbjct: 245 QDLDEKTLQTIASTTGGQYFRARNQQDLQSIYDTINQLE 283


>gi|170746808|ref|YP_001753068.1| hypothetical protein Mrad2831_0362 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170653330|gb|ACB22385.1| conserved hypothetical protein; putative vWFA domain protein
           [Methylobacterium radiotolerans JCM 2831]
          Length = 437

 Score =  106 bits (264), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 42/418 (10%), Positives = 124/418 (29%), Gaps = 56/418 (13%)

Query: 2   FSLNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHA 61
            +L +    FF    G + +  A+    +       ++       KT L + +D +++  
Sbjct: 10  RALEMVATAFFRARSGQVAVTFALVTLPVMFATAAAVDYGRRNAAKTQLDAALDGAVLAV 69

Query: 62  ATQIMNEGNGNNRKKLKGGDILCRIK----NTWNMSFRNELRDNGFVNDIDDIVRSTSLD 117
            +Q  N       + ++        K       + +    +  +  ++       +    
Sbjct: 70  MSQKTNTIPTTTLQNMETQFRTEAAKVPGVTVTSFTPGAPVNTSKTLSLTASYTATVKTS 129

Query: 118 IVVVPQNEGYSISAISRYKIPL-KFCTFIPWYTNSRHIVMPITSSVKVNSQ-TDARLDMM 175
           +  + Q     +S  S       ++  +     NS  + +  T +   N +         
Sbjct: 130 LASMMQIPAMPVSGTSSATRNTSQYINYYLLLDNSPSMGLAATDADVQNMKIATNGCAFA 189

Query: 176 IV---LDVSRSMESFFDSSIT----------KIDMAIKSINAMLEEVKLIPDVNNVVQSG 222
                 D   ++     +             +I +  ++++A++++  +   +    Q  
Sbjct: 190 CHQHTFDKKGNITGDDQNDNYHIALRNNIKLRIQVLREAVSALVDQANVSMLLPQQFQME 249

Query: 223 LVTFSNKIEE--FFLLEWGVSHLQRK---IKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + TF++ + +     +   +++++     I     +   +++    + A  ++       
Sbjct: 250 MWTFNDSVTQTKLQAMTPTLNNIKNAAPNIDIAYAYYNQSDNQTDFERAIARMNTTIPAS 309

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSL---------------YYCNEAKKRGAI- 321
               T D   + + +     E+       QS                  C+  K +    
Sbjct: 310 GDGLTPDKPIRFLFLVTDGVEDTGGSVTNQSAGFQIQSNRFIGPLSPSTCSALKNKNVKI 369

Query: 322 --VYAIGIRVIRSH--------------EFLRACASPNSFYLVENPHSMYDAFSHIGK 363
             +Y   + +  +                 L+ACAS   ++ V     +  A   +  
Sbjct: 370 GIIYTQYLPIYDNDFYNRYVRPYESQIGPSLQACASDGMYFPVTTNGDITAAMLKLFS 427


>gi|148975506|ref|ZP_01812377.1| hypothetical protein VSWAT3_03061 [Vibrionales bacterium SWAT-3]
 gi|145964934|gb|EDK30185.1| hypothetical protein VSWAT3_03061 [Vibrionales bacterium SWAT-3]
          Length = 357

 Score =  106 bits (264), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 32/225 (14%), Positives = 72/225 (32%), Gaps = 26/225 (11%)

Query: 162 VKVNSQTDARLDMMIVLDVSRSMESFFD-----SSITKIDMAIKSINAMLEEVKLIPDVN 216
            +   +     D+M+V+D+S SM            I+++    + +    +         
Sbjct: 91  GEPQVREQLGRDVMVVVDLSGSMAEQDFTSKQGKKISRLQATKEVLADFAKT-------R 143

Query: 217 NVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDM- 273
              + GL+ F +                  +    ++  G ST+    +  A        
Sbjct: 144 KGDRLGLILFGDAAFVQTPFTADQDVWLELLNQTDVAMAGQSTHLGDAIGLAIKVFEQSG 203

Query: 274 QGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR-- 331
           + M       D   +K+++ +TDG +       + +     AK +G  ++ I +   +  
Sbjct: 204 KQMSAEQAQNDIEREKVVIVLTDGNDTG--SFVEPIDAAKVAKAKGVRIHVIAMGDPQTV 261

Query: 332 -----SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKR 369
                  E ++  A  S    +   N   +  A+  IG+      
Sbjct: 262 GEVALDMETIKRIASESGGEAFEALNRDELSTAYEQIGQLEPQLY 306


>gi|294054315|ref|YP_003547973.1| hypothetical protein Caka_0779 [Coraliomargarita akajimensis DSM
           45221]
 gi|293613648|gb|ADE53803.1| conserved hypothetical protein [Coraliomargarita akajimensis DSM
           45221]
          Length = 345

 Score =  106 bits (264), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 40/239 (16%), Positives = 75/239 (31%), Gaps = 55/239 (23%)

Query: 167 QTDARLDMMIVLDVSRSMESFF----DSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSG 222
           Q    +D+++ LD+S SM +      ++ +T++D A + +   + +           + G
Sbjct: 84  QEAEGIDIVLALDLSGSMRALDLSTRENIVTRLDAAKEVVQEFIGK-------RPHDRIG 136

Query: 223 LVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
           LV F+        L      L++ ++ L   G    S   +  A        G   +   
Sbjct: 137 LVAFAADAFVVSPLTLNHDWLKKNVQRLE-LGDINLSGTAIGTAL-------GASVNRLR 188

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR-------------- 328
           +  +  +I++ +TDGEN S       L     AK     VY I                 
Sbjct: 189 DHESRSRIVILLTDGENNSGT--LSPLSAAEAAKSLNVKVYTIATGRKGRVEVAEMSRDG 246

Query: 329 ------------------VIRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVT 367
                                    LR  A  +   F+       + + +  I +   T
Sbjct: 247 RVIRDRNGNPLYRGRSELSDYDESELREIAKLTGGQFFKASESGDLENIYDEIDELEKT 305


>gi|260774144|ref|ZP_05883059.1| protein BatA [Vibrio metschnikovii CIP 69.14]
 gi|260611105|gb|EEX36309.1| protein BatA [Vibrio metschnikovii CIP 69.14]
          Length = 322

 Score =  106 bits (264), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 32/226 (14%), Positives = 75/226 (33%), Gaps = 46/226 (20%)

Query: 166 SQTDARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQS 221
           + +    DMM+V+D+S SM           I ++    + ++  + +           + 
Sbjct: 79  THSQPHRDMMLVVDLSYSMNQKDMQIGDDYIDRLTAVKQVLSDFIAQ-------RQGDRL 131

Query: 222 GLVTFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQH 279
           GL+ F++       L    + + +++    L   G  T    G+  A             
Sbjct: 132 GLIFFADHAYLQTPLTLDRTTVAQQLNQAVLRLIGTQTAIGDGIGLATKTFI-------- 183

Query: 280 CNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV---------- 329
              E    +++++ ++DG N +       +   + AK+    +Y +G+            
Sbjct: 184 ---ESDAPQRVMILLSDGSNNAG--VLDPIEAAHIAKQYHTTIYTVGVGAGEMMVRDFFM 238

Query: 330 --------IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                       E L+  A  +   ++   + H +   +  I K  
Sbjct: 239 TRRINTAEDLDEETLQKIADLTGGQYFRARDKHDLQTIYQTIDKLE 284


>gi|332884779|gb|EGK05035.1| hypothetical protein HMPREF9456_03188 [Dysgonomonas mossii DSM
           22836]
          Length = 327

 Score =  106 bits (264), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 35/233 (15%), Positives = 72/233 (30%), Gaps = 46/233 (19%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           S    +      +D+++ LD+S +M +   S  T+++ A K  +  +       +     
Sbjct: 76  SVNSSDISKSEGIDIIMALDISGTMMANDFS-PTRLEAAKKVASEFI-------NDRQSD 127

Query: 220 QSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFG--VSTNSTPGLKYAYNQIFDMQGMR 277
           + GLV F+ +      L      L   +  +        T    G               
Sbjct: 128 RIGLVIFAGESFTQCPLTTDHRVLLNLLSEVKFGMIEDGTAIGLG-----------LANS 176

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV-------- 329
            +   +  +  ++++ +TDG N + +     L     A   G  VY IGI          
Sbjct: 177 VNRLKDSQSKSRVVILLTDGSNNAGQI--APLTAAELAASYGIRVYTIGIGSRGTSVARV 234

Query: 330 -------------IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVT 367
                              L   A  +  S++   +  S+   +  I +   +
Sbjct: 235 MTPYGMQSMNVSGDFDERTLTEIASKTGGSYFRATDNTSLSGIYDEIDQMEKS 287


>gi|312131680|ref|YP_003999020.1| von willebrand factor type a [Leadbetterella byssophila DSM 17132]
 gi|311908226|gb|ADQ18667.1| von Willebrand factor type A [Leadbetterella byssophila DSM 17132]
          Length = 328

 Score =  106 bits (263), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 38/214 (17%), Positives = 71/214 (33%), Gaps = 25/214 (11%)

Query: 161 SVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQ 220
           S +      A +D+ I +D+S SM +       +++ A       +E            +
Sbjct: 91  SGESTDSLTAGVDIAIAIDISDSMLAEDLK-PNRLEAAKGMALRFIEG-------RTTDR 142

Query: 221 SGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHC 280
             LV F+ +      L    + L+  +  ++   + T S   L  A +   +        
Sbjct: 143 IALVAFAGETATLSPLTTDYTALKEYLASINTNIIRT-SGTALGMALSSCVNKLRDVAGK 201

Query: 281 NTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI-----RSHEF 335
           +        I + ++DG+N +     ++      AK  G  VY I I           + 
Sbjct: 202 SR-------IAIIISDGDNTAGTIPPET--AVELAKSFGVRVYTIAIGKPGSEEGVDEKT 252

Query: 336 LRACASP--NSFYLVENPHSMYDAFSHIGKDIVT 367
           LR  A      F+   +  S+   F  I     T
Sbjct: 253 LRMLAGGPNGRFFKAADNSSLSKIFDEIDHLEKT 286


>gi|196231436|ref|ZP_03130294.1| von Willebrand factor type A [Chthoniobacter flavus Ellin428]
 gi|196224289|gb|EDY18801.1| von Willebrand factor type A [Chthoniobacter flavus Ellin428]
          Length = 341

 Score =  106 bits (263), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 38/229 (16%), Positives = 74/229 (32%), Gaps = 50/229 (21%)

Query: 171 RLDMMIVLDVSRSMESFFDSSI----TKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
            +D+M+ LDVS SM +   +      +++D+  +     +E            + G++ F
Sbjct: 93  GIDIMLALDVSGSMIAEDFTIGGERASRVDVVKQVTQKFIEA-------RPNDRIGMIAF 145

Query: 227 SNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
           + +      L      L + +    L      T     +     ++ + +          
Sbjct: 146 AARPYLVSPLTLDHGWLIQNLDRVKLGLVEDGTAIGSAIASCTTRLIERK---------- 195

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV--------------- 329
            +  +I+V +TDG+N + K     L     A   G  VY IG                  
Sbjct: 196 DSKSRIVVLLTDGDNNAGK--VSPLTAAEAASALGVKVYTIGAGTKGFAPMPVGRDVFGR 253

Query: 330 --------IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                       + L+  A  +   FY   +  S+   +  I +   TK
Sbjct: 254 KVYQNVKVDVDEDTLKKIADMTKAKFYRATDTKSLTQIYEEIDQLEKTK 302


>gi|258647263|ref|ZP_05734732.1| BatA protein [Prevotella tannerae ATCC 51259]
 gi|260852912|gb|EEX72781.1| BatA protein [Prevotella tannerae ATCC 51259]
          Length = 334

 Score =  106 bits (263), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 41/236 (17%), Positives = 76/236 (32%), Gaps = 53/236 (22%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           +++    +++M+ +DVS SM +      ++I+ A +             +       GL 
Sbjct: 81  SNKETEGINIMMAIDVSTSMLTPDL-PPSRIETAKQVA-------YEFINNRPDDNIGLT 132

Query: 225 TFSNKIEEFFLLEWGVSHLQRKIKYLSKF-------GVSTNSTPGLKYAYNQIFDMQGMR 277
            F  +      L    S L    K ++            T    GL  A + +       
Sbjct: 133 VFGGEAYTQCPLTTDHSALLNMFKQVNCDLQKEGVISPGTAIGMGLSSAVSHLEQ----- 187

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR------ 331
                   +  K+I+ +TDGEN + +     L     AK+ G  +Y I +          
Sbjct: 188 ------SKSKSKVIILLTDGENNAGEIS--PLTAAEMAKRLGIRIYTISVGTDAAVNQTV 239

Query: 332 -----------------SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                              + L A A  +   FY   +   + D + +I +   TK
Sbjct: 240 ATLPNGETYEAAIKQNTDPKTLEAIANSTGGKFYQARSKAKLRDIYQNIDRLEKTK 295


>gi|288800165|ref|ZP_06405624.1| BatA protein [Prevotella sp. oral taxon 299 str. F0039]
 gi|288333413|gb|EFC71892.1| BatA protein [Prevotella sp. oral taxon 299 str. F0039]
          Length = 323

 Score =  106 bits (263), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 39/226 (17%), Positives = 71/226 (31%), Gaps = 39/226 (17%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
           ++   +D+M+ +DVS SM +       +++ A K     +               GL  F
Sbjct: 74  KSVEGIDIMLAMDVSTSMLAEDLK-PNRMEAAKKVAAEFI-------SDRANDNIGLTIF 125

Query: 227 SNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYA-YNQIFDMQGMRQHCNTEDA 285
           + +      +    + L   ++ +      T+       A    +            E  
Sbjct: 126 AGEAFTQCPMTTDHASLLNLLQGVR-----TDIASRGLIADGTAVGMGLANAVSRLKESK 180

Query: 286 NYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI--------------- 330
              K+I+ +TDG N     D   L     AK  G  VY IG+                  
Sbjct: 181 AKSKVIILLTDGSNNMG--DISPLTAAQIAKSLGIRVYTIGVGTNTVAPYPVTVGGTTQY 238

Query: 331 ------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                    + L+  A  +   FY   N   + + ++ I +   TK
Sbjct: 239 VNVPAEIDTKTLKDIAQSTDGGFYRATNNAELKEIYNDIDRLEKTK 284


>gi|325954650|ref|YP_004238310.1| von Willebrand factor type A [Weeksella virosa DSM 16922]
 gi|323437268|gb|ADX67732.1| von Willebrand factor type A [Weeksella virosa DSM 16922]
          Length = 338

 Score =  106 bits (263), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 43/246 (17%), Positives = 74/246 (30%), Gaps = 50/246 (20%)

Query: 154 IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
           +  P    V    ++D  +D+M+ +D S SM +       ++           +E     
Sbjct: 73  LARPRIVDVSTKIKSDKGVDIMLTVDTSLSMLARDL-EPDRLTALKAVAVKFSKE----- 126

Query: 214 DVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFG--VSTNSTPGLKYAYNQIF 271
                 + GLV++S +      L      L R+I  L        T    GL  A N I 
Sbjct: 127 --RQADRLGLVSYSGEALTRVPLTTDREVLIREINALESGELEDGTAIGIGLATAINHI- 183

Query: 272 DMQGMRQHCNTEDANYKKIIVFMTDG----ENLSTKEDQQSLYYCNEAKKRGAIVYAIGI 327
                      +     K+I+ MTDG       +             A  RG  VY IGI
Sbjct: 184 ----------KDSKAKSKVIILMTDGVESINPTNDLMYISPQTAAEMATSRGIKVYTIGI 233

Query: 328 RV-----------------------IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIG 362
                                        + L+  A  +   ++   +  S+   +  I 
Sbjct: 234 GTRGLAPFPTAYDMYGNYIFDMMPVDIDEKLLQNIADLTGGLYFRATDNQSLQKIYQEID 293

Query: 363 KDIVTK 368
           +   ++
Sbjct: 294 RLEKSE 299


>gi|312881786|ref|ZP_07741560.1| hypothetical protein VIBC2010_06474 [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309370537|gb|EFP98015.1| hypothetical protein VIBC2010_06474 [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 323

 Score =  106 bits (263), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 35/231 (15%), Positives = 73/231 (31%), Gaps = 47/231 (20%)

Query: 162 VKVNSQTDARLDMMIVLDVSRSMESFFD-----SSITKIDMAIKSINAMLEEVKLIPDVN 216
            +  +      D+M+VLD+S SM          + I ++      ++   ++        
Sbjct: 75  GEPVTTQPKHRDLMLVLDLSYSMSQEDMQDSSGNYIDRLTAVKNVVSQFAQQ-------R 127

Query: 217 NVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYL--SKFGVSTNSTPGLKYAYNQIFDMQ 274
              + GLV F++       L    + +  ++  L     G  T    G+  A        
Sbjct: 128 KGDRLGLVLFADHAYLQTPLTLDRNTISEQVNSLVLQLIGQKTAIGEGIGLATKTFI--- 184

Query: 275 GMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV----- 329
                   +    +++++ ++DG N S       +   N AKK  A +Y IG+       
Sbjct: 185 --------DSDAPQRVMILLSDGSNTSG--VLDPIEAANIAKKYNATIYTIGVGAGEMMV 234

Query: 330 -------------IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                            + L + A  +   ++   N   +   +  I    
Sbjct: 235 KDFFMTRKVNTAQDLDEKTLMSIAKITGGQYFRARNAQELATIYDTINSLE 285


>gi|288956977|ref|YP_003447318.1| hypothetical protein AZL_001360 [Azospirillum sp. B510]
 gi|288909285|dbj|BAI70774.1| hypothetical protein AZL_001360 [Azospirillum sp. B510]
          Length = 456

 Score =  106 bits (263), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 48/432 (11%), Positives = 120/432 (27%), Gaps = 76/432 (17%)

Query: 14  NYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNN 73
           + +G + I+ A+   ++  +LG+ I+ +   F+ + ++   D + +  + +       + 
Sbjct: 24  DRRGSVAIMVALSFLVLLGMLGVAIDFARAQFVSSRIYYAADAATLAVSRENFQVSTNDQ 83

Query: 74  RKKLKGGDILCRIKNTWNMSFRN-ELRDNGFVNDIDDIVRSTSLD--------IVVVPQN 124
            K L               +  +  +  +G    +     + +          +  +   
Sbjct: 84  LKALAQSYFDANFPPGTMGATTSLSVATSGTPPTVQGFTVTVTATLPLVFAPLVETLGGP 143

Query: 125 EGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARL-----DMMIVLD 179
              S+             T          ++    S           +      +    D
Sbjct: 144 TIGSVGISKASGAVFTTQTSNQGGMELVIVLDNSASMKGSQEDLRGGVKALLDMLYGNAD 203

Query: 180 VSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVT-------------- 225
             +++          +++   ++    + V  +           V               
Sbjct: 204 TRKNLYVGIVHYSGAVNVLQSALKNKADIVAPVVGGMANCPMATVNGKLNGSRLSNAPPK 263

Query: 226 ------FSNKIEEFFLLEW----------GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQ 269
                  ++ +E  +                    + IK     G  T    GL + +  
Sbjct: 264 TFKFDSTTDGVEIQYCGASTLGTSSALSPNRGDADKAIKSYVA-GGDTLIGEGLVWGWRM 322

Query: 270 IFDMQGMRQHCN----------TEDANYKKIIVFMTDGENL--------STKEDQQSLYY 311
           +        +             +    KK++V MTDG N            +  Q++  
Sbjct: 323 LTPSWRGLWNTKDQPGASLPLDYDLPYMKKVLVLMTDGVNHIAGRNYTAYYSDPYQTVAD 382

Query: 312 CNEA------------KKRGAIVYAIGIRVIRSHEFLRACAS-PNSFYLVENPHSMYDAF 358
            ++A            K    ++Y I        + +  CAS P+  Y    P  +  AF
Sbjct: 383 ASKADADLMTICNAAKKDHNVVLYTITYGSDTDEQQMSDCASDPSKHYHAALPQDLAKAF 442

Query: 359 SHIGKDIVTKRI 370
           + +G D+ T ++
Sbjct: 443 TQVGTDLTTMKL 454


>gi|323345325|ref|ZP_08085548.1| aerotolerance protein BatA [Prevotella oralis ATCC 33269]
 gi|323093439|gb|EFZ36017.1| aerotolerance protein BatA [Prevotella oralis ATCC 33269]
          Length = 332

 Score =  106 bits (263), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 38/226 (16%), Positives = 70/226 (30%), Gaps = 39/226 (17%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
           ++   +D+M+ +DVS SM +       +I+ A       +               GL  F
Sbjct: 83  KSVEGIDIMLAMDVSTSMLAEDL-HPNRIEAAKAVAAEFIAG-------RPNDNIGLTIF 134

Query: 227 SNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTP-GLKYAYNQIFDMQGMRQHCNTEDA 285
           + +      +    + L   ++ +      T+    GL      +            +  
Sbjct: 135 AGEAFTQCPMTTDHASLLNLLQNVR-----TDIAARGLIQDGTAVGMGLANAVSRLKDSK 189

Query: 286 NYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI--------------- 330
              K+++ +TDG N     D   +     AK  G  VY IG+                  
Sbjct: 190 AKSKVVILLTDGSNNMG--DLSPMTSAQIAKSLGIRVYTIGVGTNKVARYPMPVTGGIQY 247

Query: 331 ------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                    + L   A  +  +FY   N   +   ++ I K   TK
Sbjct: 248 VNIPVEIDTKTLSDIAATTDGNFYRATNNRELKQIYNDIDKLEKTK 293


>gi|255531385|ref|YP_003091757.1| von Willebrand factor A [Pedobacter heparinus DSM 2366]
 gi|255344369|gb|ACU03695.1| von Willebrand factor type A [Pedobacter heparinus DSM 2366]
          Length = 332

 Score =  106 bits (263), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 39/234 (16%), Positives = 68/234 (29%), Gaps = 46/234 (19%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           S+    + T   +D++I  D+S SM +       +++         ++            
Sbjct: 80  SAFSWQNSTTEGIDIVIATDISGSMLAEDLK-PNRLEAGKNIAIDFIKG-------RPED 131

Query: 220 QSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFG--VSTNSTPGLKYAYNQIFDMQGMR 277
           + GLV FS +      L      L      +S       T    GL  A N         
Sbjct: 132 RIGLVIFSGESFTQCPLTIDHDVLINLFSDISNGMVEDGTAIGMGLATAVN--------- 182

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI------- 330
                +     K+++ +TDG N +       L     AK+    VY IG+          
Sbjct: 183 --RLKDSEAKSKVVILLTDGSNTTGSIP--PLTAAEIAKQMKVRVYTIGVGTKGYAPYPV 238

Query: 331 --------------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                              L   A  +   ++   N   + + +  I K    K
Sbjct: 239 KTPFGTQYQQVPVTIDEGVLSKIAGITGGKYFRATNNEKLKEIYQQIDKLERAK 292


>gi|297565073|ref|YP_003684045.1| von Willebrand factor type A [Meiothermus silvanus DSM 9946]
 gi|296849522|gb|ADH62537.1| von Willebrand factor type A [Meiothermus silvanus DSM 9946]
          Length = 308

 Score =  106 bits (263), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 36/204 (17%), Positives = 72/204 (35%), Gaps = 30/204 (14%)

Query: 174 MMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEF 233
           +++ +DVS SM +      +++D A  +  + +E +         V+ GLV+F+      
Sbjct: 88  VVLAIDVSGSMMADDLK-PSRLDAAKAAARSFVERM------PAGVKVGLVSFAAGAVLE 140

Query: 234 FLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVF 293
             L      +  +I  L +   +T    GL  +                        ++ 
Sbjct: 141 SGLTADHQGVIERIDLLERR-ANTAIGEGLLESLKAFPT-------GANHQVAVPATVIL 192

Query: 294 MTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR----------SHEFLRACA--S 341
           ++DG N   +          EAK+RG  VY IG+                  LR  A  +
Sbjct: 193 LSDGRN---RIGIAPQEAAQEAKRRGVRVYTIGVGSDDPNASVDWAGFDEAELRGIAEVT 249

Query: 342 PNSFYLVENPHSMYDAFSHIGKDI 365
              ++  ++   + + +  +G  I
Sbjct: 250 GGRYFAADSADRLQEIYRELGSQI 273


>gi|32475535|ref|NP_868529.1| BatA [Rhodopirellula baltica SH 1]
 gi|32446077|emb|CAD75906.1| BatA [Rhodopirellula baltica SH 1]
          Length = 357

 Score =  106 bits (263), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 31/239 (12%), Positives = 72/239 (30%), Gaps = 41/239 (17%)

Query: 163 KVNSQTDARLDMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNV 218
           +        + + +V+D S SM++   +     + ++       +  +       +    
Sbjct: 77  EQTVSQTEGIAIEMVIDRSGSMQALDFNIDGEPVDRLTAVKNVASKFI-TGGEDLEGRFS 135

Query: 219 VQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFG----VSTNSTPGLKYAYNQIFDMQ 274
              GL+TF+   +         S +  ++             T     +  +       +
Sbjct: 136 DLVGLITFAAYADAETPPTLDHSFVVSRLNQTEIVSRRDEDGTAIGDAIALSVE-----K 190

Query: 275 GMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV----- 329
                   E     KI++ +TDGEN + + D   +     A+  G  +YAIG+       
Sbjct: 191 LNALDARQERKVQSKILILLTDGENTAGELD--PVQAAELAETLGIKIYAIGVGTTGKAP 248

Query: 330 ------------------IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                                   L+  A  +   ++   +  S+   +  I +   T+
Sbjct: 249 VPVRDPFTGRQRLHYMEVNIDEATLQKVAEITGGKYFRATDTDSLDAIYREIDQLEKTE 307


>gi|124006869|ref|ZP_01691699.1| von Willebrand factor type A domain protein [Microscilla marina
           ATCC 23134]
 gi|123987550|gb|EAY27259.1| von Willebrand factor type A domain protein [Microscilla marina
           ATCC 23134]
          Length = 351

 Score =  106 bits (263), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 39/232 (16%), Positives = 77/232 (33%), Gaps = 46/232 (19%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
           QT   +D+++ LD+S SM      +  +++ A       +             + GLV F
Sbjct: 106 QTSEGIDILLTLDISESMLIEDF-TPNRLEAAKLVAKNFVHG-------RKYDRIGLVIF 157

Query: 227 SNKIEEFFLLEWGVSHLQRKIKYLSKFG---VSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           S +      L      L+R I+ + +       T     L     ++            E
Sbjct: 158 SGEAYSVSPLTTDYKLLKRYIEDIREDMIQENGTAIGSALGMGTIRMQ-----------E 206

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI------------- 330
            A+  K+++ ++DG+N +   D   +     A      +Y I +                
Sbjct: 207 SASRSKVVILISDGDNTAGNLD--PITASRLATAHNIKIYTILVGRSGKVPYGRDMFGQP 264

Query: 331 ------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYDK 374
                      LR  A      FY   +  ++ + F+ I +   T+ I  ++
Sbjct: 265 QYVNNTVDESVLREIAKIGEGKFYRASDNQALKNVFAEINRLEKTE-IIENR 315


>gi|260769474|ref|ZP_05878407.1| protein BatA [Vibrio furnissii CIP 102972]
 gi|260614812|gb|EEX39998.1| protein BatA [Vibrio furnissii CIP 102972]
 gi|315182004|gb|ADT88917.1| von Willebrand factor type A domain protein [Vibrio furnissii NCTC
           11218]
          Length = 322

 Score =  106 bits (263), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 32/226 (14%), Positives = 73/226 (32%), Gaps = 46/226 (20%)

Query: 166 SQTDARLDMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQS 221
           + +    DMM+V+D+S SM           I ++    + ++  + +           + 
Sbjct: 79  TTSPKHRDMMLVVDLSYSMSQQDMKSGDQFIDRLSAVKQVLSDFIAK-------RQGDRL 131

Query: 222 GLVTFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQH 279
           GL+ F++       L      + +++    L   G  T    G+  A             
Sbjct: 132 GLIFFADHAYLQTPLTLDRQTIAQQLNQAVLRLIGTQTAIGEGIGLATKTFI-------- 183

Query: 280 CNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV---------- 329
              +    +++++ ++DG N S       +     AKK    +Y +G+            
Sbjct: 184 ---DSDAPQRVMILLSDGSNTSG--VLDPMEAAKIAKKYHTTIYTVGVGAGEMMVKEFFM 238

Query: 330 --------IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                       + L+A A  +   ++   N   +   +  I +  
Sbjct: 239 TRKINTAEDLDEKTLQAIADETGGQYFRARNQQDLQHIYDTINQLE 284


>gi|254459074|ref|ZP_05072497.1| von Willebrand factor, type A [Campylobacterales bacterium GD 1]
 gi|207084345|gb|EDZ61634.1| von Willebrand factor, type A [Campylobacterales bacterium GD 1]
          Length = 279

 Score =  106 bits (263), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 31/217 (14%), Positives = 69/217 (31%), Gaps = 22/217 (10%)

Query: 168 TDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVK--LIPDVNNVVQSGLVT 225
                D+++ +D S SM S       ++    +     + ++              G+V 
Sbjct: 50  NRHGKDIVLAIDASGSMNSSGFDFEDEVSDGKRLSRFEITKIIASEFIQKRISDNVGVVL 109

Query: 226 FSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDA 285
           + +       + +    + + + YL++     N+  G   A                   
Sbjct: 110 YGDFAFIASPITYEKEIVTQMLGYLTQGMAGQNTAIGEAIAMGV---------RSFKHSK 160

Query: 286 NYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV--IRSHEFLRACA--S 341
              K+IV ++DGE+ S             AK++G  +Y I +          L   A  S
Sbjct: 161 AKTKVIVLLSDGEHNSGS--VSPKEATELAKEQGIKIYTIAMGNKGEADEALLETIAKDS 218

Query: 342 PNSFYLVENPHSMYDAFSHIGKDIVT-----KRIWYD 373
              F+   +   + + +  I K   +     + +  +
Sbjct: 219 NGEFFSASSAKELKNIYDEIDKLESSNIKSREYVLKN 255


>gi|281423276|ref|ZP_06254189.1| BatA protein [Prevotella oris F0302]
 gi|281402612|gb|EFB33443.1| BatA protein [Prevotella oris F0302]
          Length = 332

 Score =  106 bits (263), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 35/226 (15%), Positives = 70/226 (30%), Gaps = 39/226 (17%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
           +    +D+M+ +DVS SM +       +++ A    +  + +             GL  F
Sbjct: 83  KQVEGIDIMLAMDVSTSMLAEDLK-PNRLEAAKNVASEFIAD-------RPNDNIGLTIF 134

Query: 227 SNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTP-GLKYAYNQIFDMQGMRQHCNTEDA 285
           + +      +      L   ++ +      T+    GL      +            +  
Sbjct: 135 AGEAFTQCPMTTDHVSLINLLQSVR-----TDIAARGLISDGTAVGMGLANAVSRLKDSK 189

Query: 286 NYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI--------------- 330
              K+++ +TDG N     D   +     A+  G  VY IGI                  
Sbjct: 190 AKSKVVILLTDGSNNMG--DISPMTSAQIARSFGIRVYTIGIGTNKVAPYPMPVAGGIQY 247

Query: 331 ------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                    + L+  A  +  +FY   N   +   +  I +   +K
Sbjct: 248 VNIPVEIDSKTLKDIAATTEGNFYRATNNRQLKQIYKDIDQLEKSK 293


>gi|153001301|ref|YP_001366982.1| von Willebrand factor type A [Shewanella baltica OS185]
 gi|151365919|gb|ABS08919.1| von Willebrand factor type A [Shewanella baltica OS185]
          Length = 340

 Score =  105 bits (262), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 30/217 (13%), Positives = 64/217 (29%), Gaps = 38/217 (17%)

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
             D+M+ +D+S SM+        K    +     +   V    +     + GL+ F++  
Sbjct: 83  GRDLMMAVDLSGSMQIEDMVVNGK---TVDRFTLIQHVVSDFIERRKGDRIGLILFADHA 139

Query: 231 EEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
                L      + + +K   +   G  T     +  A  +   M               
Sbjct: 140 YLQAPLTQDRRSVAQFLKEAQIGLVGKQTAIGEAIGLAVKRFDKMDESN----------- 188

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR----------------- 331
           ++++ +TDG N +     +       A  R   +Y +G+                     
Sbjct: 189 RVLILLTDGSNNAGNI--EPEQAAQIAANRKVTIYTVGVGADVMERRTLFGRERVNPSMD 246

Query: 332 -SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                L+  A  +   ++   N   +   +  I K  
Sbjct: 247 LDENQLKHIAEVTHGRYFRARNSQELDQIYKEIDKLE 283


>gi|262164788|ref|ZP_06032526.1| protein BatA [Vibrio mimicus VM223]
 gi|262027168|gb|EEY45835.1| protein BatA [Vibrio mimicus VM223]
          Length = 318

 Score =  105 bits (262), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 29/219 (13%), Positives = 70/219 (31%), Gaps = 46/219 (21%)

Query: 173 DMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
           D+M+V+D+S SM           + ++    + ++  + +           + GL+ F++
Sbjct: 85  DLMLVVDLSYSMSQEDMQSGQQMVDRLTAVKQVLSEFITK-------REGDRVGLILFAD 137

Query: 229 KIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
                  L      +  ++    L   G  T    G+  A                +   
Sbjct: 138 HAYLQTPLTLDRQTVISQLNQAVLKLIGTQTAIGEGIGLATKTFI-----------DSDA 186

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV----------------- 329
            +++++ ++DG N +       L   N AK+    +Y +G+                   
Sbjct: 187 PQRVMILLSDGSNTAG--VLDPLEAANIAKQYQTTIYTVGVGAGEMIVKDFLFSRKVNTA 244

Query: 330 -IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                + L+  A  +   ++   N   +   +  I +  
Sbjct: 245 QDLDEKTLQTIASTTGGQYFRARNQQDLQSIYDTINQLE 283


>gi|229527849|ref|ZP_04417240.1| protein BatA [Vibrio cholerae 12129(1)]
 gi|229334211|gb|EEN99696.1| protein BatA [Vibrio cholerae 12129(1)]
 gi|327485392|gb|AEA79798.1| BatA aerotolerance operon [Vibrio cholerae LMA3894-4]
          Length = 318

 Score =  105 bits (262), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 29/219 (13%), Positives = 71/219 (32%), Gaps = 46/219 (21%)

Query: 173 DMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
           D+M+V+D+S SM           + ++    + ++  + +           + GL+ F++
Sbjct: 85  DLMLVVDLSYSMSQEDMQSGQQMVDRLTAVKQVLSEFIAK-------REGDRIGLILFAD 137

Query: 229 KIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
                  L      +  ++    L   G  T    G+  A                +   
Sbjct: 138 HAYLQTPLTLDRQTVANQLNQAVLKLIGTQTAIGEGIGLATKTFI-----------DSNA 186

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV----------------- 329
            +++++ ++DG N +       L   N AK+    +Y +G+                   
Sbjct: 187 PQRVMILLSDGSNTAG--VLDPLEAANIAKQYHTTIYTVGVGAGEMVVKDFLFSRKLNTA 244

Query: 330 -IRSHEFLRACAS--PNSFYLVENPHSMYDAFSHIGKDI 365
                + L+  A+     ++   N   + + +  I +  
Sbjct: 245 QDLDEKTLQTIATTTGGHYFRARNQQDLQNIYDTINQLE 283


>gi|218675994|ref|YP_002394813.1| hypothetical protein VS_II0212 [Vibrio splendidus LGP32]
 gi|218324262|emb|CAV25554.1| Conserved hypothetical protein [Vibrio splendidus LGP32]
          Length = 347

 Score =  105 bits (262), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 33/219 (15%), Positives = 69/219 (31%), Gaps = 46/219 (21%)

Query: 173 DMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
           D+M+V+D+S SM           I ++      ++  +E            + GLV F++
Sbjct: 111 DLMLVVDLSYSMSQEDMQFNGEYIDRLSAVKHVLSDFIER-------RKGDRVGLVLFAD 163

Query: 229 KIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
                  L      L +++    L   G  T    G+  A                +   
Sbjct: 164 HAYLQTPLTLDRDTLSQQLNQAVLKLIGTQTAIGDGIGLATKTFV-----------DSDA 212

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV----------------- 329
            +++++ ++DG N +       L   + AKK  A +Y +G+                   
Sbjct: 213 PQRVMILLSDGSNTAG--VLDPLEAADIAKKYNATIYTVGVGAGEMMVKEFFMTRKVNTA 270

Query: 330 -IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                  L   A  +   ++   +   +   +  I +  
Sbjct: 271 QDLDERTLMEIAKRTGGQYFRARDSKELATIYDTINQLE 309


>gi|145224243|ref|YP_001134921.1| hypothetical protein Mflv_3659 [Mycobacterium gilvum PYR-GCK]
 gi|189040172|sp|A4T9I4|Y3659_MYCGI RecName: Full=UPF0353 protein Mflv_3659
 gi|145216729|gb|ABP46133.1| von Willebrand factor, type A [Mycobacterium gilvum PYR-GCK]
          Length = 335

 Score =  105 bits (262), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 33/260 (12%), Positives = 76/260 (29%), Gaps = 30/260 (11%)

Query: 130 SAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFD 189
           S   +    ++    +    +     + +            R  +M+V+DVS+SM +   
Sbjct: 55  SVAPKQPSRMRHLPAVLMILSLVSFTIAMAGPTHDVRIPRNRAVVMLVIDVSQSMRATD- 113

Query: 190 SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKY 249
            +  ++  A ++     +++    +       GL+ ++                +  I  
Sbjct: 114 VAPNRLTAAQEAAKQFADQLTPGIN------LGLIAYAGTATVLVSPTTNRESTKTAIDK 167

Query: 250 LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSL 309
           L      T +  G+  A   I  +          D      +V M+DG+           
Sbjct: 168 LQ-LADRTATGEGIFTALQAIATV---GAVIGGGDEPPPARVVLMSDGKETVPSNPDNPK 223

Query: 310 ---YYCNEAKKRGAIVYAIGIRVIR--------------SHEFLRACA--SPNSFYLVEN 350
                   AK +G  +  +                      E L+  A  S    +   +
Sbjct: 224 GAYTAARTAKDQGVPISTVSFGTPYGYVEINEQRQPVPVDDEMLKKIADLSGGEAFTASS 283

Query: 351 PHSMYDAFSHIGKDIVTKRI 370
              +   F+++ + I  + I
Sbjct: 284 LEQLKQVFTNLQEQIGYETI 303


>gi|327542237|gb|EGF28726.1| BatA aerotolerance operon protein [Rhodopirellula baltica WH47]
          Length = 345

 Score =  105 bits (262), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 31/239 (12%), Positives = 73/239 (30%), Gaps = 41/239 (17%)

Query: 163 KVNSQTDARLDMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNV 218
           +        + + +V+D S SM++   +     + ++       +  +       +    
Sbjct: 65  EQTVSQTEGIAIEMVIDRSGSMQAMDFNIDGEPVDRLTAVKNVASKFI-TGGEDLEGRFS 123

Query: 219 VQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFG----VSTNSTPGLKYAYNQIFDMQ 274
              GL+TF+   +         S +  ++             T     +  +  ++    
Sbjct: 124 DLVGLITFAAYADAETPPTLDHSFVVSRLNQTEIVSRRDEDGTAIGDAIALSVEKLN--- 180

Query: 275 GMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV----- 329
                   E     KI++ +TDGEN + + D   +     A+  G  +YAIG+       
Sbjct: 181 --ALDARQERKVQSKILILLTDGENTAGELD--PIQAAELAETLGIKIYAIGVGTKGKAP 236

Query: 330 ------------------IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                                   L+  A  +   ++   +  S+   +  I +   T+
Sbjct: 237 VPVRDPFTGRQRLHYMEVNIDEATLQKVAEITGGKYFRATDTDSLDAIYREIDQLEKTE 295


>gi|146307954|ref|YP_001188419.1| von Willebrand factor, type A [Pseudomonas mendocina ymp]
 gi|145576155|gb|ABP85687.1| von Willebrand factor, type A [Pseudomonas mendocina ymp]
          Length = 334

 Score =  105 bits (262), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 33/219 (15%), Positives = 71/219 (32%), Gaps = 44/219 (20%)

Query: 171 RLDMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+++ +DVS SM           I+++++  + +   +E+           + GL+ F
Sbjct: 89  GRDLLLAVDVSGSMAYEDMHWDEQPISRLELVKRLLGDFIED-------RRGDRVGLILF 141

Query: 227 SNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
            ++      L +    ++  +    +   G +T     +  A                + 
Sbjct: 142 GSQAYLQAPLTFDRHTVRTWLDEAMIGIAGKNTAIGDAIGLAVK-----------RLRQR 190

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR------------- 331
               +++V +TDG N   + D         A + G  +YAIGI                 
Sbjct: 191 PAQSRVLVLITDGANNGGEIDPMV--AAQLAAEEGVRIYAIGIGADPRQSGVLGAFGFSA 248

Query: 332 ---SHEFLRAC--ASPNSFYLVENPHSMYDAFSHIGKDI 365
                  LRA   A+   ++   N   +      + +  
Sbjct: 249 LDLDETSLRAIAEATGGEYFRARNQAELTQIELTLDRLE 287


>gi|254786433|ref|YP_003073862.1| von Willebrand factor A [Teredinibacter turnerae T7901]
 gi|237687231|gb|ACR14495.1| von Willebrand factor type A domain protein [Teredinibacter
           turnerae T7901]
          Length = 347

 Score =  105 bits (262), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 33/268 (12%), Positives = 83/268 (30%), Gaps = 45/268 (16%)

Query: 127 YSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSS----VKVNSQTDARLDMMIVLDVSR 182
            ++   +      +      W      +++  ++      +  +      D+++ +D+S 
Sbjct: 42  RNLQHQATGTPAQQHKISAGWLALIWVLLVAASARPQWVGEPVTLPATGRDLLLAVDISG 101

Query: 183 SMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSH 242
           SM++       K    I  +  ++ E           + GL+ F ++      L +    
Sbjct: 102 SMKTPDMVVQDKQIARILVVKYVVNEFIE---RRESDRLGLILFGSQAYLQAPLTFDRKT 158

Query: 243 LQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENL 300
           +   +    L   G  T     +  A                E    +++++ +TDG N 
Sbjct: 159 VSTLLDEAQLGFAGEQTAIGDAVGLAIK-----------RLRERPASQRVLILLTDGANT 207

Query: 301 STKEDQQSLYYCNEAKKRGAIVYAIGIRVIR---------------------SHEFLRAC 339
           + +         + AK+ G  +Y +G+   +                       + LR  
Sbjct: 208 AGE--VAPRQAADLAKQAGIKIYTVGVGADQMEQRMGLFGGFSRTVNPSSDLDEDTLRYM 265

Query: 340 A--SPNSFYLVENPHSMYDAFSHIGKDI 365
           A  +   ++   NP  +   +  + K  
Sbjct: 266 AETTGGLYFRARNPQELQAIYEELDKLE 293


>gi|86144576|ref|ZP_01062908.1| hypothetical protein MED222_09203 [Vibrio sp. MED222]
 gi|85837475|gb|EAQ55587.1| hypothetical protein MED222_09203 [Vibrio sp. MED222]
          Length = 330

 Score =  105 bits (262), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 33/219 (15%), Positives = 69/219 (31%), Gaps = 46/219 (21%)

Query: 173 DMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
           D+M+V+D+S SM           I ++      ++  +E            + GLV F++
Sbjct: 94  DLMLVVDLSYSMSQEDMQFNGEYIDRLSAVKHVLSDFIER-------RKGDRVGLVLFAD 146

Query: 229 KIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
                  L      L +++    L   G  T    G+  A                +   
Sbjct: 147 HAYLQTPLTLDRDTLSQQLNQAVLKLIGTQTAIGDGIGLATKTFV-----------DSDA 195

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV----------------- 329
            +++++ ++DG N +       L   + AKK  A +Y +G+                   
Sbjct: 196 PQRVMILLSDGSNTAG--VLDPLEAADIAKKYNATIYTVGVGAGEMMVKEFFMTRKVNTA 253

Query: 330 -IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                  L   A  +   ++   +   +   +  I +  
Sbjct: 254 QDLDERTLMEIAKRTGGQYFRARDSKELATIYDTINQLE 292


>gi|299140484|ref|ZP_07033622.1| BatA protein [Prevotella oris C735]
 gi|298577450|gb|EFI49318.1| BatA protein [Prevotella oris C735]
          Length = 332

 Score =  105 bits (262), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 35/226 (15%), Positives = 70/226 (30%), Gaps = 39/226 (17%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
           +    +D+M+ +DVS SM +       +++ A    +  + +             GL  F
Sbjct: 83  KQVEGIDIMLAMDVSTSMLAEDLK-PNRLEAAKNVASEFIAD-------RPNDNIGLTIF 134

Query: 227 SNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTP-GLKYAYNQIFDMQGMRQHCNTEDA 285
           + +      +      L   ++ +      T+    GL      +            +  
Sbjct: 135 AGEAFTQCPMTTDHVSLINLLQSVR-----TDIAARGLISDGTAVGMGLANAVSRLKDSK 189

Query: 286 NYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI--------------- 330
              K+++ +TDG N     D   +     A+  G  VY IGI                  
Sbjct: 190 AKSKVVILLTDGSNNMG--DISPMTSAQIARSFGIRVYTIGIGTNKVAPYPMPVAGGIQY 247

Query: 331 ------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                    + L+  A  +  +FY   N   +   +  I +   +K
Sbjct: 248 VNIPVEIDSKTLKDIAATTEGNFYRATNNRQLKQIYKDIDQLEKSK 293


>gi|148974032|ref|ZP_01811565.1| hypothetical protein VSWAT3_12932 [Vibrionales bacterium SWAT-3]
 gi|145965729|gb|EDK30977.1| hypothetical protein VSWAT3_12932 [Vibrionales bacterium SWAT-3]
          Length = 330

 Score =  105 bits (262), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 34/219 (15%), Positives = 69/219 (31%), Gaps = 46/219 (21%)

Query: 173 DMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
           D+M+V+D+S SM           I ++      ++  +E            + GLV F++
Sbjct: 94  DLMLVVDLSYSMSQEDMQFNGEYIDRLSAVKHVLSDFIER-------RKGDRVGLVLFAD 146

Query: 229 KIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
                  L      L +++    L   G  T    G+  A                +   
Sbjct: 147 HAYLQTPLTLDRDTLSQQLNQAVLRLIGNQTAIGDGIGLATKTFV-----------DSDA 195

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV----------------- 329
            ++++V ++DG N +       L   + AKK  A +Y +G+                   
Sbjct: 196 PQRVMVLLSDGSNTAG--VLDPLEAADIAKKYNATIYTVGVGAGEMMVKEFFMTRKVNTA 253

Query: 330 -IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                  L   A  +   ++   +   +   +  I +  
Sbjct: 254 QDLDERTLMEIAKRTGGQYFRARDSKELATIYDTINQLE 292


>gi|225028486|ref|ZP_03717678.1| hypothetical protein EUBHAL_02763 [Eubacterium hallii DSM 3353]
 gi|224954191|gb|EEG35400.1| hypothetical protein EUBHAL_02763 [Eubacterium hallii DSM 3353]
          Length = 538

 Score =  105 bits (262), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 48/277 (17%), Positives = 93/277 (33%), Gaps = 34/277 (12%)

Query: 104 VNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVK 163
            N+ D+        +      +  +    +       F            +       V 
Sbjct: 162 KNEPDNTFSDYGYYVRFNENAKDGTWKVDTFSGGETNFNNVFLCEWGDYSVTGNDGLKVT 221

Query: 164 VNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGL 223
                  + D+++ LD+S SM+         +D   K+    ++ +      N     GL
Sbjct: 222 SK-----KRDIVLTLDISASMDG------IPLDETKKAAAKFVDSIL-----NKNSNIGL 265

Query: 224 VTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           V++S++      +      L+  I  LS    +TN   GL  AY+ +             
Sbjct: 266 VSYSDEATSLSGICSNDVFLKNTITSLSSA-ENTNIEDGLSRAYSMLQL----------- 313

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI------RSHEFLR 337
             + KK+IV M+DG     K+ ++ + Y  + K +G ++Y +G               + 
Sbjct: 314 GQSKKKLIVLMSDGLPTLGKDGEELIKYAEKIKDQGVLIYTLGFFQNTEEYKAEGQYLME 373

Query: 338 ACASPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYDK 374
             AS    Y V +   +   F  +   I  ++  Y K
Sbjct: 374 KIASEGCHYEVSSSEDLVFFFEDVAGQIGGQKYIYVK 410


>gi|121586746|ref|ZP_01676529.1| conserved hypothetical protein [Vibrio cholerae 2740-80]
 gi|121728206|ref|ZP_01681240.1| conserved hypothetical protein [Vibrio cholerae V52]
 gi|147672023|ref|YP_001215942.1| hypothetical protein VC0395_1106 [Vibrio cholerae O395]
 gi|153816797|ref|ZP_01969464.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457]
 gi|227811796|ref|YP_002811806.1| hypothetical protein VCM66_A0168 [Vibrio cholerae M66-2]
 gi|229506663|ref|ZP_04396172.1| protein BatA [Vibrio cholerae BX 330286]
 gi|262167807|ref|ZP_06035508.1| protein BatA [Vibrio cholerae RC27]
 gi|298500027|ref|ZP_07009833.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
 gi|121549043|gb|EAX59080.1| conserved hypothetical protein [Vibrio cholerae 2740-80]
 gi|121629529|gb|EAX61953.1| conserved hypothetical protein [Vibrio cholerae V52]
 gi|126512600|gb|EAZ75194.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457]
 gi|146314406|gb|ABQ18946.1| conserved hypothetical protein [Vibrio cholerae O395]
 gi|227010938|gb|ACP07149.1| conserved hypothetical protein [Vibrio cholerae M66-2]
 gi|227014797|gb|ACP11006.1| conserved hypothetical protein [Vibrio cholerae O395]
 gi|229357014|gb|EEO21932.1| protein BatA [Vibrio cholerae BX 330286]
 gi|262023715|gb|EEY42415.1| protein BatA [Vibrio cholerae RC27]
 gi|297542008|gb|EFH78059.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
          Length = 318

 Score =  105 bits (262), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 29/219 (13%), Positives = 71/219 (32%), Gaps = 46/219 (21%)

Query: 173 DMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
           D+M+V+D+S SM           + ++    + ++  + +           + GL+ F++
Sbjct: 85  DLMLVVDLSYSMSQEDMQSGQQMVDRLTAVKQVLSEFIAK-------REGDRIGLILFAD 137

Query: 229 KIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
                  L      +  ++    L   G  T    G+  A                +   
Sbjct: 138 HAYLQTPLTLDRQTVANQLNQAVLKLIGTQTAIGEGIGLATKTFI-----------DSNA 186

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV----------------- 329
            +++++ ++DG N +       L   N AK+    +Y +G+                   
Sbjct: 187 PQRVMILLSDGSNTAG--VLDPLEAANIAKQYHTTIYTVGVGAGEMVVKDFLFSRKVNTA 244

Query: 330 -IRSHEFLRACAS--PNSFYLVENPHSMYDAFSHIGKDI 365
                + L+  A+     ++   N   + + +  I +  
Sbjct: 245 QDLDEKTLQTIATTTGGHYFRARNQQDLQNIYDTINQLE 283


>gi|118496821|ref|YP_897871.1| von Willebrand factor type A domain-containing protein [Francisella
           tularensis subsp. novicida U112]
 gi|118422727|gb|ABK89117.1| von Willebrand factor type A domain protein [Francisella novicida
           U112]
          Length = 333

 Score =  105 bits (262), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 39/259 (15%), Positives = 81/259 (31%), Gaps = 42/259 (16%)

Query: 134 RYKIPLKFCTFIPWYTNSRHIVMPITSSV-----KVNSQTDARLDMMIVLDVSRSMESFF 188
                 K   ++ +      I++ I+ S      K  S   +  D+++ +D+S SM    
Sbjct: 49  AGTRNFKRANYLKYLLGFIWILLIISGSGIQWLGKPVSLAQSGRDLIMAIDLSGSMAIQD 108

Query: 189 DSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIK 248
                         + ++       D     + GL+ F  +      L + ++ +++ + 
Sbjct: 109 MKKAN--GQMESRFDLVMRVANQFLDTRKGDRVGLILFGTRAYLQTPLTFDIATVKKMLD 166

Query: 249 --YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQ 306
              ++  G  T     +  A  ++    G             K ++ +TDGEN S     
Sbjct: 167 DASIALPGPQTAIGDAIGLAVKKLKKYPGDS-----------KALILLTDGENNSGT--L 213

Query: 307 QSLYYCNEAKKRGAIVYAIGIRV------------------IRSHEFLRACA--SPNSFY 346
           Q L     AK+    +Y IG+                          L   A  +   ++
Sbjct: 214 QPLQAAEIAKQYHIKIYTIGLGGGQMIVETTFGQRLVNTSEDLDTTVLEKIATMTGGKYF 273

Query: 347 LVENPHSMYDAFSHIGKDI 365
             +N   +   +  I K  
Sbjct: 274 RAQNSSDLKKVYESIDKLE 292


>gi|170727371|ref|YP_001761397.1| von Willebrand factor type A [Shewanella woodyi ATCC 51908]
 gi|169812718|gb|ACA87302.1| von Willebrand factor type A [Shewanella woodyi ATCC 51908]
          Length = 330

 Score =  105 bits (262), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 36/218 (16%), Positives = 70/218 (32%), Gaps = 38/218 (17%)

Query: 170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229
              D+M+ +D+S SM+        K   A+     +   V    +     + GL+ F++ 
Sbjct: 81  KGRDLMVAVDLSGSMQIEDMVLDGK---AVNRFIMVQSVVSDFIERRKGDKLGLILFADH 137

Query: 230 IEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287
                 L      + + +K   +   G  T     +  +  +   +              
Sbjct: 138 AYLQAPLTQDRRSVAQFLKEAQIGLVGKQTAIGEAIALSVKRFDLVDESN---------- 187

Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR---------------- 331
            +I+V +TDG N S     +     + A KRG  +Y+IG+                    
Sbjct: 188 -RILVLLTDGSNNSGSISPE--QAADIAAKRGIKIYSIGVGADVMERRTLFGKERVNPSM 244

Query: 332 --SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
               E L + A  +   ++   N   +   +  I K  
Sbjct: 245 DLDEEQLTSLAQTTGGRYFRARNAQELEQIYQEIDKLE 282


>gi|304411849|ref|ZP_07393460.1| von Willebrand factor type A [Shewanella baltica OS183]
 gi|307303383|ref|ZP_07583138.1| von Willebrand factor type A [Shewanella baltica BA175]
 gi|304349709|gb|EFM14116.1| von Willebrand factor type A [Shewanella baltica OS183]
 gi|306913743|gb|EFN44165.1| von Willebrand factor type A [Shewanella baltica BA175]
          Length = 339

 Score =  105 bits (262), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 30/217 (13%), Positives = 64/217 (29%), Gaps = 38/217 (17%)

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
             D+M+ +D+S SM+        K    +     +   V    +     + GL+ F++  
Sbjct: 83  GRDLMMAVDLSGSMQIEDMVVNGK---TVDRFTLIQHVVSDFIERRKGDRIGLILFADHA 139

Query: 231 EEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
                L      + + +K   +   G  T     +  A  +   M               
Sbjct: 140 YLQAPLTQDRRSVAQFLKEAQIGLVGKQTAIGEAIALAVKRFDKMDESN----------- 188

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR----------------- 331
           ++++ +TDG N +     +       A  R   +Y +G+                     
Sbjct: 189 RVLILLTDGSNNAGNI--EPEQAAQIAANRKVTIYTVGVGADVMERRTLFGRERVNPSMD 246

Query: 332 -SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                L+  A  +   ++   N   +   +  I K  
Sbjct: 247 LDENQLKHIAEVTHGRYFRARNSQELDQIYQEIDKLE 283


>gi|301064759|ref|ZP_07205139.1| von Willebrand factor type A domain protein [delta proteobacterium
           NaphS2]
 gi|300441134|gb|EFK05519.1| von Willebrand factor type A domain protein [delta proteobacterium
           NaphS2]
          Length = 332

 Score =  105 bits (262), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 45/290 (15%), Positives = 87/290 (30%), Gaps = 51/290 (17%)

Query: 112 RSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDAR 171
            ++++        +  S +  SR    L     +        +  P          +   
Sbjct: 28  AASAIRYSSTQTAKAISGARKSRAGRWLGTLRILALGALVVALAQPQIVHGTSEVDSS-G 86

Query: 172 LDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFS 227
           +D+++ +DVS SME+           ++D+  K +   + E           + GLV F+
Sbjct: 87  IDIVLAVDVSGSMEALDFTINNEPANRVDVVKKVVFRFIGE-------RPDDRIGLVAFA 139

Query: 228 NKIEEFFLLEWGVSHLQRKIKYLSKFG--VSTNSTPGLKYAYNQIFDMQGMRQHCNTEDA 285
            +      L      L R+++ +        T                 G   +   +  
Sbjct: 140 GRPYMVSPLTLDHDWLGRRLQTIHPGMVEDGTAIGSA-----------IGSSINRLRDQK 188

Query: 286 NYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV---------------- 329
              K+++ +TDG N + K     +     A+  G  +Y IG                   
Sbjct: 189 AKSKVVILLTDGMNNAGKI--LPVTAAEAAETLGIKIYTIGAGSRGEVPVPITDKFGNQK 246

Query: 330 ------IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKRIW 371
                       L   A  +   +Y   +  S+   +S I K   TKR  
Sbjct: 247 IVRAKVDIDEATLEKVAQMTGAKYYRATDTDSLKKIYSEINKLETTKRKI 296


>gi|78484419|ref|YP_390344.1| von Willebrand factor, type A [Thiomicrospira crunogena XCL-2]
 gi|78362705|gb|ABB40670.1| Type A von Willebrand factor-like [Thiomicrospira crunogena XCL-2]
          Length = 349

 Score =  105 bits (262), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 31/219 (14%), Positives = 78/219 (35%), Gaps = 43/219 (19%)

Query: 173 DMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
           D+M+ +D+S SME          + ++      +   +++           + GLV F +
Sbjct: 104 DLMLAVDLSGSMEKTDMPLRGVEVDRLTAVKSVVKNFIQK-------RQGDRMGLVVFGS 156

Query: 229 KIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
           +      L + ++ ++  +    +   G +T     +  A   +      +         
Sbjct: 157 QAFLQSPLTYDLNTVETLLNETEIGMAGNNTAIGDAIGIALKHLHQNSEKKAV------- 209

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR--------------- 331
               ++ +TDG N +     Q L    +A++ G  +Y IGI   +               
Sbjct: 210 ----LILLTDGSNTAG--AVQPLDAAKQAQEMGLKIYTIGIGQNQATGLDAFIFGPNRNM 263

Query: 332 SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
               L+  A  +   F++ ++ + + + +  I +   ++
Sbjct: 264 DTTTLQKIAELTQGRFFMAKDTNQLNEIYQLIDQLEASQ 302


>gi|158425008|ref|YP_001526300.1| von Willebrand factor type A domain-containing protein
           [Azorhizobium caulinodans ORS 571]
 gi|158331897|dbj|BAF89382.1| von Willebrand factor type A domain protein [Azorhizobium
           caulinodans ORS 571]
          Length = 343

 Score =  105 bits (262), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 30/216 (13%), Positives = 69/216 (31%), Gaps = 42/216 (19%)

Query: 170 ARLDMMIVLDVSRSME----SFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVT 225
              D+M+ +D+S SM     S+ +  + ++ +     +  + +           + GL+ 
Sbjct: 89  EGRDLMLAVDLSGSMSRQDLSYDNIPVDRLTIIKGVADDFIAK-------RKGDRIGLIL 141

Query: 226 FSNKIEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           FS +      L +  + ++  ++   +   G  T     +  A                 
Sbjct: 142 FSTRAYVQAPLTFDRNVVRDLLRTSSIGMTGQETAIGDAIALAVKT-----------LRT 190

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR------------ 331
               ++++V +TDG N S             AK  G  +Y IG+                
Sbjct: 191 RPQEQRVLVLLTDGANNSGMLSPIP--AAEIAKANGVKIYTIGVGADAFAVGQRMVNPSF 248

Query: 332 --SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGK 363
                 L   A  +   ++   +   +   ++ I +
Sbjct: 249 DLDEGALEQIAQMTGGRYFRARDAAGLAAIYNDIDR 284


>gi|299135165|ref|ZP_07028356.1| conserved hypothetical protein [Afipia sp. 1NLS2]
 gi|298590142|gb|EFI50346.1| conserved hypothetical protein [Afipia sp. 1NLS2]
          Length = 601

 Score =  105 bits (261), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 33/236 (13%), Positives = 74/236 (31%), Gaps = 30/236 (12%)

Query: 3   SLNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAA 62
            L    R F  + +G + I+ AI    +  ++G  ++ +     +T L S +D + +  +
Sbjct: 8   RLTRLARRFQTDARGNVAIIFAIVSIPLVALVGAAVDYTRAVSDRTALQSALDSAALMIS 67

Query: 63  TQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVP 122
                     +   +    I  R +             +      D  +++ +       
Sbjct: 68  K---------DAATMSASQITTRARQYV----------DSLYTATDAPIQNFTATYTPNS 108

Query: 123 QNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSR 182
            +   SI   +   +P  F         S    +P+ +S         R+ + +VLD + 
Sbjct: 109 GSGA-SILLSANGTMPTYFM----RVLGSNFNTLPVATSSTTK-WGSTRMRVALVLDNTG 162

Query: 183 SMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEW 238
           SM         K+     +   M+ ++         V   +V F+  +        
Sbjct: 163 SMAQNG-----KMAALQSAATDMITKLSAFNTTTGDVYISIVPFAKDVNVSTSNVS 213



 Score = 47.9 bits (112), Expect = 0.003,   Method: Composition-based stats.
 Identities = 31/158 (19%), Positives = 57/158 (36%), Gaps = 20/158 (12%)

Query: 232 EFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQ-IFDMQGMRQHCNTEDANYKKI 290
               +    S L+ +I  ++  G +TN   GL + +          +      +  YK  
Sbjct: 443 TITPMSNQWSTLKSQINAMTPSG-NTNQAVGLFWGWQTLNTTNDPFKAPAKDPNWVYKDY 501

Query: 291 IVFMTDGENL-------STKEDQQSLYYCNEAKK------RGAIVYAIGIR---VIRSHE 334
           IV ++DG N         +  D +    C   K           V++I +       + +
Sbjct: 502 IVLLSDGLNTQNRWTQTVSDIDARQELLCKNIKDPAQNGGNQITVFSIQVNISSKDPTSK 561

Query: 335 FLRACASPNSFYL--VENPHSMYDAFSHIGKDIVTKRI 370
            L+ CA+P + Y   +       DAF+++   I   RI
Sbjct: 562 VLQDCATPGAGYFQMITQSSQTADAFNNVLATIAKLRI 599


>gi|160875970|ref|YP_001555286.1| von Willebrand factor type A [Shewanella baltica OS195]
 gi|160861492|gb|ABX50026.1| von Willebrand factor type A [Shewanella baltica OS195]
 gi|315268165|gb|ADT95018.1| von Willebrand factor type A [Shewanella baltica OS678]
          Length = 339

 Score =  105 bits (261), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 30/217 (13%), Positives = 64/217 (29%), Gaps = 38/217 (17%)

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
             D+M+ +D+S SM+        K    +     +   V    +     + GL+ F++  
Sbjct: 83  GRDLMMAVDLSGSMQIEDMVINGK---TVDRFTLIQHVVSDFIERRKGDRIGLILFADHA 139

Query: 231 EEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
                L      + + +K   +   G  T     +  A  +   M               
Sbjct: 140 YLQAPLTQDRRSVAQFLKEAQIGLVGKQTAIGEAIGLAVKRFDKMDESN----------- 188

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR----------------- 331
           ++++ +TDG N +     +       A  R   +Y +G+                     
Sbjct: 189 RVLILLTDGSNNAGNI--EPEQAAQIAANRKVTIYTVGVGADVMERRTLFGRERVNPSMD 246

Query: 332 -SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                L+  A  +   ++   N   +   +  I K  
Sbjct: 247 LDENQLKHIAEVTHGRYFRARNSQELDQIYQEIDKLE 283


>gi|317154611|ref|YP_004122659.1| von Willebrand factor type A [Desulfovibrio aespoeensis Aspo-2]
 gi|316944862|gb|ADU63913.1| von Willebrand factor type A [Desulfovibrio aespoeensis Aspo-2]
          Length = 395

 Score =  105 bits (261), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 46/424 (10%), Positives = 124/424 (29%), Gaps = 122/424 (28%)

Query: 29  IIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKN 88
           ++  V G+ +++ +++   T L + +D   +  + ++  + + +              K 
Sbjct: 1   MLLAVAGLAVDMGNMYVTHTRLQAAVDAGALAGSLELPYDPDLS--------------KG 46

Query: 89  TWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWY 148
               +  + +  N     ++ +   T +           S+   ++ K+ L    F+   
Sbjct: 47  IVQQAVSDMIHTNMPDAVVESVSPGTEV----------RSVVVTAKAKVNLLVMGFL--- 93

Query: 149 TNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITK-------------- 194
               ++      +          L+++ V+D S SM+    + + +              
Sbjct: 94  ----NLADQWVEAGAAAGFNK--LEIVFVIDNSGSMKGTPINLVKEASIGLTDLLIPDGQ 147

Query: 195 --------------------IDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFF 234
                               +D            V      + +     ++   + +   
Sbjct: 148 QPDTKVGLVAFRGKVRLGGDVDGLEAGCRNADGSVNTGIHEDFMSMYWALSSYYRNQIDL 207

Query: 235 LLEW----------GVSHLQRKIKYLSKFG--VSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
                             +   I   +  G    T  + G+K+A + +       Q  + 
Sbjct: 208 DTCSSIPESRPLSQDKGDIVEGINSQTALGSASGTVISEGIKWARHMLTPEAPYTQAGDK 267

Query: 283 EDANYKKIIVFMTDGE----------------------------------NLSTKEDQQS 308
              +++KI++ +TDG+                                        +Q  
Sbjct: 268 --KDFRKIMIVLTDGDTEDGECGGSYRASFRPNNYWTNAYYGMGVDTAHCQDGGVLNQDM 325

Query: 309 LYYCNEAKKRGAIVYAIGIRVIRSHE--FLRACA-----SPNSFYLVENPHSMYDAFSHI 361
           L     AK  G  ++AI   V  + +   ++  A     + + ++   + + + D F  I
Sbjct: 326 LAEAQLAKDEGIEIFAIRFGVSDNTDISLMKQIASSKAGTNDHYFDAPSVYDIPDVFKKI 385

Query: 362 GKDI 365
           GK +
Sbjct: 386 GKQL 389


>gi|229514670|ref|ZP_04404131.1| protein BatA [Vibrio cholerae TMA 21]
 gi|229348650|gb|EEO13608.1| protein BatA [Vibrio cholerae TMA 21]
          Length = 318

 Score =  105 bits (261), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 29/219 (13%), Positives = 71/219 (32%), Gaps = 46/219 (21%)

Query: 173 DMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
           D+M+V+D+S SM           + ++    + ++  + +           + GL+ F++
Sbjct: 85  DLMLVVDLSYSMSQEDMQSGQQMVDRLTAVKQVLSEFIAK-------REGDRIGLILFAD 137

Query: 229 KIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
                  L      +  ++    L   G  T    G+  A                +   
Sbjct: 138 HAYLQTPLTLDRQTVANQLNQAVLKLIGTQTAIGEGIGLATKTFI-----------DSNA 186

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV----------------- 329
            +++++ ++DG N +       L   N AK+    +Y +G+                   
Sbjct: 187 PQRVMILLSDGSNTAG--VLDPLEAANIAKQYHTTIYTVGVGAGEMVVKDFLFSRKVNTA 244

Query: 330 -IRSHEFLRACAS--PNSFYLVENPHSMYDAFSHIGKDI 365
                + L+  A+     ++   N   + + +  I +  
Sbjct: 245 QDLDEKTLQTIATTTGGHYFRARNQQDLQNIYDTINQLE 283


>gi|194324498|ref|ZP_03058270.1| von Willebrand factor type A domain membrane protein [Francisella
           tularensis subsp. novicida FTE]
 gi|194321333|gb|EDX18819.1| von Willebrand factor type A domain membrane protein [Francisella
           tularensis subsp. novicida FTE]
          Length = 339

 Score =  105 bits (261), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 39/259 (15%), Positives = 81/259 (31%), Gaps = 42/259 (16%)

Query: 134 RYKIPLKFCTFIPWYTNSRHIVMPITSSV-----KVNSQTDARLDMMIVLDVSRSMESFF 188
                 K   ++ +      I++ I+ S      K  S   +  D+++ +D+S SM    
Sbjct: 55  AGTRNFKRANYLKYLLGFIWILLIISGSGIQWLGKPVSLAQSGRDLIMAIDLSGSMAIQD 114

Query: 189 DSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIK 248
                         + ++       D     + GL+ F  +      L + ++ +++ + 
Sbjct: 115 MKKAN--GQMESRFDLVMRVANQFLDTRKGDRVGLILFGTRAYLQTPLTFDIATVKKMLD 172

Query: 249 --YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQ 306
              ++  G  T     +  A  ++    G             K ++ +TDGEN S     
Sbjct: 173 DASIALPGPQTAIGDAIGLAVKKLKKYPGDS-----------KALILLTDGENNSGT--L 219

Query: 307 QSLYYCNEAKKRGAIVYAIGIRV------------------IRSHEFLRACA--SPNSFY 346
           Q L     AK+    +Y IG+                          L   A  +   ++
Sbjct: 220 QPLQAAEIAKQYHIKIYTIGLGGGQMIVETTFGQRLVNTSEDLDTTVLEKIATMTGGKYF 279

Query: 347 LVENPHSMYDAFSHIGKDI 365
             +N   +   +  I K  
Sbjct: 280 RAQNSSDLKKVYESIDKLE 298


>gi|156616290|ref|NP_001096078.1| collagen alpha-6(VI) chain precursor [Homo sapiens]
 gi|189082902|sp|A6NMZ7|CO6A6_HUMAN RecName: Full=Collagen alpha-6(VI) chain; Flags: Precursor
          Length = 2263

 Score =  105 bits (261), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 38/267 (14%), Positives = 88/267 (32%), Gaps = 28/267 (10%)

Query: 109 DIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQT 168
           +    T L+ +     E Y     +   +     TF+    N     + + S      ++
Sbjct: 368 EGASDTQLEKIASHPAEQYVSKLKTFADLAAHNQTFLKKLRNQITHTVSVFSERTETLKS 427

Query: 169 D----ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
                   D+ +++D S S ++     +       + +         +       + G V
Sbjct: 428 GCVDTEEADIYLLIDGSGSTQATDFHEMK--TFLSEVVGMFNIAPHKV-------RVGAV 478

Query: 225 TFSNKIEEFF--LLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +++  +  F          L + I+ + + G +TN+   L +  + +      +     
Sbjct: 479 QYADSWDLEFEINKYSNKQDLGKAIENIRQMGGNTNTGAALNFTLSLL-----QKAKKQR 533

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
            +     ++V        +       L   N  ++    VYAIGI    +   LR  A  
Sbjct: 534 GNKVPCHLVVL------TNGMSKDSILEPANRLREEHIRVYAIGI-KEANQTQLREIAGE 586

Query: 343 N-SFYLVENPHSMYDAFSHIGKDIVTK 368
               Y V +  ++ D  + + ++I T+
Sbjct: 587 EKRVYYVHDFDALKDIRNQVVQEICTE 613



 Score = 83.4 bits (204), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 36/334 (10%), Positives = 97/334 (29%), Gaps = 26/334 (7%)

Query: 39   EVSHIFFMKTVLHSMIDRS---LVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFR 95
            +      + +VL +  D++     + A  +    +     +    +              
Sbjct: 865  DFGTKLEVISVLQN--DQAMGGSTYTAEALGFSDHMFTEARGSRLNKGVPQVLIVITDGE 922

Query: 96   NELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIV 155
            +   D           +   +  V +       + A++       F             V
Sbjct: 923  SHDADKLNATAKALRDKGILVLAVGIDGANPVELLAMAGSSDKYFFVETFGGLKGIFSDV 982

Query: 156  MPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDV 215
                 +         ++D++ ++D S S++              K    +   V+     
Sbjct: 983  TASVCNSSKVDCEIDKVDLVFLMDGSTSIQPNDF---------KKMKEFLASVVQDFDVS 1033

Query: 216  NNVVQSGLVTFSNKIEEFFL--LEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM 273
             N V+ G   FS+     F      G   +  +I+ + +   +T+          +  + 
Sbjct: 1034 LNRVRIGAAQFSDTYHPEFPLGTFIGEKEISFQIENIKQIFGNTHIGAA-----LREVEH 1088

Query: 274  QGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSH 333
                   +  +    ++++ +TD      +   +        + RG  +Y++GI  +   
Sbjct: 1089 YFRPDMGSRINTGTPQVLLVLTD-----GQSQDEVAQAAEALRHRGIDIYSVGIGDVDDQ 1143

Query: 334  EFLRACASPNSFYLVENPHSMYDAFSHIGKDIVT 367
            + ++   +      V N   +      I ++I T
Sbjct: 1144 QLIQITGTAEKKLTVHNFDELKKVNKRIVRNICT 1177



 Score = 81.1 bits (198), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 48/334 (14%), Positives = 107/334 (32%), Gaps = 30/334 (8%)

Query: 44  FFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGF 103
           F  ++ + + ID+  +    Q    G+  +              N           +   
Sbjct: 679 FMSQSDISNAIDQ--MAHIGQTTLTGSALSFVSQYFSPTKGARPNIRKFLILITDGEAQD 736

Query: 104 VNDIDDIVRSTSLDIVVVPQNEGYSIS----AISRYKIPLKFCTFIPWYTNSRHIVMPIT 159
           +     +V      I+      G +++       R ++      F         +V  I 
Sbjct: 737 IVKEPAVVLRQEGVIIYSVGVFGSNVTQLEEISGRPEMVFYVENFDILQRIEDDLVFGI- 795

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSI--TKIDMAIKSINAMLEEVKLIPDVNN 217
            S +   +    LD++ V+D S S++    + +    I +  K+               N
Sbjct: 796 CSPREECKRIEVLDVVFVIDSSGSIDYDEYNIMKDFMIGLVKKA-----------DVGKN 844

Query: 218 VVQSGLVTFSNKIEEFFL--LEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQG 275
            V+ G + +++  E  F          +   ++     G ST +   L +      D   
Sbjct: 845 QVRFGALKYADDPEVLFYLDDFGTKLEVISVLQNDQAMGGSTYTAEALGF-----SDHMF 899

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF 335
                +  +    ++++ +TDGE+    +  +        + +G +V A+GI      E 
Sbjct: 900 TEARGSRLNKGVPQVLIVITDGESH---DADKLNATAKALRDKGILVLAVGIDGANPVEL 956

Query: 336 LRACASPNSFYLVENPHSMYDAFSHIGKDIVTKR 369
           L    S + ++ VE    +   FS +   +    
Sbjct: 957 LAMAGSSDKYFFVETFGGLKGIFSDVTASVCNSS 990



 Score = 57.6 bits (137), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 39/298 (13%), Positives = 89/298 (29%), Gaps = 33/298 (11%)

Query: 57  SLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSL 116
             +     +             G D   +      +   +E  DN              +
Sbjct: 103 GSLQIGKALQEAHRTYFSAPANGRD-KKQFPPILVVLASSESEDNVEEASKALRKDGVKI 161

Query: 117 DIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIV-----------MPITSSVKVN 165
             V V +    ++ A++  +      T       S+++              +       
Sbjct: 162 ISVGVQKASEENLKAMATSQFHFNLRTVRDLSMFSQNMTHIIKDVIKYKEGAVDDIFVEA 221

Query: 166 SQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVT 225
            Q  +  D++ +LD+S       + S    D        + E V  +    N ++ GLV 
Sbjct: 222 CQGPSMADVVFLLDMS------INGSEENFDYLK---GFLEESVSALDIKENCMRVGLVA 272

Query: 226 FSNKIEEFFL--LEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           +SN+ +      +    S + + I+ LS       +      A  ++       ++ + +
Sbjct: 273 YSNETKVINSLSMGINKSEVLQHIQNLSPRTGKAYTGA----AIKKLRKEVFSARNGSRK 328

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACAS 341
           +    +I V +T         +          ++ G  ++ +GI      + L   AS
Sbjct: 329 NQGVPQIAVLVTH-----RDSEDNVTKAAVNLRREGVTIFTLGIEGASDTQ-LEKIAS 380



 Score = 46.0 bits (107), Expect = 0.010,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 62/186 (33%), Gaps = 22/186 (11%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D++ ++D S                       + + +  +P   +  +  L  +S+K+  
Sbjct: 27  DVVFLVDSS------DRLGSKSFPFVKM---FITKMISSLPIEADKYRVALAQYSDKLHS 77

Query: 233 FFL--LEWGVSHLQRKI-KYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
            F      G S +   + K     G S      L+ A+   F           +   +  
Sbjct: 78  EFHLSTFKGRSPMLNHLRKNFGFIGGSLQIGKALQEAHRTYFSAPA----NGRDKKQFPP 133

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVE 349
           I+V +      S++ +          +K G  + ++G++   S E L+A A+    + + 
Sbjct: 134 ILVVLA-----SSESEDNVEEASKALRKDGVKIISVGVQK-ASEENLKAMATSQFHFNLR 187

Query: 350 NPHSMY 355
               + 
Sbjct: 188 TVRDLS 193


>gi|217972770|ref|YP_002357521.1| von Willebrand factor type A [Shewanella baltica OS223]
 gi|217497905|gb|ACK46098.1| von Willebrand factor type A [Shewanella baltica OS223]
          Length = 340

 Score =  105 bits (261), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 30/217 (13%), Positives = 64/217 (29%), Gaps = 38/217 (17%)

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
             D+M+ +D+S SM+        K    +     +   V    +     + GL+ F++  
Sbjct: 83  GRDLMMAVDLSGSMQIEDMVVNGK---TVDRFTLIQHVVSDFIERRKGDRIGLILFADHA 139

Query: 231 EEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
                L      + + +K   +   G  T     +  A  +   M               
Sbjct: 140 YLQAPLTQDRRSVAQFLKEAQIGLVGKQTAIGEAIALAVKRFDKMDESN----------- 188

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR----------------- 331
           ++++ +TDG N +     +       A  R   +Y +G+                     
Sbjct: 189 RVLILLTDGSNNAGNI--EPEQAAQIAANRKVTIYTVGVGADVMERRTLFGRERVNPSMD 246

Query: 332 -SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                L+  A  +   ++   N   +   +  I K  
Sbjct: 247 LDENQLKHIADVTHGRYFRARNSQELDQIYQEIDKLE 283


>gi|298372684|ref|ZP_06982674.1| BatA protein [Bacteroidetes oral taxon 274 str. F0058]
 gi|298275588|gb|EFI17139.1| BatA protein [Bacteroidetes oral taxon 274 str. F0058]
          Length = 326

 Score =  105 bits (261), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 48/283 (16%), Positives = 88/283 (31%), Gaps = 57/283 (20%)

Query: 122 PQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPIT----------SSVKVNSQTDAR 171
           P++   S+   S         T   W       ++ +           +S   ++ T   
Sbjct: 26  PKHNDASLQVSSTKAFEGMAKTKKIWLYYFPSTLIVVALLVIVLARPQTSDSYSNSTTEG 85

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           ++++I +D+S SM +   S   +++ A       +               GLV F+ +  
Sbjct: 86  INIVIAMDISGSMLARDLS-PNRLEAAKDVGIEFILS-------RPNDNFGLVVFAGESF 137

Query: 232 EFFLLEWGVSHLQRKIKYLS--KFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
               +    + L    K +        T    GL  A N+I            +     K
Sbjct: 138 TQCPITSNHASLVNLFKQVDFGIIQDGTAIGLGLATAINRI-----------KDAEGKSK 186

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI------------------- 330
           +I+ +TDG N +   D   +     A+  G  VY IG+                      
Sbjct: 187 VIILLTDGTNNTG--DIAPISAAQIAQSYGIRVYTIGVGTQGIAEVPMLDQFGNIHYTEA 244

Query: 331 ---RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                   L+  A  +   ++   N  S+   +S I K   TK
Sbjct: 245 EVVIDETTLQQIASTTGGKYFRATNVSSLKQIYSEIDKMEKTK 287


>gi|329894014|ref|ZP_08270022.1| BatA [gamma proteobacterium IMCC3088]
 gi|328923357|gb|EGG30676.1| BatA [gamma proteobacterium IMCC3088]
          Length = 339

 Score =  105 bits (261), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 34/225 (15%), Positives = 72/225 (32%), Gaps = 46/225 (20%)

Query: 171 RLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+++ +D+S SM          ++ +ID         +E            + GL+ F
Sbjct: 90  GRDLLLAVDISGSMRVEDMVIANQAVRRIDAVRDIGAEFIER-------REGDRVGLILF 142

Query: 227 SNKIEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
            ++      L +    +++ +    +   G  T     L  A                + 
Sbjct: 143 GSRAYMQSPLSFDRDTVKQFLSEAQIGFAGSETAIGDALGLAVK-----------RLRDK 191

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR------------- 331
            +  ++++ +TDG++ ++  D   L     A   G  VY IGI                 
Sbjct: 192 EDGDRVVILLTDGQDTASSVD--PLDATALAANYGVKVYTIGIGADEMLVPSLFGNRRVN 249

Query: 332 -----SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKR 369
                  E L A A  +   ++   +P  +   +  +     T+ 
Sbjct: 250 PSAELDEETLSAMAESTGGRYFRARSPDELAKIYDLLDLLEPTQT 294


>gi|282879637|ref|ZP_06288368.1| von Willebrand factor type A domain protein [Prevotella timonensis
           CRIS 5C-B1]
 gi|281306585|gb|EFA98614.1| von Willebrand factor type A domain protein [Prevotella timonensis
           CRIS 5C-B1]
          Length = 332

 Score =  105 bits (261), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 36/223 (16%), Positives = 66/223 (29%), Gaps = 39/223 (17%)

Query: 170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229
             +D+M+ +DVS SM +       +++ A       +               GL  F+ +
Sbjct: 86  EGIDIMLAMDVSTSMLAEDLK-PNRLEAAKNVAAEFISG-------RPNDNIGLTIFAGE 137

Query: 230 IEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTP-GLKYAYNQIFDMQGMRQHCNTEDANYK 288
                 +    + L   ++ +      T+    GL      +            +     
Sbjct: 138 AFTQCPMTTDHTSLLNLLRNVR-----TDIAARGLISDGTAVGMGLANAVSRLKDSKTKS 192

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI------------------ 330
           K+++ +TDG N     D   +     AK     VY IG+                     
Sbjct: 193 KVVILLTDGSNNMG--DISPMTSAQIAKSLDIRVYTIGVGTNKVAPYPMSVGGGTQYINI 250

Query: 331 ---RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                 + L   A  +  +FY   N   +   +  I K   TK
Sbjct: 251 PVEIDSKTLSDIAAVTEGNFYRATNNQQLKQIYKDIDKLEKTK 293


>gi|153830331|ref|ZP_01982998.1| conserved hypothetical protein [Vibrio cholerae 623-39]
 gi|148874174|gb|EDL72309.1| conserved hypothetical protein [Vibrio cholerae 623-39]
          Length = 318

 Score =  105 bits (261), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 29/219 (13%), Positives = 71/219 (32%), Gaps = 46/219 (21%)

Query: 173 DMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
           D+M+V+D+S SM           + ++    + ++  + +           + GL+ F++
Sbjct: 85  DLMLVVDLSYSMSQEDMQSGQQMVDRLTAVKQVLSEFIAK-------REGDRIGLILFAD 137

Query: 229 KIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
                  L      +  ++    L   G  T    G+  A                +   
Sbjct: 138 HAYLQTPLTLDRQTVANQLNQAVLKLIGTQTAIGEGIGLATKTFI-----------DSNA 186

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV----------------- 329
            +++++ ++DG N +       L   N AK+    +Y +G+                   
Sbjct: 187 PQRVMILLSDGSNTAG--VLDPLEAANIAKQYHTTIYTVGVGAGEMVVKDFLFSRKVNTA 244

Query: 330 -IRSHEFLRACAS--PNSFYLVENPHSMYDAFSHIGKDI 365
                + L+  A+     ++   N   + + +  I +  
Sbjct: 245 QDLDEKTLQTIATTTGGHYFRARNQQDLQNIYDTINQLE 283


>gi|297671963|ref|XP_002814093.1| PREDICTED: collagen alpha-6(VI) chain-like [Pongo abelii]
          Length = 2291

 Score =  105 bits (261), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 37/267 (13%), Positives = 88/267 (32%), Gaps = 28/267 (10%)

Query: 109 DIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQT 168
           +    T L+ +     E Y     +   +     TF+    N     + + S      ++
Sbjct: 396 EGASDTQLEKIASHPAEQYVSKLKTFADLAAHNQTFLKKLRNQITHTVSVFSERTETLKS 455

Query: 169 D----ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
                   D+ +++D S S ++     +       + +         +       + G V
Sbjct: 456 GCVDTEEADIYLLIDGSGSTQATDFHEMK--TFLSEVVGMFNIAPHKV-------RVGAV 506

Query: 225 TFSNKIEEFF--LLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +++  +  F          L + I+ + + G +TN+   L +  + +      +     
Sbjct: 507 QYADSWDLEFEINKYSNKQDLGKAIENIRQMGGNTNTGAALNFTLSLL-----QKAKKQR 561

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
            +     ++V        +       L   N  ++    VYAIG+    +   LR  A  
Sbjct: 562 GNKVPCHLVVL------TNGMSKDSILEPANRLREEHIRVYAIGV-KEANQTQLREIAGE 614

Query: 343 N-SFYLVENPHSMYDAFSHIGKDIVTK 368
               Y V +  ++ D  + + ++I T+
Sbjct: 615 EKRVYYVHDFDALKDIRNQVVQEICTE 641



 Score = 82.2 bits (201), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 36/334 (10%), Positives = 98/334 (29%), Gaps = 26/334 (7%)

Query: 39   EVSHIFFMKTVLHSMIDRSL---VHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFR 95
            +      + +VL +  D+++    + A  +    +     +    +              
Sbjct: 893  DFGTKLEVISVLQN--DQAMGGNTYTAEALGFSDHMFTEARGSRLNKGVPQVLIVITDGE 950

Query: 96   NELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIV 155
            +   D           +   +  V +       + A++       F             V
Sbjct: 951  SHDADKLNATAKALRDKGILVLAVGIAGANPVELLAMAGSSDKYFFVETFGGLKGIFSDV 1010

Query: 156  MPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDV 215
                 +         ++D++ ++D S S++              K    +   V+     
Sbjct: 1011 TASVCNSSKVDCEIDKVDLVFLMDGSTSIQQNDF---------KKMKEFLASVVQDFDVS 1061

Query: 216  NNVVQSGLVTFSNKIEEFFL--LEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM 273
             N V+ G   FS+     F      G   +  +I+ + +   +T+          +  + 
Sbjct: 1062 LNRVRIGAAQFSDTYHPEFPLGAFIGEKEISFQIENIKQIFGNTHIGAA-----LRKVEH 1116

Query: 274  QGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSH 333
                   +  +    ++++ +TD      +   +        + RG  +Y++GI  +   
Sbjct: 1117 YFRPDMGSRINTGTPQVLLVLTD-----GQSQDEVAQAAEALRHRGIDIYSVGIGDVDDQ 1171

Query: 334  EFLRACASPNSFYLVENPHSMYDAFSHIGKDIVT 367
            + ++   +      V N   +      I ++I T
Sbjct: 1172 QLIQITGTAEKKLTVHNFDELKKVNKRIVRNICT 1205



 Score = 81.1 bits (198), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 43/332 (12%), Positives = 103/332 (31%), Gaps = 26/332 (7%)

Query: 44   FFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGF 103
            F  ++ + + ID+      T +         +              + +   +    +  
Sbjct: 707  FMSQSDISNAIDQMAHIGQTTLTGSALSFVSQYFSPTKGARPNVRKFLILITDGEAQDIV 766

Query: 104  VNDIDDIVRSTSLDIVVVPQNEGYS--ISAISRYKIPLKFCTFIPWYTNSRHIVMPITSS 161
                  + +   +   V       +       R ++      F         +V  I  S
Sbjct: 767  KEPAIALRQEGVIIYSVGVFGSNVTQLEEISGRPEMVFYVENFDILQRVEDDLVFGI-CS 825

Query: 162  VKVNSQTDARLDMMIVLDVSRSMESFFDSSI--TKIDMAIKSINAMLEEVKLIPDVNNVV 219
             +   +    LD++ V+D S S++    + +    I +  K+               N V
Sbjct: 826  PREECKRIEVLDVVFVIDSSGSIDYDEYNIMKDFMIGLVKKA-----------DVGKNQV 874

Query: 220  QSGLVTFSNKIEEFFL--LEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
            + G + +++  E  F          +   ++     G +T +   L +      D     
Sbjct: 875  RFGALKYADDPEVLFYLDDFGTKLEVISVLQNDQAMGGNTYTAEALGF-----SDHMFTE 929

Query: 278  QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
               +  +    ++++ +TDGE+    +  +        + +G +V A+GI      E L 
Sbjct: 930  ARGSRLNKGVPQVLIVITDGESH---DADKLNATAKALRDKGILVLAVGIAGANPVELLA 986

Query: 338  ACASPNSFYLVENPHSMYDAFSHIGKDIVTKR 369
               S + ++ VE    +   FS +   +    
Sbjct: 987  MAGSSDKYFFVETFGGLKGIFSDVTASVCNSS 1018



 Score = 57.6 bits (137), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 36/313 (11%), Positives = 93/313 (29%), Gaps = 32/313 (10%)

Query: 31  FLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTW 90
           F  +G  +++          +           +   N  +      +         ++  
Sbjct: 126 FGFIGGSLQIGKALQEAHRTY----------FSAPANGRDKKQFPPILVVLASSESEDDV 175

Query: 91  NMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTN 150
             + +   +D   +  +     S      +      +++  +    +  +  T I     
Sbjct: 176 EEASKALQKDGVKIISVGVQKASEENLKAMATSQFHFNLRTVRDLSMFSQNMTHIIKDVT 235

Query: 151 SRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVK 210
                  +        Q  +  D++ +LD+S       + S    D        + E V 
Sbjct: 236 KYK-EGAVDDIFVEACQGPSMADVVFLLDMS------INGSEENFDYLK---GFLEESVS 285

Query: 211 LIPDVNNVVQSGLVTFSNKIEEFFL--LEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYN 268
            +    N ++ GLV +SN+ +      +    S + + I+ LS       +      A  
Sbjct: 286 ALDIKENCMRVGLVAYSNETKVINSLSMGINKSEVLQHIQNLSPRTGKAYTGA----AIK 341

Query: 269 QIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR 328
           ++       ++ + ++    +I V +T         +          ++ G  ++ +GI 
Sbjct: 342 KLRKEVFSARNGSRKNQGVPQIAVLVTH-----RDSEDNVTKAAVNLRREGVTIFTLGIE 396

Query: 329 VIRSHEFLRACAS 341
                + L   AS
Sbjct: 397 GASDTQ-LEKIAS 408



 Score = 44.5 bits (103), Expect = 0.026,   Method: Composition-based stats.
 Identities = 32/201 (15%), Positives = 68/201 (33%), Gaps = 25/201 (12%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D++ ++D S                       + + +  +P   +  +  L  +S+K+  
Sbjct: 55  DVVFLVDSS------DRLGSKSFPFVKM---FITKMISSLPIEADKYRVALAQYSDKLHS 105

Query: 233 FFL--LEWGVSHLQRKI-KYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
            F      G S +   + K     G S      L+ A+   F           +   +  
Sbjct: 106 EFHLSTFKGRSPMLNHLRKNFGFIGGSLQIGKALQEAHRTYFSAPA----NGRDKKQFPP 161

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYL-- 347
           I+V +      S++ +          +K G  + ++G++   S E L+A A+    +   
Sbjct: 162 ILVVLA-----SSESEDDVEEASKALQKDGVKIISVGVQK-ASEENLKAMATSQFHFNLR 215

Query: 348 -VENPHSMYDAFSHIGKDIVT 367
            V +        +HI KD+  
Sbjct: 216 TVRDLSMFSQNMTHIIKDVTK 236


>gi|84385370|ref|ZP_00988402.1| hypothetical protein V12B01_16906 [Vibrio splendidus 12B01]
 gi|84379967|gb|EAP96818.1| hypothetical protein V12B01_16906 [Vibrio splendidus 12B01]
          Length = 319

 Score =  105 bits (261), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 33/219 (15%), Positives = 69/219 (31%), Gaps = 46/219 (21%)

Query: 173 DMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
           D+M+V+D+S SM           I ++      ++  +E            + GLV F++
Sbjct: 83  DLMLVVDLSGSMSQEDMQFNGEYIDRLSAVKHVLSDFIER-------RKGDRVGLVLFAD 135

Query: 229 KIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
                  L      L +++    L   G  T    G+  A                +   
Sbjct: 136 HAYLQTPLTLDRDTLSQQLNQAVLKLIGTQTAIGDGIGLATKTFV-----------DSDA 184

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV----------------- 329
            +++++ ++DG N +       L   + AKK  A +Y +G+                   
Sbjct: 185 PQRVMILLSDGSNTAG--VLDPLEAADIAKKYNATIYTVGVGAGEMMVKEFFMTRKVNTA 242

Query: 330 -IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                  L   A  +   ++   +   +   +  I +  
Sbjct: 243 QDLDERTLMEIAKRTGGQYFRARDSKELATIYDTINQLE 281


>gi|258620051|ref|ZP_05715090.1| conserved hypothetical protein [Vibrio mimicus VM573]
 gi|258587409|gb|EEW12119.1| conserved hypothetical protein [Vibrio mimicus VM573]
          Length = 308

 Score =  104 bits (260), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 29/219 (13%), Positives = 70/219 (31%), Gaps = 46/219 (21%)

Query: 173 DMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
           D+M+V+D+S SM           + ++    + ++  + +           + GL+ F++
Sbjct: 75  DLMLVVDLSYSMSQEDMQSGQQMVDRLTAVKQVLSEFITK-------REGDRMGLILFAD 127

Query: 229 KIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
                  L      +  ++    L   G  T    G+  A                +   
Sbjct: 128 HAYLQTPLTLDRQTVISQLNQAVLKLIGTQTAIGEGIGLATKTFI-----------DSDA 176

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV----------------- 329
            +++++ ++DG N +       L   N AK+    +Y +G+                   
Sbjct: 177 PQRVMILLSDGSNTAG--VLDPLEAANIAKQYQTTIYTVGVGAGEMIVKDFLFSRKVNTA 234

Query: 330 -IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                + L+  A  +   ++   N   +   +  I +  
Sbjct: 235 QDLDEKTLQTIASTTGGQYFRARNQQDLQSIYDTINQLE 273


>gi|332534652|ref|ZP_08410484.1| protein BatA [Pseudoalteromonas haloplanktis ANT/505]
 gi|332035932|gb|EGI72413.1| protein BatA [Pseudoalteromonas haloplanktis ANT/505]
          Length = 328

 Score =  104 bits (260), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 33/251 (13%), Positives = 76/251 (30%), Gaps = 47/251 (18%)

Query: 142 CTFIPWYTNSRHIVMPITSS--VKVNSQTDARLDMMIVLDVSRSMESFFD----SSITKI 195
              + W      +      +   +  S  +   D+M+ +D+S SM           + ++
Sbjct: 55  LNPLEWIIWLLLVTAAANPTWLDEPISLPNEGRDIMLAVDLSGSMTEQDMAYNGQYVDRL 114

Query: 196 DMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIK--YLSKF 253
            M    ++  +E+           + GL+ F +       L   V  + + +    +   
Sbjct: 115 TMVKAVLSDFIEQ-------RQGDRLGLILFGDTAFLQTPLTRDVKTVSKMLSEAQIGLV 167

Query: 254 GVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCN 313
           G +T                 G+            +I+V +TDG+N +            
Sbjct: 168 GRATAIGDA-----------LGLSVKRFANKDESNRIVVLLTDGQNTAGN--LNPEDALL 214

Query: 314 EAKKRGAIVYAIGIRVIR-----------------SHEFLRACA--SPNSFYLVENPHSM 354
            A++ G  VY IG+                         L+  A  +   ++  ++   +
Sbjct: 215 LAREEGIKVYTIGVGSDNPRGFSLFNVGGSSGSNLDESLLKKIAEQTGGLYFRAKDVAGL 274

Query: 355 YDAFSHIGKDI 365
              ++ + K  
Sbjct: 275 QQIYAELDKLE 285


>gi|328675375|gb|AEB28050.1| BatA in aerotolerance operon [Francisella cf. novicida 3523]
          Length = 333

 Score =  104 bits (260), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 33/217 (15%), Positives = 68/217 (31%), Gaps = 37/217 (17%)

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
             D+++ +D+S SM                  + ++       D     + GL+ F  + 
Sbjct: 91  GRDLIMAIDLSGSMAIQDMKKSN--GQMESRFDLVMRVANQFLDTRKGDRVGLILFGTRA 148

Query: 231 EEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
                L + ++ +++ +    ++  G  T     +  A  ++    G             
Sbjct: 149 YLQTPLTFDIATVKKMLDDASIALPGPQTAIGDAIGLAVKKLKKYPGDS----------- 197

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV------------------I 330
           K ++ +TDGEN S     Q L     AK+    +Y IG+                     
Sbjct: 198 KALILLTDGENNSGT--LQPLQAAEIAKQYHIKIYTIGLGGGQMIVETTFGQRLINTSED 255

Query: 331 RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                L   A  +   ++  +N   +   +  I K  
Sbjct: 256 LDTTVLEKIAEMTGGKYFRAQNSSDLKKVYESIDKLE 292


>gi|157962424|ref|YP_001502458.1| von Willebrand factor type A [Shewanella pealeana ATCC 700345]
 gi|157847424|gb|ABV87923.1| von Willebrand factor type A [Shewanella pealeana ATCC 700345]
          Length = 336

 Score =  104 bits (260), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/218 (12%), Positives = 65/218 (29%), Gaps = 38/218 (17%)

Query: 170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229
              D+M+ +D+S SM+        K    +     +   +    +     + GL+ F++ 
Sbjct: 82  KGRDLMLSVDLSGSMQIEDMVIDGK---VVDRFTLIQHVISDFIERRKGDRIGLILFADH 138

Query: 230 IEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287
                 L      + + +K   +   G  T     +     +   ++             
Sbjct: 139 AYLQSPLTQDRRSVAQYLKEAQIGLVGKQTAIGEAIALGVKRFDKVEQSN---------- 188

Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR---------------- 331
            ++++ +TDG N +     +       A +RG  +Y IG+                    
Sbjct: 189 -RVLILLTDGSNNAGAITPE--QASQIAAQRGITIYTIGVGADVMERRTLFGKERVNPSM 245

Query: 332 --SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                 L+  A  +   ++   N   +   +  I    
Sbjct: 246 DLDESQLQEIAKVTGGQYFRARNTEELEQIYQVIDTLE 283


>gi|288925756|ref|ZP_06419687.1| BatA protein [Prevotella buccae D17]
 gi|315608294|ref|ZP_07883284.1| aerotolerance protein BatA [Prevotella buccae ATCC 33574]
 gi|288337411|gb|EFC75766.1| BatA protein [Prevotella buccae D17]
 gi|315250075|gb|EFU30074.1| aerotolerance protein BatA [Prevotella buccae ATCC 33574]
          Length = 332

 Score =  104 bits (260), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 39/232 (16%), Positives = 70/232 (30%), Gaps = 51/232 (21%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
           +T   +D+M+ +DVS SM +       +I+ A       +               GL  F
Sbjct: 83  KTVEGIDIMLAMDVSASMLAEDLK-PNRIEAAKDVAAEFI-------SGRPNDNIGLTIF 134

Query: 227 SNKIEEFFLLEWGVSHLQRKIKYLSKFG-------VSTNSTPGLKYAYNQIFDMQGMRQH 279
           + +      +    + L   ++ +             T    GL  A +           
Sbjct: 135 AGEAFTQCPMTTDHASLLTLLQDVRTDMATRGLINDGTAIGMGLANAVS----------- 183

Query: 280 CNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV---------- 329
              +     ++++ +TDG N +   D   L     AK  G  VY I +            
Sbjct: 184 RLKDSKTKSRVVILLTDGANNAG--DISPLTAAQMAKSLGIRVYTIAVGTSKVAPYPIEV 241

Query: 330 -----------IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                          + LR  A  +  +FY   N   +   +  I +   TK
Sbjct: 242 GGRVQYISRPADIDTKTLREIAAVTEGNFYSANNTAQLKQIYHDIDQLEKTK 293


>gi|254514588|ref|ZP_05126649.1| von Willebrand factor, type A [gamma proteobacterium NOR5-3]
 gi|219676831|gb|EED33196.1| von Willebrand factor, type A [gamma proteobacterium NOR5-3]
          Length = 347

 Score =  104 bits (260), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 33/223 (14%), Positives = 74/223 (33%), Gaps = 42/223 (18%)

Query: 169 DARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
           ++  D+M+ +D+S SM         ++   I ++  +  +        +  + GL+ F +
Sbjct: 89  NSGRDLMLAVDISGSMRVEDMQVGNRMARRIDAVKQLGSDFM---SRRSGDRLGLILFGS 145

Query: 229 KIEEFFLLEWGVSHLQRKI--KYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
           +      L + +  +QR +    +   G  T     +  A  ++            E   
Sbjct: 146 RAYLQSPLSFDIQTVQRFLLESQIGFAGQETAIGDAIGLAVKRLQ-----------ERPA 194

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR--------------- 331
             ++++ +TDG++ +       L   N A   G  +Y IGI                   
Sbjct: 195 TSRVLILLTDGQDTA--STVDPLEAANLAADLGVRIYTIGIGADSLTLPGLLGSPLGART 252

Query: 332 -------SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                      L A A  +   ++   +P  +   +  + K  
Sbjct: 253 VNPSADLDENSLIAIASSTGGQYFRARDPEELATVYRLLEKLE 295


>gi|254372185|ref|ZP_04987677.1| conserved hypothetical protein [Francisella tularensis subsp.
           novicida GA99-3549]
 gi|151569915|gb|EDN35569.1| conserved hypothetical protein [Francisella novicida GA99-3549]
          Length = 339

 Score =  104 bits (260), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 39/259 (15%), Positives = 81/259 (31%), Gaps = 42/259 (16%)

Query: 134 RYKIPLKFCTFIPWYTNSRHIVMPITSSV-----KVNSQTDARLDMMIVLDVSRSMESFF 188
                 K   ++ +      I++ I+ S      K  S   +  D+++ +D+S SM    
Sbjct: 55  AGTRNFKRANYLKYLLGFIWILLIISGSGIQWLGKPVSLPQSGRDLIMAIDLSGSMAIQD 114

Query: 189 DSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIK 248
                         + ++       D     + GL+ F  +      L + ++ +++ + 
Sbjct: 115 MKKAN--GQMESRFDLVMRVANQFLDTRKGDRVGLILFGTRAYLQTPLTFDIATVKKMLD 172

Query: 249 --YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQ 306
              ++  G  T     +  A  ++    G             K ++ +TDGEN S     
Sbjct: 173 DASIALPGPQTAIGDAIGLAVKKLKKYPGDS-----------KALILLTDGENNSGT--L 219

Query: 307 QSLYYCNEAKKRGAIVYAIGIRV------------------IRSHEFLRACA--SPNSFY 346
           Q L     AK+    +Y IG+                          L   A  +   ++
Sbjct: 220 QPLQAAEIAKQYHIKIYTIGLGGGQMIVETTFGQRLVNTSEDLDTTVLEKIATMTGGKYF 279

Query: 347 LVENPHSMYDAFSHIGKDI 365
             +N   +   +  I K  
Sbjct: 280 RAQNSSDLKKVYESIDKLE 298


>gi|319426861|gb|ADV54935.1| von Willebrand factor type A [Shewanella putrefaciens 200]
          Length = 339

 Score =  104 bits (260), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 29/218 (13%), Positives = 64/218 (29%), Gaps = 38/218 (17%)

Query: 170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229
              D+M+ +D+S SM+        K    +     +   V    +     + GL+ F++ 
Sbjct: 82  KGRDLMMAVDLSGSMQIEDMVVNGK---TVDRFTLIQHVVSDFIERRKGDRIGLILFADH 138

Query: 230 IEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287
                 L      + + +K   +   G  T     +  A  +   +              
Sbjct: 139 AYLQAPLTQDRRSVAQFLKEAQIGLVGKQTAIGEAIALAVKRFDKIDESN---------- 188

Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR---------------- 331
            ++++ +TDG N +     +       A  R   +Y +G+                    
Sbjct: 189 -RVLILLTDGSNNAGNI--EPEQAAQIAANRKVTIYTVGVGADVMERRTLFGRERVNPSM 245

Query: 332 --SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                 L+  A  +   ++   N   +   +  I K  
Sbjct: 246 DLDENQLKHIADVTHGRYFRARNSQELDQIYQEIDKLE 283


>gi|120598362|ref|YP_962936.1| von Willebrand factor, type A [Shewanella sp. W3-18-1]
 gi|146293560|ref|YP_001183984.1| von Willebrand factor, type A [Shewanella putrefaciens CN-32]
 gi|120558455|gb|ABM24382.1| von Willebrand factor, type A [Shewanella sp. W3-18-1]
 gi|145565250|gb|ABP76185.1| von Willebrand factor, type A [Shewanella putrefaciens CN-32]
          Length = 339

 Score =  104 bits (259), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 29/218 (13%), Positives = 64/218 (29%), Gaps = 38/218 (17%)

Query: 170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229
              D+M+ +D+S SM+        K    +     +   V    +     + GL+ F++ 
Sbjct: 82  KGRDLMMAVDLSGSMQIEDMVVNGK---TVDRFTLIQHVVSDFIERRKGDRIGLILFADH 138

Query: 230 IEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287
                 L      + + +K   +   G  T     +  A  +   +              
Sbjct: 139 AYLQAPLTQDRRSVAQFLKEAQIGLVGKQTAIGEAIALAVKRFDKIDESN---------- 188

Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR---------------- 331
            ++++ +TDG N +     +       A  R   +Y +G+                    
Sbjct: 189 -RVLILLTDGSNNAGNI--EPEQAAQIAANRKVTIYTVGVGADVMERRTLFGRERVNPSM 245

Query: 332 --SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                 L+  A  +   ++   N   +   +  I K  
Sbjct: 246 DLDENQLKHIADVTHGRYFRARNSQELDQIYQEIDKLE 283


>gi|313885991|ref|ZP_07819729.1| von Willebrand factor type A domain protein [Porphyromonas
           asaccharolytica PR426713P-I]
 gi|312924521|gb|EFR35292.1| von Willebrand factor type A domain protein [Porphyromonas
           asaccharolytica PR426713P-I]
          Length = 326

 Score =  104 bits (259), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 33/223 (14%), Positives = 71/223 (31%), Gaps = 46/223 (20%)

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
            +D+++ +D+S SM++       + + A    + M+               GLV F+ + 
Sbjct: 86  GIDLVLAMDLSGSMQALDLK-PNRFEAARDVASEMIAA-------RPNDNIGLVVFAGES 137

Query: 231 EEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
                L    + +Q+ ++   + +    T    GL  A N                 N  
Sbjct: 138 FTLCPLTVDHNVIQQMLETTEIGQLEDGTAIGLGLATAINT-----------LRGSDNKS 186

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIG--------------IRVIR--- 331
           K+I+ +TDG N +             A++ G  +Y +                       
Sbjct: 187 KVIILLTDGSNNAGDITPSM--AAELAQQYGIRIYTVAAGTNGVAKFPVQTAFGTEYVEA 244

Query: 332 ----SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                   LR  A  +   +Y   +   +++ +  I     ++
Sbjct: 245 DVQIDEGTLRHIAEQTGGKYYRATDETKLHEIYKEIDSLEKSR 287


>gi|167624593|ref|YP_001674887.1| von Willebrand factor type A [Shewanella halifaxensis HAW-EB4]
 gi|167354615|gb|ABZ77228.1| von Willebrand factor type A [Shewanella halifaxensis HAW-EB4]
          Length = 345

 Score =  104 bits (259), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 30/218 (13%), Positives = 67/218 (30%), Gaps = 38/218 (17%)

Query: 170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229
              D+M+ +D+S SM+        K    +   + +   +    +     + GL+ F++ 
Sbjct: 82  KGRDLMLSVDLSGSMQIEDMVLDGK---VVDRFSLIQHVISDFIERRKGDRIGLILFADH 138

Query: 230 IEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287
                 L      + + +K   +   G  T     +  A  +   ++             
Sbjct: 139 AYLQSPLTQDRRTVAQYLKEAQIGLVGKQTAIGEAIALAVKRFDKVEQSN---------- 188

Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR---------------- 331
            ++++ +TDG N +     +       A KRG  +Y IG+                    
Sbjct: 189 -RVLILLTDGSNNAGAISPE--QATQIAAKRGITIYTIGVGADVMERRTLFGKERVNPSM 245

Query: 332 --SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                 L+  A  +   ++   N   +   +  I    
Sbjct: 246 DLDESQLQEIAKTTGGQYFRARNTEELEQIYQVIDTLE 283


>gi|330504126|ref|YP_004380995.1| von Willebrand factor, type A [Pseudomonas mendocina NK-01]
 gi|328918412|gb|AEB59243.1| von Willebrand factor, type A [Pseudomonas mendocina NK-01]
          Length = 334

 Score =  104 bits (259), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 31/219 (14%), Positives = 69/219 (31%), Gaps = 44/219 (20%)

Query: 171 RLDMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+++ +DVS SM+          I+++++  + +   +E            + GL+ F
Sbjct: 89  GRDLLLAVDVSGSMDYADMQWDDEPISRLELVKRLLGDFIEG-------RRGDRVGLILF 141

Query: 227 SNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
            ++      L +    ++  +    +   G +T     +  A                + 
Sbjct: 142 GSQAYLQAPLTFDRHTVRTWLDEALIGIAGKNTAIGDAIGLAVK-----------RLRQR 190

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR------------- 331
               +++V +TDG N   + D         A   G  +Y IGI                 
Sbjct: 191 PAQSRVLVLITDGANNGGEIDPMV--AAQLAADEGVRIYTIGIGADPQQSGAFGSFGFSA 248

Query: 332 ---SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                  LRA +  +   ++   N   +      + +  
Sbjct: 249 LDLDETSLRAISDTTGGEYFRARNQAELEQIELTLDRLE 287


>gi|127513358|ref|YP_001094555.1| von Willebrand factor, type A [Shewanella loihica PV-4]
 gi|126638653|gb|ABO24296.1| von Willebrand factor, type A [Shewanella loihica PV-4]
          Length = 339

 Score =  104 bits (259), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 33/222 (14%), Positives = 68/222 (30%), Gaps = 38/222 (17%)

Query: 170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229
              D+M+ +D+S SM+        K   A+     + + +    +     + GL+ F++ 
Sbjct: 88  KGRDLMLAVDLSGSMQIEDMVLNGK---AVDRFAMVQQVMSEFIERRKGDKLGLILFADH 144

Query: 230 IEEFFLLEWGVSHLQRKI--KYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287
                 L      + + +    +   G  T     +  A  +    +             
Sbjct: 145 AYLQAPLTQDRRSVAQFLTEAQIGLVGKQTAIGEAIALAVKRFDKAKQSN---------- 194

Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR---------------- 331
            ++++ +TDG N S     +     + A KRG  +Y IG+                    
Sbjct: 195 -RVLILLTDGSNNSGSITPE--QAADIAAKRGVTIYTIGVGAEVMERRTLFGKERVNPSM 251

Query: 332 --SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKR 369
                 L   A  +   ++   N   +   +  I K   T  
Sbjct: 252 DLDEAQLTLLAQKTKGRYFRARNSDELEQIYQEIDKLEPTDS 293


>gi|332299342|ref|YP_004441263.1| von Willebrand factor type A [Porphyromonas asaccharolytica DSM
           20707]
 gi|332176405|gb|AEE12095.1| von Willebrand factor type A [Porphyromonas asaccharolytica DSM
           20707]
          Length = 326

 Score =  104 bits (259), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 33/223 (14%), Positives = 71/223 (31%), Gaps = 46/223 (20%)

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
            +D+++ +D+S SM++       + + A    + M+               GLV F+ + 
Sbjct: 86  GIDLVLAMDLSGSMQALDLK-PNRFEAARDVASEMIAA-------RPNDNIGLVVFAGES 137

Query: 231 EEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
                L    + +Q+ ++   + +    T    GL  A N                 N  
Sbjct: 138 FTLCPLTVDHNVIQQMLETTEIGQLEDGTAIGLGLATAINT-----------LRGSDNKS 186

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIG--------------IRVIR--- 331
           K+I+ +TDG N +             A++ G  +Y +                       
Sbjct: 187 KVIILLTDGSNNAGDITPSM--AAELAQQYGIRIYTVAAGTNGVAKFPVQTAFGTEYVEA 244

Query: 332 ----SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                   LR  A  +   +Y   +   +++ +  I     ++
Sbjct: 245 DVQIDEGTLRHIAEQTGGKYYRATDETKLHEIYKEIDSLEKSR 287


>gi|119470787|ref|ZP_01613398.1| hypothetical protein ATW7_05591 [Alteromonadales bacterium TW-7]
 gi|119446014|gb|EAW27293.1| hypothetical protein ATW7_05591 [Alteromonadales bacterium TW-7]
          Length = 328

 Score =  104 bits (259), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 30/222 (13%), Positives = 71/222 (31%), Gaps = 45/222 (20%)

Query: 169 DARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           +   D+M+ +D+S SM           + ++ M    ++  +E+           + GL+
Sbjct: 84  NEGRDIMLAVDLSGSMTEQDMAYNGQYVDRLTMVKAVLSDFIEQ-------RTGDRLGLI 136

Query: 225 TFSNKIEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            F +       L   +  + + +    +   G +T                 G+      
Sbjct: 137 LFGDTAFLQTPLTRDLKTVTKMLNEAQIGLVGRATAIGDA-----------LGLSVKRFA 185

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR----------- 331
              +  +I+V +TDG+N +             A++ G  VY IG+               
Sbjct: 186 SKDDSNRIVVLLTDGQNTAGN--LNPDDALLLAREEGIKVYTIGVGSDNPRGFSLFNMGG 243

Query: 332 ------SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                     L+  A  +   ++  ++   +   ++ + K  
Sbjct: 244 SGGSNLDERLLKNIADDTGGLYFRAKDVAGLKQIYAELDKLE 285


>gi|88858061|ref|ZP_01132703.1| hypothetical protein PTD2_11764 [Pseudoalteromonas tunicata D2]
 gi|88819678|gb|EAR29491.1| hypothetical protein PTD2_11764 [Pseudoalteromonas tunicata D2]
          Length = 328

 Score =  104 bits (259), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 31/220 (14%), Positives = 71/220 (32%), Gaps = 43/220 (19%)

Query: 169 DARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           +   D+M+ +D+S SM           + ++ M    +   + +           + GL+
Sbjct: 84  NEGRDIMLAVDLSGSMVEQDMAYQGRYVDRLSMVKAVLKNFIAQ-------RQGDRLGLI 136

Query: 225 TFSNKIEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            F +       L   ++ + + ++   +   G +T     L  A  +             
Sbjct: 137 LFGDTAFLQTPLTRDLNTVSKMLEEAQIGLVGRATAIGDALGLAVKRFSQ---------- 186

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR-------------- 328
              +  +I+V +TDGEN +             A++ G  VY +G+               
Sbjct: 187 -KQDSNRILVLLTDGENTAGN--LAPEEALLLAREEGIKVYTVGVGSQGGNRFNLFSMSG 243

Query: 329 -VIRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                   L+  A  +   ++   +  S+   +  + K  
Sbjct: 244 SSSLDESLLQKIATETGGLYFRATDVASLQQIYQELDKLE 283


>gi|328676285|gb|AEB27155.1| BatA in aerotolerance operon [Francisella cf. novicida Fx1]
          Length = 333

 Score =  104 bits (259), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 33/217 (15%), Positives = 68/217 (31%), Gaps = 37/217 (17%)

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
             D+++ +D+S SM                  + ++       D     + GL+ F  + 
Sbjct: 91  GRDLIMAIDLSGSMAIQDMKKAN--GQMESRFDLVMRVANQFLDTRKGDRVGLILFGTRA 148

Query: 231 EEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
                L + ++ +++ +    ++  G  T     +  A  ++    G             
Sbjct: 149 YLQTPLTFDIATVKKMLDDASIALPGPQTAIGDAIGLAVKKLKKYPGDS----------- 197

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV------------------I 330
           K ++ +TDGEN S     Q L     AK+    +Y IG+                     
Sbjct: 198 KALILLTDGENNSGT--LQPLQAAEIAKQYHIKIYTIGLGGGQMIVETTFGQRLVNTSED 255

Query: 331 RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                L   A  +   ++  +N   +   +  I K  
Sbjct: 256 LDTTVLEKIATMTGGKYFRAQNSSDLKKVYESIDKLE 292


>gi|282877523|ref|ZP_06286341.1| von Willebrand factor type A domain protein [Prevotella buccalis
           ATCC 35310]
 gi|281300347|gb|EFA92698.1| von Willebrand factor type A domain protein [Prevotella buccalis
           ATCC 35310]
          Length = 332

 Score =  104 bits (259), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 36/223 (16%), Positives = 68/223 (30%), Gaps = 39/223 (17%)

Query: 170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229
             +D+M+ +DVS SM +       +++ A       +               GL  F+ +
Sbjct: 86  EGIDIMLAMDVSTSMLAEDL-RPNRLEAAKNVAAEFISG-------RPNDNIGLTIFAGE 137

Query: 230 IEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTP-GLKYAYNQIFDMQGMRQHCNTEDANYK 288
                 +    + L   ++ +      T+    GL      +            +     
Sbjct: 138 SFTQCPMTTDHASLLNLLRNVR-----TDIAARGLISDGTAVGMGLANAVSRLKDSKAKS 192

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI------------------ 330
           K+++ +TDG N     D   +     A+  G  VY IG+                     
Sbjct: 193 KVVILITDGSNNMG--DISPMTSAQIAQSLGIRVYTIGVGTNKVAPYPMNVGGTTQYVNI 250

Query: 331 ---RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                 + L   A  +  +FY   N   +   ++ I K   TK
Sbjct: 251 PVEIDSKTLSDIAAVTEGNFYRATNNKELKQIYNDIDKLEKTK 293


>gi|222528069|ref|YP_002571951.1| YD repeat-containing protein [Caldicellulosiruptor bescii DSM 6725]
 gi|222454916|gb|ACM59178.1| YD repeat protein [Caldicellulosiruptor bescii DSM 6725]
          Length = 3027

 Score =  104 bits (258), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 48/206 (23%), Positives = 78/206 (37%), Gaps = 32/206 (15%)

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
           ++D++ VLD S SM S   +   +I+   K I  + E            + GLV F + +
Sbjct: 766 KVDIVFVLDNSGSMSSNDPNY-YRIEATKKFIQNIDEL---------NNRVGLVDFDSSV 815

Query: 231 EEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKI 290
                L    S L + +  +   G STN   GLK A                +    KKI
Sbjct: 816 SVRSNLTSDKSKLLQALNAMRWTGGSTNIGGGLKAALGLF------------DQEQSKKI 863

Query: 291 IVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA--SPNSFYLV 348
           IV ++DG + +       L    E  K+  +V  I +      E L   A  +   ++ V
Sbjct: 864 IVLLSDGYHNTGIHPNDVL---PELIKQEIVVNTIALGKDCDRELLHDIADKTKGGYFYV 920

Query: 349 ENPHSMYDAFSHIGKDIVTKRIWYDK 374
           +N   +      + K I    + Y+K
Sbjct: 921 DNTGGLSQ--EDVDKQI---ELIYEK 941


>gi|254496635|ref|ZP_05109500.1| conserved hypothetical protein [Legionella drancourtii LLAP12]
 gi|254354157|gb|EET12827.1| conserved hypothetical protein [Legionella drancourtii LLAP12]
          Length = 342

 Score =  104 bits (258), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 31/225 (13%), Positives = 74/225 (32%), Gaps = 46/225 (20%)

Query: 168 TDARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGL 223
                ++M+ LD+S SME           +++ +   +    + +           + GL
Sbjct: 86  EREGYNIMMALDLSGSMEIPDMILHDRPASRLTVVKNAAEQFVRD-------RLGDKIGL 138

Query: 224 VTFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCN 281
           + F ++      L +    +  +I+   +   G +T+    +  A  ++  +        
Sbjct: 139 ILFGSRAYLQTPLTYDRQTVLLRIEDATVGLAGKTTSIGDAVGLAVKRLDAVPQKG---- 194

Query: 282 TEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR------------- 328
                  ++I+ +TDG N S     + L     AK  G  +Y IG+              
Sbjct: 195 -------RVIILLTDGANNSG--ILEPLKAAELAKDEGIKIYTIGLGAATDPRALTNGFL 245

Query: 329 -----VIRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIV 366
                     E L+  +  +   ++   +  ++   +  I +   
Sbjct: 246 MQAAAADLDEETLKEMSAMTGGRYFRATDTATLNSIYKTINQLER 290


>gi|312961300|ref|ZP_07775805.1| von Willebrand factor, type A [Pseudomonas fluorescens WH6]
 gi|311284958|gb|EFQ63534.1| von Willebrand factor, type A [Pseudomonas fluorescens WH6]
          Length = 362

 Score =  104 bits (258), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 29/220 (13%), Positives = 69/220 (31%), Gaps = 45/220 (20%)

Query: 171 RLDMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+++ +DVS SM+          ++++ +    +   L++           + GL+ F
Sbjct: 89  GRDLLVAVDVSGSMDFPDMHWRDEDVSRLSLVKHLLGDFLQQ-------REGDRVGLILF 141

Query: 227 SNKIEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
            ++      L +    ++  +    +   G +T     +  A                  
Sbjct: 142 GSQAYLQAPLTFDRRTVRTWLDEARIGIAGKNTAIGDAIGLALK-----------RLRLR 190

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR------------- 331
               ++++ +TDG N + + D   L     A + G  +Y IGI                 
Sbjct: 191 PAQSRVLILITDGANNAGQID--PLTAARLAAEEGVKIYPIGIGADPEQTGSLGILGVNP 248

Query: 332 ----SHEFLRAC--ASPNSFYLVENPHSMYDAFSHIGKDI 365
                   L+A   A+   ++   +   +      +    
Sbjct: 249 SLDLDEPALKAIAAATGGQYFRARDGEELQAIKQTLDTLE 288


>gi|228471029|ref|ZP_04055873.1| BatA protein [Porphyromonas uenonis 60-3]
 gi|228307249|gb|EEK16272.1| BatA protein [Porphyromonas uenonis 60-3]
          Length = 326

 Score =  104 bits (258), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 32/223 (14%), Positives = 68/223 (30%), Gaps = 46/223 (20%)

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
            +D+++ +D+S SM++       + + A    + M+               GLV F+ + 
Sbjct: 86  GIDLVLAMDLSGSMQALDLK-PNRFEAARDVASEMIAA-------RPNDNIGLVVFAGES 137

Query: 231 EEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
                L      + + +    + +    T    GL  A N                 N  
Sbjct: 138 FTLCPLTVDHDVILQMLDATEIGQLEDGTAIGLGLATAINT-----------LRGSDNKS 186

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI------------------ 330
           K+I+ +TDG N +             A++ G  +Y +                       
Sbjct: 187 KVIILLTDGSNNAGDITPSM--AAELAQQYGIRIYTVAAGTNGVAKFPVQTASGIEYVEA 244

Query: 331 ---RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                   LR  A  +   +Y   +   +++ +  I     ++
Sbjct: 245 DVQIDEGTLRHIAQQTGGKYYRATDETKLHEIYKEIDSLEKSR 287


>gi|254373668|ref|ZP_04989152.1| conserved hypothetical protein [Francisella novicida GA99-3548]
 gi|151571390|gb|EDN37044.1| conserved hypothetical protein [Francisella novicida GA99-3548]
          Length = 339

 Score =  104 bits (258), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 33/217 (15%), Positives = 68/217 (31%), Gaps = 37/217 (17%)

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
             D+++ +D+S SM                  + ++       D     + GL+ F  + 
Sbjct: 97  GRDLIMAIDLSGSMAIQDMKKAN--GQMESRFDLVMRVANQFLDTRKGDRVGLILFGTRA 154

Query: 231 EEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
                L + ++ +++ +    ++  G  T     +  A  ++    G             
Sbjct: 155 YLQTPLTFDIATVKKMLDDASIALPGPQTAIGDAIGLAVKKLKKFPGDS----------- 203

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV------------------I 330
           K ++ +TDGEN S     Q L     AK+    +Y IG+                     
Sbjct: 204 KALILLTDGENNSGT--LQPLQAAEIAKQYHIKIYTIGLGGGQMIVETTFGQRLVNTSED 261

Query: 331 RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                L   A  +   ++  +N   +   +  I K  
Sbjct: 262 LDTTVLEKIATMTGGKYFRAQNSSDLKKVYESIDKLE 298


>gi|120403735|ref|YP_953564.1| hypothetical protein Mvan_2751 [Mycobacterium vanbaalenii PYR-1]
 gi|166988604|sp|A1T8Q8|Y2751_MYCVP RecName: Full=UPF0353 protein Mvan_2751
 gi|119956553|gb|ABM13558.1| von Willebrand factor, type A [Mycobacterium vanbaalenii PYR-1]
          Length = 335

 Score =  104 bits (258), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 32/249 (12%), Positives = 72/249 (28%), Gaps = 30/249 (12%)

Query: 141 FCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIK 200
               +    +     + +            R  +M+V+DVS+SM +    +  ++  A +
Sbjct: 66  HLPAVLLILSLMSFTVAMAGPTHDVRIPRNRAVVMLVIDVSQSMRATD-VAPNRLVAAQE 124

Query: 201 SINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNST 260
           +     +++    +       GL+ ++                +  I  L      T + 
Sbjct: 125 AAKQFADQLTPGIN------LGLIAYAGTATVLVSPTTNREATKAAIDKLQ-LADRTATG 177

Query: 261 PGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSL---YYCNEAKK 317
            G+  A   +  +          D      IV M+DG+                   AK 
Sbjct: 178 EGIFTALQAVATV---GAVIGGGDEPPPARIVLMSDGKETVPSNPDNPKGAYTAARTAKD 234

Query: 318 RGAIVYAIGIRVIR--------------SHEFLRACA--SPNSFYLVENPHSMYDAFSHI 361
           +G  +  +                      E L+  A  S    +   +   +   F+++
Sbjct: 235 QGVPISTVSFGTPYGYVEINDQRQPVPVDDEMLKKIADLSGGDAFTASSLEQLKQVFTNL 294

Query: 362 GKDIVTKRI 370
            + I  + I
Sbjct: 295 QEQIGYETI 303


>gi|254368552|ref|ZP_04984568.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica FSC022]
 gi|157121455|gb|EDO65646.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica FSC022]
          Length = 339

 Score =  104 bits (258), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 33/217 (15%), Positives = 69/217 (31%), Gaps = 37/217 (17%)

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
             D+++ +D+S SM                  + ++       D     + GL+ F  + 
Sbjct: 97  GRDLIMAIDLSGSMAIQDMKKAN--GQMESRFDLVMRVANQFIDTRKGDRVGLILFGTRA 154

Query: 231 EEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
                L + ++ +++ +    ++  G  T     +  A  ++    G             
Sbjct: 155 YLQTPLTFDIATVKKMLDDASIALPGPQTAIGDAIGLAVKKLKKYPGDS----------- 203

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR----------------- 331
           K ++ +TDGEN S     Q L     AK+    +Y IG+   +                 
Sbjct: 204 KALILLTDGENNSGT--LQPLQAAEIAKQYHIKIYTIGLGGDQMIVETTFGQRLVNTSED 261

Query: 332 -SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                L   A  +   ++  +N   +   +  I K  
Sbjct: 262 LDTTVLEKIATMTGGKYFRAQNSSDLKKVYESIDKLE 298


>gi|227820127|ref|YP_002824098.1| transmembrane protein [Sinorhizobium fredii NGR234]
 gi|227339126|gb|ACP23345.1| putative transmembrane protein [Sinorhizobium fredii NGR234]
          Length = 451

 Score =  104 bits (258), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 43/352 (12%), Positives = 112/352 (31%), Gaps = 31/352 (8%)

Query: 4   LNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAAT 63
           +   +     +  G + +  AI +  + L +G  ++ +  + +++ + S +D +LV A  
Sbjct: 12  IAGRMATMVSDRGGNVALTVAICIIPMILAVGAGLDYTRAYNVQSRMQSDLDAALVAAIK 71

Query: 64  QIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQ 123
           +I         +K+K        K +          D            +    ++ +  
Sbjct: 72  EIDEYDEDEIAEKIKDWFDAQSEKQSATYDLTEITVDKSGHTITASASGTVPTTLMTLAD 131

Query: 124 NEGYSISAISRYKIP-LKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMI------ 176
            +   +  IS  + P   +         S  +++  TS  +   + DA +          
Sbjct: 132 IKTVPVGVISAIEGPATSYLEVYIVIDKSPSMLLAATSEDQAMLRADANITCEFACHDTK 191

Query: 177 --------VLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
                   V+  +            + D+A+ ++  +L+ V    + +  ++ GL +   
Sbjct: 192 DPVKKNGTVIASTYYNYIKSLGVKLRTDVALDAVEEVLDMVDAADEDHARIKVGLYSLGE 251

Query: 229 K-IEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287
              E         +  ++     S    +T+ +        +    +       T  A+ 
Sbjct: 252 TISEVLEPTYSTSTARKKLSDDSSGLTSATSMSATYFQTALKALKKKVGTAGDGTSAASP 311

Query: 288 KKIIVFMTDGENLS------------TKEDQQSLYYCNEAKKRGAI---VYA 324
            K+++ +TDG   +             +    +  +C+  K   A    +Y 
Sbjct: 312 LKLVLLLTDGVQSNRDWVIKWSGKYWGRVTPLNPDWCDYLKDNDATMAVLYT 363


>gi|208780564|ref|ZP_03247903.1| von Willebrand factor type A domain protein [Francisella novicida
           FTG]
 gi|208743539|gb|EDZ89844.1| von Willebrand factor type A domain protein [Francisella novicida
           FTG]
          Length = 333

 Score =  104 bits (258), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 33/217 (15%), Positives = 68/217 (31%), Gaps = 37/217 (17%)

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
             D+++ +D+S SM                  + ++       D     + GL+ F  + 
Sbjct: 91  GRDLIMAIDLSGSMAIQDMKKAN--GQMESRFDLVMRVANQFLDTRKGDRVGLILFGTRA 148

Query: 231 EEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
                L + ++ +++ +    ++  G  T     +  A  ++    G             
Sbjct: 149 YLQTPLTFDIATVKKMLDDASIALPGPQTAIGDAIGLAVKKLKKFPGDS----------- 197

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV------------------I 330
           K ++ +TDGEN S     Q L     AK+    +Y IG+                     
Sbjct: 198 KALILLTDGENNSGT--LQPLQAAEIAKQYHIKIYTIGLGGGQMIVETTFGQRLVNTSED 255

Query: 331 RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                L   A  +   ++  +N   +   +  I K  
Sbjct: 256 LDTTVLEKIATMTGGKYFRAQNSSDLKKVYESIDKLE 292


>gi|153825062|ref|ZP_01977729.1| von Willebrand factor type A domain protein [Vibrio cholerae MZO-2]
 gi|149741387|gb|EDM55421.1| von Willebrand factor type A domain protein [Vibrio cholerae MZO-2]
          Length = 318

 Score =  103 bits (257), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 29/219 (13%), Positives = 71/219 (32%), Gaps = 46/219 (21%)

Query: 173 DMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
           D+M+V+D+S SM           + ++    + ++  + +           + GL+ F++
Sbjct: 85  DLMLVVDLSYSMSQEDMQSGQQMVDRLTAVKQVLSEFIAK-------REGDRIGLILFAD 137

Query: 229 KIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
                  L      +  ++    L   G  T    G+  A                +   
Sbjct: 138 HAYLQTPLTLDRQTVANQLNQAVLKLIGTQTAIGEGIGLATKTFI-----------DSNA 186

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV----------------- 329
            +++++ ++DG N +       L   N AK+    +Y +G+                   
Sbjct: 187 PQRVMILLSDGSNTAG--VLDPLEAANIAKQYHTTIYTLGVGAGEMVVKDFLFSRKVNTA 244

Query: 330 -IRSHEFLRACAS--PNSFYLVENPHSMYDAFSHIGKDI 365
                + L+  A+     ++   N   + + +  I +  
Sbjct: 245 QDLDEKTLQTIATTTGGHYFRARNQQDLQNIYDTINQLE 283


>gi|187932172|ref|YP_001892157.1| protein of unknown function containing a von Willebrand factor type
           A (vWA) domain [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|187713081|gb|ACD31378.1| protein of unknown function containing a von Willebrand factor type
           A (vWA) domain [Francisella tularensis subsp.
           mediasiatica FSC147]
          Length = 333

 Score =  103 bits (257), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 33/217 (15%), Positives = 68/217 (31%), Gaps = 37/217 (17%)

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
             D+++ +D+S SM                  + ++       D     + GL+ F  + 
Sbjct: 91  GRDLIMAIDLSGSMAIQDMKKAN--GQMESRFDLVMRVANQFIDTRKGDRVGLILFGTRA 148

Query: 231 EEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
                L + ++ +++ +    ++  G  T     +  A  ++    G             
Sbjct: 149 YLQTPLTFDIATVKKMLDDASIALPGPQTAIGDAIGLAVKKLKKYPGDS----------- 197

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV------------------I 330
           K ++ +TDGEN S     Q L     AK+    +Y IG+                     
Sbjct: 198 KALILLTDGENNSGT--LQPLQAAEIAKQYHIKIYTIGLGGGQMIVETTFGQRLVNTSED 255

Query: 331 RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                L   A  +   ++  +N   +   +  I K  
Sbjct: 256 LDTTVLEKIATMTGGKYFRAQNSSDLKKVYESIDKLE 292


>gi|89255637|ref|YP_512998.1| hypothetical protein FTL_0203 [Francisella tularensis subsp.
           holarctica LVS]
 gi|134302613|ref|YP_001122584.1| hypothetical protein FTW_1793 [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|156501587|ref|YP_001427652.1| hypothetical protein FTA_0219 [Francisella tularensis subsp.
           holarctica FTNF002-00]
 gi|167009921|ref|ZP_02274852.1| IMP dehydrogenase/GMP reductase:von Willebrand factor, type A
           [Francisella tularensis subsp. holarctica FSC200]
 gi|224456527|ref|ZP_03665000.1| hypothetical protein FtultM_01598 [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|254367031|ref|ZP_04983067.1| hypothetical protein FTHG_00206 [Francisella tularensis subsp.
           holarctica 257]
 gi|290953465|ref|ZP_06558086.1| hypothetical protein FtulhU_03745 [Francisella tularensis subsp.
           holarctica URFT1]
 gi|295313263|ref|ZP_06803900.1| hypothetical protein FtulhU_03730 [Francisella tularensis subsp.
           holarctica URFT1]
 gi|89143468|emb|CAJ78644.1| hypothetical membrane protein [Francisella tularensis subsp.
           holarctica LVS]
 gi|134050390|gb|ABO47461.1| conserved membrane protein with von Willebrand factor type A domain
           [Francisella tularensis subsp. tularensis WY96-3418]
 gi|134252857|gb|EBA51951.1| hypothetical protein FTHG_00206 [Francisella tularensis subsp.
           holarctica 257]
 gi|156252190|gb|ABU60696.1| conserved membrane protein with von Willebrand factor, type A
           domain [Francisella tularensis subsp. holarctica
           FTNF002-00]
 gi|282158589|gb|ADA77980.1| hypothetical protein NE061598_01650 [Francisella tularensis subsp.
           tularensis NE061598]
          Length = 333

 Score =  103 bits (257), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 33/217 (15%), Positives = 68/217 (31%), Gaps = 37/217 (17%)

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
             D+++ +D+S SM                  + ++       D     + GL+ F  + 
Sbjct: 91  GRDLIMAIDLSGSMAIQDMKKAN--GQMESRFDLVMRVANQFIDTRKGDRVGLILFGTRA 148

Query: 231 EEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
                L + ++ +++ +    ++  G  T     +  A  ++    G             
Sbjct: 149 YLQTPLTFDIATVKKMLDDASIALPGPQTAIGDAIGLAVKKLKKYPGDS----------- 197

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV------------------I 330
           K ++ +TDGEN S     Q L     AK+    +Y IG+                     
Sbjct: 198 KALILLTDGENNSGT--LQPLQAAEIAKQYHIKIYTIGLGGGQMIVETTFGQRLVNTSED 255

Query: 331 RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                L   A  +   ++  +N   +   +  I K  
Sbjct: 256 LDTTVLEKIATMTGGKYFRAQNSSDLKKVYESIDKLE 292


>gi|90424817|ref|YP_533187.1| hypothetical protein RPC_3326 [Rhodopseudomonas palustris BisB18]
 gi|90106831|gb|ABD88868.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB18]
          Length = 479

 Score =  103 bits (257), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 26/230 (11%), Positives = 72/230 (31%), Gaps = 29/230 (12%)

Query: 3   SLNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAA 62
            L    + F     G + +L  I +  +   +G+ ++ S     ++ +    D + +  +
Sbjct: 9   WLRRTAKAFHAADDGNIAVLFGIAVIPLISFVGVAVDYSRATAARSAMQGAADSATLMVS 68

Query: 63  TQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVP 122
                          +  DI    +  +   + +   +N           + +       
Sbjct: 69  KDYAAGVI-------RASDIQATAEKYFKALYTSPGINNV----------TVTATYTARS 111

Query: 123 QNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSR 182
            N   ++   +   +P  F            +    +S+   ++    RL + + LDV+ 
Sbjct: 112 ANGSSTVVMNTSGSMPTSFL----KVAGFTALPFTASST---STWGATRLRVAMALDVTG 164

Query: 183 SMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           SM+        K+     +   ++  +K     +  V   ++ F+  +  
Sbjct: 165 SMDWDD-----KLTAMKTAAIKLVNTLKATASTDADVYISIIPFNVMVNV 209



 Score = 65.6 bits (158), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 31/142 (21%), Positives = 52/142 (36%), Gaps = 13/142 (9%)

Query: 241 SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENL 300
           S L+ KI  L   G +TN   GL +A+  +     +       +  Y   I+ ++DG+N 
Sbjct: 337 STLKGKINKLDAEG-NTNQPIGLFWAWMSLQTGVPLNTPAKDTEYKYTDAIILLSDGDNT 395

Query: 301 STKEDQQS-------LYYCNEAKK--RGAI-VYAIGIRVIRSHE--FLRACASPNSFYLV 348
            +                C+  K    G   ++ I +      E   L+ CAS   F+  
Sbjct: 396 QSGNSNSVSAIDARQKKLCDNIKDPLNGTTTIFTIQVNTDGDDESAVLKYCASDGQFFQS 455

Query: 349 ENPHSMYDAFSHIGKDIVTKRI 370
                +  AF  IG  +   R+
Sbjct: 456 TTADQIEIAFQSIGSSLTKLRL 477


>gi|56460106|ref|YP_155387.1| von Willebrand factor type A (vWA) domain-containing protein
           [Idiomarina loihiensis L2TR]
 gi|56179116|gb|AAV81838.1| Uncharacterized protein containing a von Willebrand factor type A
           (vWA) domain [Idiomarina loihiensis L2TR]
          Length = 327

 Score =  103 bits (257), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 26/222 (11%), Positives = 72/222 (32%), Gaps = 46/222 (20%)

Query: 170 ARLDMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVT 225
              ++M+ +D+S SME         S+ ++ M    ++  +E            + GL+ 
Sbjct: 84  EGREIMLAVDLSGSMEIADMQLEGRSVNRLTMVKHVLSDFIER-------REGDRLGLIL 136

Query: 226 FSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           F++       + +  + +++ +    L   G  T                  +      +
Sbjct: 137 FADTAYLQTPMTYDRNTVKQMLNESVLGLVGERTAIGDA-----------IALSVKRFRD 185

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR------------ 331
           D    +++V +TDG+N +     +       A+     +Y I +                
Sbjct: 186 DEKSNRVLVLLTDGQNTAGNLPPE--QALELAQAYDVTIYPIAVGAEEVVVDSFFGQRRV 243

Query: 332 ------SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                     +++ A  +   ++   + + + + +  + K  
Sbjct: 244 NPSRDLDVPLMQSIAKQTGGKYFRARSTNELEEIYQRLDKLE 285


>gi|56707447|ref|YP_169343.1| hypothetical protein FTT_0293 [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|110669918|ref|YP_666475.1| hypothetical protein FTF0293 [Francisella tularensis subsp.
           tularensis FSC198]
 gi|115314141|ref|YP_762864.1| hypothetical protein FTH_0198 [Francisella tularensis subsp.
           holarctica OSU18]
 gi|254370860|ref|ZP_04986865.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis FSC033]
 gi|254874284|ref|ZP_05246994.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|56603939|emb|CAG44926.1| hypothetical membrane protein [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|110320251|emb|CAL08309.1| hypothetical membrane protein [Francisella tularensis subsp.
           tularensis FSC198]
 gi|115129040|gb|ABI82227.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica OSU18]
 gi|151569103|gb|EDN34757.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis FSC033]
 gi|254840283|gb|EET18719.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis MA00-2987]
          Length = 339

 Score =  103 bits (257), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 33/217 (15%), Positives = 68/217 (31%), Gaps = 37/217 (17%)

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
             D+++ +D+S SM                  + ++       D     + GL+ F  + 
Sbjct: 97  GRDLIMAIDLSGSMAIQDMKKAN--GQMESRFDLVMRVANQFIDTRKGDRVGLILFGTRA 154

Query: 231 EEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
                L + ++ +++ +    ++  G  T     +  A  ++    G             
Sbjct: 155 YLQTPLTFDIATVKKMLDDASIALPGPQTAIGDAIGLAVKKLKKYPGDS----------- 203

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV------------------I 330
           K ++ +TDGEN S     Q L     AK+    +Y IG+                     
Sbjct: 204 KALILLTDGENNSGT--LQPLQAAEIAKQYHIKIYTIGLGGGQMIVETTFGQRLVNTSED 261

Query: 331 RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                L   A  +   ++  +N   +   +  I K  
Sbjct: 262 LDTTVLEKIATMTGGKYFRAQNSSDLKKVYESIDKLE 298


>gi|229495742|ref|ZP_04389470.1| BatA protein [Porphyromonas endodontalis ATCC 35406]
 gi|229317316|gb|EEN83221.1| BatA protein [Porphyromonas endodontalis ATCC 35406]
          Length = 325

 Score =  103 bits (257), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 34/224 (15%), Positives = 66/224 (29%), Gaps = 46/224 (20%)

Query: 170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229
             +D+M+ +D S SM +       +   A++     +               GLV F+ +
Sbjct: 84  EGIDIMLAIDASGSMMAMDL-QPNRFVAAVEVAQKFIGN-------RPNDNIGLVMFAGE 135

Query: 230 IEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287
                 L    + L  ++    +      T    G+  A            +   E    
Sbjct: 136 SFTQCPLTTDHATLLNRLSEVEIGYLEDGTAIGLGIATA-----------CNRLKESHAK 184

Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV------------------ 329
            KIIV +TDG N +           + A+  G  +Y + +                    
Sbjct: 185 SKIIVLLTDGTNNAGSIAPSM--AASLAESLGIRIYTVAVGTRGEAPYPHATAFGTVIDN 242

Query: 330 ---IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                    L+  A  +  S++   +  S+   +  I     +K
Sbjct: 243 VKVEIDEASLKEIAQTTGGSYFRATDNESLNQIYDEIDSLEKSK 286


>gi|326795817|ref|YP_004313637.1| von Willebrand factor type A [Marinomonas mediterranea MMB-1]
 gi|326546581|gb|ADZ91801.1| von Willebrand factor type A [Marinomonas mediterranea MMB-1]
          Length = 337

 Score =  103 bits (257), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 39/281 (13%), Positives = 85/281 (30%), Gaps = 40/281 (14%)

Query: 111 VRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITS--SVKVNSQT 168
             S              S ++    +   K    +  +     +V              T
Sbjct: 30  KESNQTTYWWSSHALPSSTASTPSPEGWFKTSNILLMFAWISLVVAIARPIWVGSPTQIT 89

Query: 169 DARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
            +  D+ + LD+S SM+       ++    +     +L +           + G++ F  
Sbjct: 90  PSGRDLFVALDLSGSMQISDMYYQSRPVNRLVISKHVLSDFIE---KRKGDRIGVIVFGT 146

Query: 229 KIEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
           K      L +    +++ I+   +   G  T     +     Q+ ++            +
Sbjct: 147 KAYLQAPLSFDTKTVRQLIQETQIGFAGEKTAIGDAIGLGIKQLSEL-----------PS 195

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR--------------- 331
            KK+++ MTDG N + +     L   N A ++G  ++ IGI                   
Sbjct: 196 DKKVLILMTDGANTAGR--VSPLQAANFAAEQGVTIHTIGIGADEMEVQGFFGPQTVNPS 253

Query: 332 ---SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVT 367
                  L   A  +   +Y  ++   + + +  I     T
Sbjct: 254 EDLDEALLENVASLTGGKYYRAKSTSDLEEIYGDINNIEPT 294


>gi|254505681|ref|ZP_05117827.1| von Willebrand factor, type A [Vibrio parahaemolyticus 16]
 gi|219551334|gb|EED28313.1| von Willebrand factor, type A [Vibrio parahaemolyticus 16]
          Length = 322

 Score =  103 bits (256), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 35/230 (15%), Positives = 68/230 (29%), Gaps = 46/230 (20%)

Query: 162 VKVNSQTDARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNN 217
            +  +      D+M+VLD+S SM           + ++    K ++    +         
Sbjct: 75  GEPVTTQPKHRDLMLVLDLSYSMSKEDMLDDGDYVDRLTAVKKVVSDFASK-------RE 127

Query: 218 VVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYL--SKFGVSTNSTPGLKYAYNQIFDMQG 275
             + GLV F++       L      +  ++  L     G  T    G+  A         
Sbjct: 128 GDRLGLVLFADHAYLQTPLTLDRKTIAEQVNQLVLRLIGEKTAIGEGIGLATKTFV---- 183

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV------ 329
                  +    ++++V ++DG N S       L     AKK  A +Y IG+        
Sbjct: 184 -------DSDAPQRVMVLLSDGSNTSG--VLDPLEAAKIAKKYNATIYTIGVGAGEMVVK 234

Query: 330 ------------IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                             L   A  +   ++   +   +   +  I    
Sbjct: 235 EFFMTRKVNTAQDLDERTLMDIAQVTGGQYFRARDAKELATIYDTINSLE 284


>gi|254481548|ref|ZP_05094792.1| von Willebrand factor type A domain protein [marine gamma
           proteobacterium HTCC2148]
 gi|214038176|gb|EEB78839.1| von Willebrand factor type A domain protein [marine gamma
           proteobacterium HTCC2148]
          Length = 345

 Score =  103 bits (256), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 31/227 (13%), Positives = 74/227 (32%), Gaps = 50/227 (22%)

Query: 169 DARLDMMIVLDVSRSMESFFDSS----ITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           ++  D+M+ +D+S SM+          +++I    +  +  +E+           + GL+
Sbjct: 88  NSGRDLMLAVDISGSMKIEDMEVSDELVSRIRAVKQVGSRFIEQ-------REGDRLGLI 140

Query: 225 TFSNKIEEFFLLEWGVSHLQRKI--KYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            F +       L +  + ++R +    +   G  T     +  A                
Sbjct: 141 LFGSNAYVQSPLSFDTATVKRFLLEAQIGFAGQDTAIGDAIGLAVK-----------RLK 189

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR----------- 331
           E     ++++ ++DG++ +     Q L     A   G  +Y IGI               
Sbjct: 190 ERPAENRVLILLSDGKDTA--SSVQPLNAAKLAADLGIRIYTIGIGADSLTMPGLFGSSF 247

Query: 332 -----------SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                          L+  A  +   ++   NP  + + +  + +  
Sbjct: 248 GARQVNPSAELDEAGLQQIAKITDGKYFRARNPEELANIYQLLDQLE 294


>gi|327481077|gb|AEA84387.1| von Willebrand factor type A domain-containing protein [Pseudomonas
           stutzeri DSM 4166]
          Length = 339

 Score =  103 bits (256), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 31/220 (14%), Positives = 71/220 (32%), Gaps = 45/220 (20%)

Query: 171 RLDMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+++ +DVS SM+          +T++++    +   +E+        +  + GL+ F
Sbjct: 89  GRDLLLAVDVSGSMDYPDMQWQGEELTRLELVKVLLGDFIEQ-------RHGDRVGLILF 141

Query: 227 SNKIEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
            +K      L +    ++  +    +   G +T     +  A                E 
Sbjct: 142 GSKAYLQSPLTFDRRTVRVWLDEASVGIAGSNTAIGDAIGLALK-----------RLRER 190

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV--------------- 329
               +++V +TDG N   +   + L     A +    ++ IGI                 
Sbjct: 191 PANSRVLVLVTDGANNGGEI--EPLLAATLAAEENVRIHTIGIGAVPEEGGVLSRFGFNP 248

Query: 330 --IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                   LRA A  +   ++   +   +      + +  
Sbjct: 249 GLDLDEPTLRAIAEQTGGEYFRAASSEQLQAIGEALDRLE 288


>gi|152995759|ref|YP_001340594.1| von Willebrand factor type A [Marinomonas sp. MWYL1]
 gi|150836683|gb|ABR70659.1| von Willebrand factor type A [Marinomonas sp. MWYL1]
          Length = 342

 Score =  103 bits (256), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 31/232 (13%), Positives = 74/232 (31%), Gaps = 46/232 (19%)

Query: 162 VKVNSQTDARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNN 217
            +    T +  D++I LD+S SM+            +++ A   ++  ++E         
Sbjct: 78  GEPTKVTPSGRDLLIALDLSGSMQVTDMALNGQPANRLEAAKSVLSDFIQE-------RR 130

Query: 218 VVQSGLVTFSNKIEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQG 275
             + G++ F +K      L +    + + ++   +   G  T     +            
Sbjct: 131 GDRIGIIVFGSKAYLQAPLSFDTKTINQLVQEAQIGFAGEQTAIGDAIGLGIK------- 183

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR---- 331
                  +  + KK+++ MTDG N + +   Q       A  +   ++ IGI        
Sbjct: 184 ----RLEDKPSDKKVLILMTDGANTAGR--VQPQQAATFAASQNVKIHTIGIGADSMIVQ 237

Query: 332 --------------SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVT 367
                             L+  A  +   ++  ++   +   +  +     T
Sbjct: 238 SFFGPKAINPSSDLDETLLKNIAAQTGGEYFRAKSTEDLQAIYQTLDALEPT 289


>gi|218462279|ref|ZP_03502370.1| hypothetical protein RetlK5_23628 [Rhizobium etli Kim 5]
          Length = 347

 Score =  103 bits (256), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 32/264 (12%), Positives = 79/264 (29%), Gaps = 23/264 (8%)

Query: 11  FFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHS----------MIDRSLVH 60
           F  +  G   I+TA+ +  +    GM ++ +H   ++T L++                V 
Sbjct: 8   FISDRSGNFGIMTALLMVPLLGTAGMAVDFAHALSLRTQLYAAADAAAVGSIAEKSGAVA 67

Query: 61  AATQIMNEGNGNNRKKLKGGDILCRI----KNTWNMSFRNELRDNGFVNDIDDIVRSTSL 116
           AA  + + G  +  K       + ++             +  +    +N       +   
Sbjct: 68  AAMAMNSNGTVSLGKTDARNIFMSQMSGELAEVQVDLGIDVTKTANKLNSQVSFTATVPT 127

Query: 117 DIVVVPQNEGYSISAISRYKIPL-KFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMM 175
             + +   +  +IS  +  +     F  F     N+  + +  T       +  A     
Sbjct: 128 TFMQILGRDSITISGTATAEYQTAAFMDFYILLDNTPSMGVGATPDDVSKLEAKAGCAFA 187

Query: 176 IVLDVSRSMESFFD---SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI-- 230
                                +ID+  ++  A+ +  K     ++  + G+ TF  K   
Sbjct: 188 CHQMDKTINNYTIAKSLGVAMRIDVVRQATQALTDTAKTERVSSDQFRMGVYTFGTKAED 247

Query: 231 ---EEFFLLEWGVSHLQRKIKYLS 251
                   L   ++ ++     + 
Sbjct: 248 AKLTTISGLTSDLTKVKNYTDAVD 271


>gi|209884898|ref|YP_002288755.1| hypothetical protein OCAR_5764 [Oligotropha carboxidovorans OM5]
 gi|209873094|gb|ACI92890.1| conserved hypothetical protein [Oligotropha carboxidovorans OM5]
          Length = 600

 Score =  103 bits (256), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 28/222 (12%), Positives = 78/222 (35%), Gaps = 26/222 (11%)

Query: 11  FFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGN 70
           F  + +G + I+  +    +  ++G  ++ + +   +T + S +D + +  +        
Sbjct: 16  FRKDARGNVAIIFTLVAIPLVALVGAAVDYTRVSSARTAMQSALDSAALMISK------- 68

Query: 71  GNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSIS 130
             +   +   +I  R +             N    + +  +++ S          G +I 
Sbjct: 69  --DAATMSDSEITTRARQYV----------NSLYTNTETPIQTFSAVYTPN-NGSGATIL 115

Query: 131 AISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDS 190
             +   +P  F         +    +PI ++        +R+ + +VLD + SM+     
Sbjct: 116 LNAGGNMPTYFM----KIVGTNFSTLPINTASTTK-WGSSRMRVALVLDNTGSMDQNGKM 170

Query: 191 SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           +  K   A  +   +++++         V   +V F+  +  
Sbjct: 171 TALKKAAA-NATTGLIKKLSAFNTNEGDVYISVVPFAKDVNV 211



 Score = 61.4 bits (147), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/157 (17%), Positives = 52/157 (33%), Gaps = 19/157 (12%)

Query: 232 EFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQ-IFDMQGMRQHCNTEDANYKKI 290
               +    + L  K+  ++  G +TN   GL + +          +      +  Y+  
Sbjct: 443 TITPMSNQWATLNSKVNAMNPSG-NTNQAIGLFWGWQTLNTANDPFKAPSKDPNWVYQDY 501

Query: 291 IVFMTDGENLSTKEDQQS------------LYYCNEAKKRGAIVYAIGIR---VIRSHEF 335
           IV ++DG N   +                    C+  K     ++ I +         + 
Sbjct: 502 IVILSDGLNTQNRWYTCPNAGPCPTIDGREKTLCDNIKADKITIFTIQVNINSKDPESQV 561

Query: 336 LRACASPNSFYL--VENPHSMYDAFSHIGKDIVTKRI 370
           L+ CAS  S Y   + + +    AF ++   I   RI
Sbjct: 562 LKDCASSGSGYFQLITSANDTATAFDNVLNKIAKLRI 598


>gi|90021389|ref|YP_527216.1| BatB protein [Saccharophagus degradans 2-40]
 gi|89950989|gb|ABD81004.1| von Willebrand factor, type A [Saccharophagus degradans 2-40]
          Length = 341

 Score =  103 bits (256), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 30/225 (13%), Positives = 72/225 (32%), Gaps = 49/225 (21%)

Query: 170 ARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVT 225
              D+++ +D+S SM++         I +I +    +   +E            + GLV 
Sbjct: 89  TGRDLLVAVDISGSMDTKDMVVQNQQIPRIAVVKHIVGDFIER-------RVGDRLGLVL 141

Query: 226 FSNKIEEFFLLEWGVSHLQRKI--KYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           F         L +  + +++ +    +   G +T                 G+      +
Sbjct: 142 FGTSAYLQSPLTFDRTTVKQLLVESQIGFAGPNTAIGDA-----------IGLSIKRLRD 190

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR------------ 331
                ++++ +TDG+N + +         + AK+ G  VY IG+                
Sbjct: 191 RPAENRVVILLTDGQNTAGE--VSPRQAADLAKQSGVKVYTIGVGANEMIVSDGFFGNFQ 248

Query: 332 ---------SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                      + L   A  +   ++   +P  +   +  + +  
Sbjct: 249 RKINPSRDLDEDTLTYIAETTGGRYFRAHSPQELNQIYQLLDELE 293


>gi|104780882|ref|YP_607380.1| hypothetical protein PSEEN1727 [Pseudomonas entomophila L48]
 gi|95109869|emb|CAK14574.1| conserved hypothetical protein; Willebrand factor type A domain
           protein [Pseudomonas entomophila L48]
          Length = 358

 Score =  103 bits (256), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 29/220 (13%), Positives = 70/220 (31%), Gaps = 45/220 (20%)

Query: 171 RLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+++ +DVS SM+          I+++D+    +   L++           + GL+ F
Sbjct: 89  GRDLLVAVDVSGSMDFPDMQWQGDEISRLDLVKALMGDFLQD-------RQGDRVGLILF 141

Query: 227 SNKIEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
            ++      L +    ++  +    +   G +T     +  A                + 
Sbjct: 142 GSQAYLQAPLTFDRRTVRTFLDEAQIGIAGKNTAIGDAIGLAVK-----------RLRQR 190

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV--------------- 329
               ++++ +TDG N   +     L     A + G  +Y IGI                 
Sbjct: 191 PAQSRVLILITDGANNGGQIH--PLTAARLAAQEGVRIYTIGIGANPEASGTPGLLGLNP 248

Query: 330 --IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                   L+  A  +  +++   +   +      + +  
Sbjct: 249 SLDLDEASLKEIAGITHGTYFRAHDGAELNAIGDTLDQLE 288


>gi|229590954|ref|YP_002873073.1| hypothetical protein PFLU3509 [Pseudomonas fluorescens SBW25]
 gi|229362820|emb|CAY49730.1| putative exported protein [Pseudomonas fluorescens SBW25]
          Length = 362

 Score =  103 bits (256), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 30/220 (13%), Positives = 71/220 (32%), Gaps = 45/220 (20%)

Query: 171 RLDMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+++ +DVS SM+    +     ++++ +    +   LE            + GL+ F
Sbjct: 89  GRDLLVAVDVSGSMDFPDMNWQGEDVSRLSLVKHLLGDFLEG-------REGDRVGLILF 141

Query: 227 SNKIEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
            ++      L +    ++  +    +   G +T     +  A                + 
Sbjct: 142 GSQAYLQAPLTFDRRTVRTWLDEARIGIAGKNTAIGDAIGLALK-----------RLRQR 190

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR------------- 331
               ++++ +TDG N + + D   L     A + G  +Y IGI                 
Sbjct: 191 PAQSRVLILVTDGANNAGQID--PLTAARLAAEEGVKIYPIGIGADPEQTGSLGILGVNP 248

Query: 332 ----SHEFLRAC--ASPNSFYLVENPHSMYDAFSHIGKDI 365
                   L+A   A+   ++   +   +    + +    
Sbjct: 249 SLDLDEPALKAIAEATGGQYFRARDGEELQAIKATLDTLE 288


>gi|91792882|ref|YP_562533.1| von Willebrand factor, type A [Shewanella denitrificans OS217]
 gi|91714884|gb|ABE54810.1| von Willebrand factor, type A [Shewanella denitrificans OS217]
          Length = 330

 Score =  103 bits (256), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 29/218 (13%), Positives = 66/218 (30%), Gaps = 38/218 (17%)

Query: 170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229
              D+M+ +D+S SM+        K    +   + +   +    +  N  + GL+ F++ 
Sbjct: 82  KGRDLMLAVDLSGSMQIEDMVINGK---TVDRFSLIQNVLGEFIERRNGDRLGLILFADH 138

Query: 230 IEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287
                 L      +   +    +   G  T     +  A  +   +              
Sbjct: 139 AYLQAPLTQDRRSIATFLADAQIGLVGKQTAIGEAIALAVKRFDQVSESN---------- 188

Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV------------------ 329
            +++V +TDG N +   +         A KR   +Y +G+                    
Sbjct: 189 -RVLVLLTDGSNNAGNIEPDV--AAEIAAKRNVTIYTVGVGAELMERRTIFGKERVNPSM 245

Query: 330 IRSHEFLRACAS--PNSFYLVENPHSMYDAFSHIGKDI 365
                 L+  A+     ++  +N   +   +  I +  
Sbjct: 246 DLDEAQLQRLATMTNGYYFRAKNSEDLAQIYQKIDQLE 283


>gi|254448210|ref|ZP_05061672.1| von Willebrand factor, type A [gamma proteobacterium HTCC5015]
 gi|198262077|gb|EDY86360.1| von Willebrand factor, type A [gamma proteobacterium HTCC5015]
          Length = 336

 Score =  103 bits (255), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 31/232 (13%), Positives = 68/232 (29%), Gaps = 52/232 (22%)

Query: 169 DARLDMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
                +++ LD+S SME           ++I +        +++           +  LV
Sbjct: 83  REGRALVVALDISGSMEEQDMDDNGQRRSRIAVTKDVAMDFVKQ-------REGDRIALV 135

Query: 225 TFSNKIEEFFLLEWGVSHLQRKI--------KYLSKFGVSTNSTPGLKYAYNQIFDMQGM 276
            F         L +    + + I          L +   +T     +  A          
Sbjct: 136 LFGTHPYLQTPLTFDHPTVMQHIYEAQLTMADDLQRGIHATAIGDAIGLAVK-------- 187

Query: 277 RQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI------ 330
                 +     K ++ +TDG + +       L     A + G  +Y IG+         
Sbjct: 188 ---RLRDIDAPDKTLILLTDGSDNA--SQVAPLKAAQIAAREGLKIYTIGLGAEQRQASL 242

Query: 331 ------------RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                          + L+  A  +   ++   NP  + + + HI +   ++
Sbjct: 243 LGFDFGFGKNREIDEKTLKDIAKATDGRYFRARNPEELREIYQHIDRLEPSE 294


>gi|134100328|ref|YP_001105989.1| hypothetical protein SACE_3793 [Saccharopolyspora erythraea NRRL
           2338]
 gi|133912951|emb|CAM03064.1| von Willebrand factor, type A [Saccharopolyspora erythraea NRRL
           2338]
          Length = 327

 Score =  103 bits (255), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 36/257 (14%), Positives = 79/257 (30%), Gaps = 30/257 (11%)

Query: 131 AISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDS 190
              + +   K             + + +            R  +M+ +DVS SM++    
Sbjct: 49  VAGKGQGWSKHVPAALLGVALILLTVALAGPTAEQRIPRNRATVMLTVDVSLSMKATD-V 107

Query: 191 SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYL 250
              +++ A  +     +++    +       GLV+F+       +     + +++ I  L
Sbjct: 108 EPNRLEAAKVAAKEFADQLTPGIN------LGLVSFAGTATVLVMPTTDRASVKQAIDNL 161

Query: 251 SKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLY 310
                +T +  G+  A + I       +            IV M DG     +E      
Sbjct: 162 K-LSEATATGDGINAAMSAIDSF---GKMVGGPSGAPPARIVLMADGGQTIPRELDAPRG 217

Query: 311 Y---CNEAKKRGAIVYAIGIRV--------------IRSHEFLRACA--SPNSFYLVENP 351
                 EAKK    +  I                      E ++  A  S   F+   + 
Sbjct: 218 AYTKAQEAKKANIPISTISFGTKHGSIEIEGEQEFVEVDDEAMQEIARLSGGEFHKAASA 277

Query: 352 HSMYDAFSHIGKDIVTK 368
             + + ++ +G+ I  +
Sbjct: 278 EQLREVYATLGEQIGYE 294


>gi|77463970|ref|YP_353474.1| hypothetical protein RSP_0399 [Rhodobacter sphaeroides 2.4.1]
 gi|77388388|gb|ABA79573.1| conserved hypothetical protein [Rhodobacter sphaeroides 2.4.1]
          Length = 566

 Score =  103 bits (255), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 29/207 (14%), Positives = 68/207 (32%), Gaps = 34/207 (16%)

Query: 8   IRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMN 67
           +R F  +  G + I     L ++ ++ G+ ++V    F +  L   +DR+++ AA+    
Sbjct: 13  LRRFGRSEDGSILIFGIFMLILMLMIGGLAVDVMRFEFQRARLQGTLDRAVLAAAS---- 68

Query: 68  EGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGY 127
                                            +                +V        
Sbjct: 69  ------------LTQSRSPAEVVRDYVTKAGLADYLDEP-----------VVNANTLNVR 105

Query: 128 SISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESF 187
           S++A + Y +P  F        +   +  P  S+ +        +++ +VLD+S SM + 
Sbjct: 106 SVTATAAYSMPTVFM----KLLDIDRLEAPAVSTAEERVSN---VEISLVLDMSNSMVTD 158

Query: 188 FDSSITKIDMAIKSINAMLEEVKLIPD 214
             +   ++D    +    ++ V    +
Sbjct: 159 GTNPRDRLDNLKVAARDFIDIVMAGAN 185



 Score = 57.6 bits (137), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 24/149 (16%), Positives = 49/149 (32%), Gaps = 3/149 (2%)

Query: 223 LVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
           +VT S  +E+        S  + + + +     ST +   L Y         G      +
Sbjct: 418 IVTRSCTVEQVCTRTRNGSCTRWQDQQVCTDTPSTVTAHRLSYPDLWHQARVGWVSGLYS 477

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR-SHEFLRACAS 341
                 +   +++  +       +++   C+ A+ +G  VY++           L+ CAS
Sbjct: 478 SAGVSGRYSSWVSTLDPTVKN--ERTRQICDAARAQGITVYSVAFEAEAGGQALLQYCAS 535

Query: 342 PNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
               Y       +   F  I   I   R+
Sbjct: 536 TTGHYYATVGPQIRTVFHSIASHITQLRL 564


>gi|229526203|ref|ZP_04415607.1| protein BatA [Vibrio cholerae bv. albensis VL426]
 gi|229336361|gb|EEO01379.1| protein BatA [Vibrio cholerae bv. albensis VL426]
          Length = 318

 Score =  103 bits (255), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 28/219 (12%), Positives = 70/219 (31%), Gaps = 46/219 (21%)

Query: 173 DMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
           D+M V+D+S SM           + ++    + ++  + +           + GL+ F++
Sbjct: 85  DLMQVVDLSYSMSQEDMQSGQQMVDRLTAVKQVLSEFIAK-------REGDRIGLILFAD 137

Query: 229 KIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
                  L      +  ++    L   G  T    G+  A                +   
Sbjct: 138 HAYLQTPLTLDRQTVANQLNQAVLKLIGTQTAIGEGIGLATKTFI-----------DSNA 186

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV----------------- 329
            +++++ ++DG N +       L   + AK+    +Y +G+                   
Sbjct: 187 PQRVMILLSDGSNTAG--VLDPLEAADIAKQYHTTIYTVGVGAGEMVVKDFLFSRKVNTA 244

Query: 330 -IRSHEFLRACAS--PNSFYLVENPHSMYDAFSHIGKDI 365
                + L+  A+     ++   N   + + +  I +  
Sbjct: 245 QDLDEKTLQTIATTTGGHYFRARNQQDLQNIYDTINQLE 283


>gi|254281808|ref|ZP_04956776.1| von Willebrand factor, type A [gamma proteobacterium NOR51-B]
 gi|219678011|gb|EED34360.1| von Willebrand factor, type A [gamma proteobacterium NOR51-B]
          Length = 328

 Score =  103 bits (255), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 35/209 (16%), Positives = 71/209 (33%), Gaps = 30/209 (14%)

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
             D+M+ +D+S SM+        ++   I+++ A+  +           + GL+ F  + 
Sbjct: 90  GRDLMLAIDLSGSMQIEDMQVGARLVSRIEAVKAIASDF---TSQRVGDRVGLILFGTRA 146

Query: 231 EEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
                L +  + + R I+   L   G  T     L  A                E     
Sbjct: 147 YVQAPLTFDTATVTRFIREAQLGFAGEDTAIGDALGLAIK-----------RLRERPAES 195

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR----------VIRSHEFLRA 338
           ++++ +TDG++ +       +     A + G  VY IGI                  L A
Sbjct: 196 RVLILLTDGQDTA--STVDPMEATALAAESGIKVYTIGISRRIGARAGGSGEVDEALLNA 253

Query: 339 CA--SPNSFYLVENPHSMYDAFSHIGKDI 365
            A  +   ++   NP  +   +  + +  
Sbjct: 254 IAEATGGEYFRARNPAELQSIYGVVDQLE 282


>gi|194367004|ref|YP_002029614.1| von Willebrand factor type A [Stenotrophomonas maltophilia R551-3]
 gi|194349808|gb|ACF52931.1| von Willebrand factor type A [Stenotrophomonas maltophilia R551-3]
          Length = 334

 Score =  103 bits (255), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 26/228 (11%), Positives = 70/228 (30%), Gaps = 44/228 (19%)

Query: 162 VKVNSQTDARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNN 217
            +  +       MM+ +DVS SM          ++ ++  A   +   L       D   
Sbjct: 89  GEAITPPQEGRQMMLAMDVSGSMGEGDMVLGGQAVDRLTAAKAVLADFL-------DRRA 141

Query: 218 VVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQG 275
             + GL+ F ++      L   ++ ++ +++   +   G  T     +  A         
Sbjct: 142 GDRIGLLVFGDRAYTLTPLTADLASVRDQLRDSVVGLAGRETAIGDAIGLAVK------- 194

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR------- 328
                       +++++ +TDG + +     + L     A+  G  ++ +          
Sbjct: 195 ----RLRSQPEGQRVLILLTDGVSNAG--VLEPLRAAEVARAEGVRIHTVAFGGDGSMRL 248

Query: 329 ---------VIRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                           L+  A  +   F+   +   +   ++ + +  
Sbjct: 249 FGIPISADQDPVDEATLKKIATMTGGQFFRARDTAQLAGIYAELDRLE 296


>gi|326382237|ref|ZP_08203929.1| hypothetical protein SCNU_04806 [Gordonia neofelifaecis NRRL
           B-59395]
 gi|326198967|gb|EGD56149.1| hypothetical protein SCNU_04806 [Gordonia neofelifaecis NRRL
           B-59395]
          Length = 330

 Score =  103 bits (255), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 41/264 (15%), Positives = 81/264 (30%), Gaps = 35/264 (13%)

Query: 130 SAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFD 189
           +   + +   K    +        + + +            R  +M+V+DVS SM+S   
Sbjct: 46  AVTPKNQDRFKHVPVVVLLVGLLLLTIAMAGPQAERDVPRNRATVMLVVDVSNSMKSTD- 104

Query: 190 SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKY 249
            + +++  A  +            D+ + +  GL++F+             S  +  +  
Sbjct: 105 VAPSRLKAAQAAGKRF------ADDLTDGINLGLISFAGTASTLVSPTPDHSATKNALDR 158

Query: 250 LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSL 309
           L      T +  G+  A  QI     +              IV ++DG+    +      
Sbjct: 159 LK-LADKTATGEGIFAALQQIDT---LNAVLGGPSGAPPARIVLLSDGKQTVPESPDDPR 214

Query: 310 ---YYCNEAKKRGAIVYAIGIRV-------------------IRSHEFLRACA--SPNSF 345
                  +AK++G  V  I                           E LR  A  S   F
Sbjct: 215 GGFTAARKAKEKGVPVSTISFGTLTGTVDLETPGGGVERVPVPVDDESLRKIANLSGGDF 274

Query: 346 YLVENPHSMYDAFSHIGKDIVTKR 369
           +   +   +   +S + K I  +R
Sbjct: 275 FTASSLDELNKVYSTLQKQIGYER 298


>gi|304312669|ref|YP_003812267.1| von Willebrand factor, type A protein [gamma proteobacterium HdN1]
 gi|301798402|emb|CBL46626.1| von Willebrand factor, type A protein [gamma proteobacterium HdN1]
          Length = 347

 Score =  103 bits (255), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 28/221 (12%), Positives = 66/221 (29%), Gaps = 48/221 (21%)

Query: 173 DMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
           D+M+ +D S+SME          + ++ +    ++  +             + GL+ F  
Sbjct: 94  DLMLAVDTSQSMEIQDMRLHGEPVDRLTVIKSVVDDFI-------SHRKNDRIGLILFGT 146

Query: 229 KIEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
           +      L +    ++  +    +   G  T     +  A                    
Sbjct: 147 QAYLQTPLTFDHKTVRTLLNESRIGIAGGQTAIGDAIGLALK-----------RLKNHKT 195

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR--------------- 331
             K+++ +TDG N +       +     A ++G  +Y +G+                   
Sbjct: 196 GSKVLILLTDGANTAGS--VSPVQAAELAARQGMKIYTVGVGADEMRIPGVLGFGSQIVN 253

Query: 332 -----SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                    ++  A  +   ++   N   +   + HI K  
Sbjct: 254 PSADLDEVTMKKIASLTGAQYFRARNTDELRRIYQHIDKLE 294


>gi|291008772|ref|ZP_06566745.1| hypothetical protein SeryN2_29978 [Saccharopolyspora erythraea NRRL
           2338]
          Length = 324

 Score =  103 bits (255), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 36/257 (14%), Positives = 79/257 (30%), Gaps = 30/257 (11%)

Query: 131 AISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDS 190
              + +   K             + + +            R  +M+ +DVS SM++    
Sbjct: 46  VAGKGQGWSKHVPAALLGVALILLTVALAGPTAEQRIPRNRATVMLTVDVSLSMKATD-V 104

Query: 191 SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYL 250
              +++ A  +     +++    +       GLV+F+       +     + +++ I  L
Sbjct: 105 EPNRLEAAKVAAKEFADQLTPGIN------LGLVSFAGTATVLVMPTTDRASVKQAIDNL 158

Query: 251 SKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLY 310
                +T +  G+  A + I       +            IV M DG     +E      
Sbjct: 159 K-LSEATATGDGINAAMSAIDSF---GKMVGGPSGAPPARIVLMADGGQTIPRELDAPRG 214

Query: 311 Y---CNEAKKRGAIVYAIGIRV--------------IRSHEFLRACA--SPNSFYLVENP 351
                 EAKK    +  I                      E ++  A  S   F+   + 
Sbjct: 215 AYTKAQEAKKANIPISTISFGTKHGSIEIEGEQEFVEVDDEAMQEIARLSGGEFHKAASA 274

Query: 352 HSMYDAFSHIGKDIVTK 368
             + + ++ +G+ I  +
Sbjct: 275 EQLREVYATLGEQIGYE 291


>gi|332828718|gb|EGK01410.1| hypothetical protein HMPREF9455_02243 [Dysgonomonas gadei ATCC
           BAA-286]
          Length = 330

 Score =  103 bits (255), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 33/223 (14%), Positives = 66/223 (29%), Gaps = 46/223 (20%)

Query: 170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229
             +D+++ LD+S +M +   S  T+++ A K     +       +     + GLV F  +
Sbjct: 89  EGIDIVMALDISGTMMAQDFS-PTRLEAAKKVAAEFI-------NDRPNDRIGLVIFGGE 140

Query: 230 IEEFFLLEWGVSHLQRKIKYLSKFG--VSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287
                 L      L   +  +        T    G                +   +  + 
Sbjct: 141 SFTQCPLTTDHKVLLNLLTEVKFGMIEDGTAIGLG-----------LANSVNRLKDSKSK 189

Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV------------------ 329
            ++++ +TDG N + +     L     A      VY IGI                    
Sbjct: 190 SRVVILLTDGSNNAGQI--APLTAAELAASYDIRVYTIGIGSRGTSTARIMTPYGLQTMQ 247

Query: 330 ---IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVT 367
                    L   A  +   ++   +  S+   +  I +   T
Sbjct: 248 VSGDFDERTLTEIAAITKGQYFRATDNTSLSAIYDEIDQMEKT 290


>gi|269961128|ref|ZP_06175496.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269834079|gb|EEZ88170.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 362

 Score =  102 bits (254), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 36/241 (14%), Positives = 79/241 (32%), Gaps = 29/241 (12%)

Query: 145 IPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSIT-----KIDMAI 199
           I W      +  P T   +   +     D+M+V+D+S SM     +S T     ++D A 
Sbjct: 80  ISWLLVVTAMAKP-TVLGEPQVRESLGRDVMVVVDLSGSMAEQDFTSKTGEKISRLDAAK 138

Query: 200 KSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVST 257
           + ++   +            + GL+ F +                  +    ++  G ST
Sbjct: 139 EVLSDFAKT-------RKGDRLGLILFGDAAFVQTPFTPDQKVWLELLNQTDVAMAGQST 191

Query: 258 NSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKK 317
           +    +  A       +   +     + + +K+ + +TDG +       + +     AK 
Sbjct: 192 HLGDAIGLAIKV---FEQSEKSRTDVEESKEKVAIVLTDGNDTG--SFVEPIDAAKVAKA 246

Query: 318 RGAIVYAIGIRVIR-------SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
           +   ++ I +   +           ++  A  S    +   N   +  A+  IGK     
Sbjct: 247 KDVRIHVIAMGDPQTVGETALDMNTIKRIAKESGGEAFEALNRDELAKAYDEIGKLEPQL 306

Query: 369 R 369
            
Sbjct: 307 Y 307


>gi|289667993|ref|ZP_06489068.1| hypothetical protein XcampmN_05693 [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 310

 Score =  102 bits (254), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 32/222 (14%), Positives = 68/222 (30%), Gaps = 45/222 (20%)

Query: 169 DARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
                MM+ +D+S SM           + ++  A   ++  L       D  +  + GL+
Sbjct: 71  REARQMMLAVDLSGSMSEPDMVLGGKVVDRLTAAKAVLSDFL-------DRRDGDRVGLL 123

Query: 225 TFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            F  +      L   ++ ++ +++   +   G  T                  +      
Sbjct: 124 VFGQRAYALTPLTADLTSVRDQLRDSVVGLAGRETAIGDA-----------IALSVKRLR 172

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR-------------- 328
           E    ++++V +TDG N +       L     AK  G  V+ I                 
Sbjct: 173 EQKQGQRVVVLLTDGVNTAG--VLNPLKAAELAKAEGVRVHTIAFGGSGGYSLFGVPIPA 230

Query: 329 ---VIRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                   E LR  A  +   F+   +   +   ++ + +  
Sbjct: 231 GGNDDIDEEGLRKIAQQTGGRFFRARDTEELAGIYAELDRLE 272


>gi|51244490|ref|YP_064374.1| hypothetical protein DP0638 [Desulfotalea psychrophila LSv54]
 gi|50875527|emb|CAG35367.1| conserved hypothetical membrane protein (BatA) [Desulfotalea
           psychrophila LSv54]
          Length = 328

 Score =  102 bits (254), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 36/233 (15%), Positives = 69/233 (29%), Gaps = 50/233 (21%)

Query: 171 RLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
            +D+++ +DVS SM++           ++++    +   + +             GLV F
Sbjct: 86  GIDILLAVDVSGSMQAMDFTLNGKRTNRLEVVKDVMAKFISQ-------RPNDSIGLVAF 138

Query: 227 SNKIEEFFLLEWGVSHLQRKIKYLSKFG--VSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
           + +           + L  ++  LS       T     +    N              E 
Sbjct: 139 AGRPYVVCPPTLDHNWLTLRLHSLSIGMIEDGTAIGSAIGTGVN-----------RLREK 187

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV--------------- 329
            +  +II+ +TDG N + K     L     AK     VY IG                  
Sbjct: 188 KSPSQIIILLTDGINNAGKVP--PLIAAEAAKSFKVKVYTIGAGTRGEAPIPITDAFGRR 245

Query: 330 -------IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
                      + L   A  +   ++   +  S+   ++ I     T R    
Sbjct: 246 QLVRARVDIDDKTLSKVAQITGARYFRATDTESLEKVYAEINSMETTSRSMKK 298


>gi|190575666|ref|YP_001973511.1| putative von Willebrand factor-like protein [Stenotrophomonas
           maltophilia K279a]
 gi|190013588|emb|CAQ47223.1| putative von Willebrand factor-like protein [Stenotrophomonas
           maltophilia K279a]
          Length = 334

 Score =  102 bits (254), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 26/228 (11%), Positives = 70/228 (30%), Gaps = 44/228 (19%)

Query: 162 VKVNSQTDARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNN 217
            +  +       MM+ +DVS SM          ++ ++  A   +   L       D   
Sbjct: 89  GEAITPPQQGRQMMLAMDVSGSMGEGDMVLGGQAVDRLTAAKAVLADFL-------DRRA 141

Query: 218 VVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQG 275
             + GL+ F ++      L   ++ ++ +++   +   G  T     +  A         
Sbjct: 142 GDRIGLLIFGDRAYTLTPLTADLASVRDQLRDSVVGLAGRETAIGDAIGLAVK------- 194

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR------- 328
                       +++++ +TDG + +     + L     A+  G  ++ +          
Sbjct: 195 ----RLRSQPEGQRVLILLTDGVSNAG--VLEPLRAAEVAQAEGVRIHTVAFGGDGSMRF 248

Query: 329 ---------VIRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                           L+  A  +   F+   +   +   ++ + +  
Sbjct: 249 LGIPISADQDPVDEATLKKIASLTGGQFFRARDTAQLAGIYAELDRLE 296


>gi|189219434|ref|YP_001940075.1| hypothetical protein Minf_1423 [Methylacidiphilum infernorum V4]
 gi|189186292|gb|ACD83477.1| Uncharacterized protein containing a von Willebrand factor type A
           (vWA) domain [Methylacidiphilum infernorum V4]
          Length = 334

 Score =  102 bits (254), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 40/239 (16%), Positives = 78/239 (32%), Gaps = 47/239 (19%)

Query: 169 DARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
               D+++VLD+S SM +         ++++D+ ++ +   L       D     + GLV
Sbjct: 84  KEGYDIILVLDISGSMLAEDYEIDQKRVSRLDIVLEVVKTFL-------DKRTNDRIGLV 136

Query: 225 TFSNKIEEFFLLEWGVSHLQRKIKYLSKFG--VSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            F+ +      L +  + L+RKI  L        T     L  A +++   +   +    
Sbjct: 137 AFAGRAYTVCPLTFDHNWLKRKIDQLQAGTIEDGTAIGDALGLALSRLEGKKESGERKKI 196

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR-------------- 328
                   ++ +TDG N         +     A      V+ IG                
Sbjct: 197 GS-----FLILLTDGANNCGN--LTPIEAARLAAHAAVPVFTIGAGINGEVTMPVMDEER 249

Query: 329 ---------VIRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIG--KDIVTKRIWYDK 374
                           LR  A  +   ++   + +++  AF  I   K I  + +   K
Sbjct: 250 RKIGSQTVVSEVDEGLLRNIAQLTGGEYFRATDSNAIVSAFQAIDAQKKIPFEPVVVTK 308


>gi|332558842|ref|ZP_08413164.1| hypothetical protein RSWS8N_07295 [Rhodobacter sphaeroides WS8N]
 gi|332276554|gb|EGJ21869.1| hypothetical protein RSWS8N_07295 [Rhodobacter sphaeroides WS8N]
          Length = 566

 Score =  102 bits (254), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 29/207 (14%), Positives = 69/207 (33%), Gaps = 34/207 (16%)

Query: 8   IRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMN 67
           +R F  +  G + I     L ++ ++ G+ ++V    F +  L   +DR+++ AA+    
Sbjct: 13  LRRFGRSEDGSILIFGIFMLILMLMIGGLAVDVMRFEFQRARLQGTLDRAVLAAAS---- 68

Query: 68  EGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGY 127
                                           ++                +V        
Sbjct: 69  ------------LTQSRSPAEVVRDYVAKAGLEDYLDEP-----------VVNANTLNVR 105

Query: 128 SISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESF 187
           S++A + Y +P  F        +   +  P  S+ +        +++ +VLD+S SM + 
Sbjct: 106 SVTATAAYSMPTVFM----KLLDIDRLEAPAVSTAEERVSN---VEISLVLDMSNSMVTD 158

Query: 188 FDSSITKIDMAIKSINAMLEEVKLIPD 214
             +   ++D    +    ++ V    +
Sbjct: 159 GTNPRDRLDNLKVAARDFIDIVMAGAN 185



 Score = 57.6 bits (137), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 24/149 (16%), Positives = 49/149 (32%), Gaps = 3/149 (2%)

Query: 223 LVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
           +VT S  +E+        S  + + + +     ST +   L Y         G      +
Sbjct: 418 IVTRSCTVEQVCTRTRNGSCTRWQDQQVCTDTPSTVTAHRLSYPDLWHQARVGWVSGLYS 477

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR-SHEFLRACAS 341
                 +   +++  +       +++   C+ A+ +G  VY++           L+ CAS
Sbjct: 478 SAGVSGRYSSWVSTLDPTVKN--ERTRQICDAARAQGITVYSVAFEAEAGGQALLQYCAS 535

Query: 342 PNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
               Y       +   F  I   I   R+
Sbjct: 536 TTGHYYATVGPQIRTVFHSIASHITQLRL 564


>gi|83816834|ref|YP_446668.1| von Willebrand factor type A domain-containing protein
           [Salinibacter ruber DSM 13855]
 gi|83758228|gb|ABC46341.1| von Willebrand factor type A domain protein [Salinibacter ruber DSM
           13855]
          Length = 289

 Score =  102 bits (254), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 43/232 (18%), Positives = 81/232 (34%), Gaps = 48/232 (20%)

Query: 170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229
             +D+M+VLD S SM++      T+ + A ++  A +E            + GL+ F+ +
Sbjct: 49  EGIDIMMVLDASTSMQAEDF-QPTRFEAAREAAGAFVEG-------RVSDRVGLIVFAAE 100

Query: 230 IEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287
                 L    S LQR ++   +      T     L  A N              +    
Sbjct: 101 AYTQAPLTLDYSFLQRMLEDVEVGAVEDGTAVGTALATAVN-----------RLKDSEAE 149

Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRA--------- 338
            K+ + +TDG N   + D ++      A+  G  VYAIG+      +             
Sbjct: 150 SKVAILLTDGRNNRGQIDPRT--AAEVARTMGVRVYAIGVGSSEDRDTWEEPLPQGQRDE 207

Query: 339 -------------CASPNSFYLVENPHSMYDAFSHIGKDIVT---KRIWYDK 374
                         ++   ++   N  ++   ++ I     T   KR++ D+
Sbjct: 208 SAGVDAEMLRSVSVSTGGQYFSATNRDALERIYAEIDTMEATPVDKRVYTDR 259


>gi|78049050|ref|YP_365225.1| hypothetical protein XCV3494 [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|78037480|emb|CAJ25225.1| putative membrane protein [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
          Length = 451

 Score =  102 bits (254), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 31/222 (13%), Positives = 67/222 (30%), Gaps = 45/222 (20%)

Query: 169 DARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
                MM+ +D+S SM           + ++  A   ++  L       D  +  + GL+
Sbjct: 209 REARQMMLAVDLSGSMSEPDMVLGGKVVDRLTAAKAVLSDFL-------DRRDGDRVGLL 261

Query: 225 TFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            F  +      L   ++ ++ ++    +   G  T                  +      
Sbjct: 262 VFGQRAYALTPLTADLTSVRDQLSDSVVGLAGRETAIGDA-----------IALSVKRLR 310

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR-------------- 328
           E    ++++V +TDG N +       L     AK  G  V+ I                 
Sbjct: 311 EQKQGQRVVVLLTDGVNTAG--VLNPLKAAELAKAEGVRVHTIAFGGSGGYSLFGVPIPA 368

Query: 329 ---VIRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                   + LR  A  +   F+   +   +   ++ + +  
Sbjct: 369 GGNDDIDEDGLRKIAQQTGGRFFRARDTEELAGIYAELDRLE 410


>gi|254525166|ref|ZP_05137221.1| von Willebrand factor, type A [Stenotrophomonas sp. SKA14]
 gi|219722757|gb|EED41282.1| von Willebrand factor, type A [Stenotrophomonas sp. SKA14]
          Length = 334

 Score =  102 bits (254), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 26/228 (11%), Positives = 70/228 (30%), Gaps = 44/228 (19%)

Query: 162 VKVNSQTDARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNN 217
            +  +       MM+ +DVS SM          ++ ++  A   +   L       D   
Sbjct: 89  GEAITPPQQGRQMMLAMDVSGSMGEGDMVLGGQAVDRLTAAKAVLADFL-------DRRA 141

Query: 218 VVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQG 275
             + GL+ F ++      L   ++ ++ +++   +   G  T     +  A         
Sbjct: 142 GDRIGLLIFGDRAYTLTPLTADLASVRDQLRDSVVGLAGRETAIGDAIGLAVK------- 194

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR------- 328
                       +++++ +TDG + +     + L     A+  G  ++ +          
Sbjct: 195 ----RLRSQPEGQRVLILLTDGVSNAG--VLEPLRAAEVARAEGVRIHTVAFGGDGSMRV 248

Query: 329 ---------VIRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                           L+  A  +   F+   +   +   ++ + +  
Sbjct: 249 FGISISADQDPVDEATLKKIAGMTGGQFFRARDTAQLAGIYAELDRLE 296


>gi|262202333|ref|YP_003273541.1| von Willebrand factor type A [Gordonia bronchialis DSM 43247]
 gi|262085680|gb|ACY21648.1| von Willebrand factor type A [Gordonia bronchialis DSM 43247]
          Length = 325

 Score =  102 bits (254), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 35/220 (15%), Positives = 74/220 (33%), Gaps = 30/220 (13%)

Query: 169 DARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
             +  +++V+DVSRSM +    + ++I  A  +            D+   +  GL++F+ 
Sbjct: 85  RNKATVILVMDVSRSMNATD-VAPSRIRAAQSAAKKF------ADDLTEGINLGLISFAG 137

Query: 229 KIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
                       +  ++ +  L      T +  G+  A +QI     +       +A   
Sbjct: 138 TPSTLVSPTPDHTATKKAVDKLV-LADKTATGEGIFAALDQIRT---LNAVLGGPEAAPP 193

Query: 289 KIIVFMTDGENLSTKEDQQSL---YYCNEAKKRGAIVYAIGIRV--------------IR 331
             IV ++DG+     E            +AK+ G  V  I                    
Sbjct: 194 AHIVLLSDGKQTVPDEPTDPRGAFTAARKAKEEGIPVSTISFGTAYGTVELDGDRVPVPV 253

Query: 332 SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKR 369
               L+  A  S  +F+   +   + + +  +  +I  + 
Sbjct: 254 DDPSLKQIANLSGGNFFTASSLDELNEVYEKLQSEIGYET 293


>gi|159901412|ref|YP_001547659.1| hypothetical protein Haur_4901 [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159894451|gb|ABX07531.1| conserved hypothetical membrane protein [Herpetosiphon aurantiacus
           ATCC 23779]
          Length = 330

 Score =  102 bits (254), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 36/227 (15%), Positives = 66/227 (29%), Gaps = 47/227 (20%)

Query: 169 DARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
              +D+ + LD+S SM++       +I +A + I   ++            + GLV FS 
Sbjct: 85  REGIDIQLALDISLSMKAGDFDPKDRITVAKEVIAEFVKG-------RKDDRIGLVVFSG 137

Query: 229 KIEEFFLLEWGVSHLQRKIKYLSKFG--VSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
                  L      LQ  +  +        T     L +             +       
Sbjct: 138 HAFTQVPLTLDYDFLQNLLGQVQTVRRPDGTAIGLALAH-----------SVNGLRNSTT 186

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR------------------ 328
             K+++ +TDG N     D +       A+     VY I +                   
Sbjct: 187 KSKVVILLTDGSNNRG--DIEPAQAAEIARALDVRVYTILVGKPGNGEYPVHDPWRDETY 244

Query: 329 -----VIRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                       LR  A  +   F+   +   + D +  I K   ++
Sbjct: 245 LIPAPTAEDEVALRDIAEQTGGIFFRAGDEQGLRDVYDTIDKMERSQ 291


>gi|296228118|ref|XP_002759733.1| PREDICTED: collagen alpha-6(VI) chain [Callithrix jacchus]
          Length = 2267

 Score =  102 bits (254), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 39/267 (14%), Positives = 92/267 (34%), Gaps = 28/267 (10%)

Query: 109 DIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQT 168
           +  R + L+ +     E Y     +   +     TF+    N     + + S      ++
Sbjct: 367 EGARDSQLEKIASHPAEQYVSKLKTFADLAAHNQTFLKKLRNQITHTVSVFSERTETLKS 426

Query: 169 D----ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
                   D+ +++D S S ++             +  + + E V +     + V+ G V
Sbjct: 427 GCVDTEEADIYLLIDGSGSTQATDFH---------EMKSFLSEVVGMFNIAPHKVRVGAV 477

Query: 225 TFSNKIEEFF--LLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +++  +  F          L + I+ + + G +TN+   L +  + +   +        
Sbjct: 478 QYADSWDLEFEINKYSNKQDLGKAIENIRQMGGNTNTGAALNFTLSLLQKAKQQ-----R 532

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
            +     ++V        +       L   N  ++    VYAIG+    +   LR  A  
Sbjct: 533 GNKVPCHLVVL------TNGMSKDSILEPANRLREEHIRVYAIGV-KEANKTQLREIAGE 585

Query: 343 N-SFYLVENPHSMYDAFSHIGKDIVTK 368
               Y V +  ++ D  + + ++I  +
Sbjct: 586 EKRVYYVHDFDALKDIRNQVVQEICAE 612



 Score = 79.9 bits (195), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 32/252 (12%), Positives = 82/252 (32%), Gaps = 21/252 (8%)

Query: 118  IVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIV 177
             V +       + A++       F             V     +         ++D++ +
Sbjct: 944  AVGIAGANPVELLAMAGSSDKYFFVETFGGLKGIFSDVTASVCNSSKVDCEIDKVDLVFL 1003

Query: 178  LDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFL-- 235
            +D S S+ S   + + +          ++  V+      N V+ G   FS+   + F   
Sbjct: 1004 MDGSNSIHSSDFTKMKEF---------LVSVVQDFDVSLNRVRIGAAQFSHNYRQEFPLG 1054

Query: 236  LEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMT 295
               G   +  +I+ + + G +T+          +           +  +    ++++ +T
Sbjct: 1055 TFIGEKEISFQIENIQQLGGNTHIGDA-----LRQVGHYFRPDMGSRINTGTPQVLLVLT 1109

Query: 296  DGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMY 355
            D      +   +        + RG  +Y++GI  +   + ++   +      V N   + 
Sbjct: 1110 D-----GQSQDEVAQAAEALRHRGIDIYSVGIGDVDDQQLIQITGAAEKKLTVHNFDELK 1164

Query: 356  DAFSHIGKDIVT 367
                 I ++I T
Sbjct: 1165 KVKKRIVRNICT 1176



 Score = 79.5 bits (194), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 43/332 (12%), Positives = 105/332 (31%), Gaps = 26/332 (7%)

Query: 44  FFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGF 103
           F  ++ + + ID+ +    T +         +              + +   +    +  
Sbjct: 678 FMSQSDISNAIDQMVHIGETTLTGSALSFVSQYFSPTKGARPNVRKFLILITDGEAQDVV 737

Query: 104 VNDIDDIVRSTSLDIVVVPQNEGYS--ISAISRYKIPLKFCTFIPWYTNSRHIVMPITSS 161
                 + +   +   V       +       R ++      F         +V  I  S
Sbjct: 738 KEPAVALRQEGIIIYSVGVFGSNVTQLEEISGRPEMVFYVENFDILQHIEDDLVFGI-CS 796

Query: 162 VKVNSQTDARLDMMIVLDVSRSMESFFDSSI--TKIDMAIKSINAMLEEVKLIPDVNNVV 219
            +   +    LD++ V+D S S++    + +    I +  K+               N V
Sbjct: 797 PQEECKRIEILDVVFVIDSSGSIDHDEYNIMKDFMIGLVKKA-----------DVGKNRV 845

Query: 220 QSGLVTFSNKIEEFFL--LEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + G + +++  E  F          +   ++     G +T ++  L +      D     
Sbjct: 846 RFGALKYADDPEVLFYLGDFDTKLEVISVLQNDQPMGGNTYTSEALGF-----SDHMFTE 900

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
              +  +    ++++ +TDGE+    +  +        + +G +V A+GI      E L 
Sbjct: 901 AQGSRLNKGVPQVLIVITDGESH---DADKLNATAKALRDKGILVLAVGIAGANPVELLA 957

Query: 338 ACASPNSFYLVENPHSMYDAFSHIGKDIVTKR 369
              S + ++ VE    +   FS +   +    
Sbjct: 958 MAGSSDKYFFVETFGGLKGIFSDVTASVCNSS 989



 Score = 64.9 bits (156), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 23/209 (11%), Positives = 62/209 (29%), Gaps = 29/209 (13%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D+M ++D S S+                 +  ++ + ++  +   +        + +  +
Sbjct: 621 DIMFLVDSSGSI------GPENFSKMKTFMKNLVSKSQIGANRVQIGVVQFSGVNKEEFQ 674

Query: 233 FFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIV 292
                   S +   I  +   G +T +          +  +            N +K ++
Sbjct: 675 LNRFMS-QSDISNAIDQMVHIGETTLTGSA-------LSFVSQYFSPTKGARPNVRKFLI 726

Query: 293 FMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIG-IRVIRSHEFLRACAS-PNSFYLVEN 350
            +TD      +            ++ G I+Y++G      +   L   +  P   + VEN
Sbjct: 727 LITD-----GEAQDVVKEPAVALRQEGIIIYSVGVFGSNVTQ--LEEISGRPEMVFYVEN 779

Query: 351 PHSMYDAFSHIG------KDIVTKRIWYD 373
              +      +       ++   +    D
Sbjct: 780 FDILQHIEDDLVFGICSPQEECKRIEILD 808



 Score = 54.9 bits (130), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 42/298 (14%), Positives = 90/298 (30%), Gaps = 33/298 (11%)

Query: 57  SLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSL 116
             +     +             G D          ++   E  D+              +
Sbjct: 102 GSLQIGKALQEAHRTYFSAPTNGRDRKQFPPILVVLA-SAESEDDVEEASKALQKDGVKI 160

Query: 117 DIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVM----------PITSSVKVNS 166
             V V      ++ A++         T     T S+++                 + V  
Sbjct: 161 ISVGVQDASEENLKAMATSHFHFNLRTVRDLSTFSQNMTQIIKDVTKYKEGAVDDILVEV 220

Query: 167 QTDARL-DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVT 225
                + D++ +LDVS       + S    D   +    + E V  +    N ++ GLV 
Sbjct: 221 CQGPSVADVVFLLDVS------VNGSEENFDFLKE---FLEESVSALDIKENCMRVGLVA 271

Query: 226 FSNKIEEFFL--LEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           +SN+ +      +    S + R I+ LS    +  +      A  ++       ++ + +
Sbjct: 272 YSNETKVINSLSMGINKSEILRNIQNLSPQTGNAYTGA----AIKKLRKEVFSARNGSRK 327

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACAS 341
           +    +I V +T         +          ++ G  ++ +GI   R  + L   AS
Sbjct: 328 NQGVPQIAVLVTH-----RASEDNVTKAAVNLRREGVAIFTLGIEGARDSQ-LEKIAS 379



 Score = 52.5 bits (124), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 31/201 (15%), Positives = 67/201 (33%), Gaps = 25/201 (12%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D++ +LD S            K+ +           +  +P   +  +  L  +S+K+  
Sbjct: 26  DVVFLLDSSD-HLGSKSFPFVKMFITK--------MINSLPIEADKYRVALAQYSDKLHS 76

Query: 233 FFL--LEWGVSHLQRKIK-YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
            F      G + +   +K      G S      L+ A+   F           +   +  
Sbjct: 77  EFHLSTFKGRNPMLNHLKKNFQFLGGSLQIGKALQEAHRTYF----SAPTNGRDRKQFPP 132

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVE 349
           I+V +   E      +          +K G  + ++G++   S E L+A A+ +  + + 
Sbjct: 133 ILVVLASAE-----SEDDVEEASKALQKDGVKIISVGVQ-DASEENLKAMATSHFHFNLR 186

Query: 350 NPHSMYDA---FSHIGKDIVT 367
               +       + I KD+  
Sbjct: 187 TVRDLSTFSQNMTQIIKDVTK 207


>gi|167032571|ref|YP_001667802.1| von Willebrand factor type A [Pseudomonas putida GB-1]
 gi|166859059|gb|ABY97466.1| von Willebrand factor type A [Pseudomonas putida GB-1]
          Length = 358

 Score =  102 bits (254), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 30/220 (13%), Positives = 70/220 (31%), Gaps = 45/220 (20%)

Query: 171 RLDMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+++ +DVS SM+          I+++D+    +   L++           + GL+ F
Sbjct: 89  GRDLLVAVDVSGSMDFPDMQWKNEDISRLDLVKALMGDFLQD-------REGDRVGLILF 141

Query: 227 SNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
            ++      L +    ++  +    +   G +T     +  A                + 
Sbjct: 142 GSQAYLQAPLTFDRRTVRTFLDEAKIGIAGKNTAIGDAIGLAVK-----------RLRQR 190

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV--------------- 329
               +++V +TDG N   +     L     A + G  +Y IGI                 
Sbjct: 191 PAQSRVLVLITDGANNGGQIH--PLTAARLAAQEGVRIYTIGIGANPEASGTPGLLGLNP 248

Query: 330 --IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                   L+  A  +  +++   +   +      + +  
Sbjct: 249 SLDLDEAALKEIADITHGAYFRAHDGAELDAIGDTLDQLE 288


>gi|323493494|ref|ZP_08098616.1| hypothetical protein VIBR0546_14275 [Vibrio brasiliensis LMG 20546]
 gi|323312317|gb|EGA65459.1| hypothetical protein VIBR0546_14275 [Vibrio brasiliensis LMG 20546]
          Length = 393

 Score =  102 bits (254), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 52/377 (13%), Positives = 112/377 (29%), Gaps = 25/377 (6%)

Query: 9   RNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNE 68
                  +G + I     L  + +     I + +   +       +D + +    +   +
Sbjct: 4   SRLLSKQRGSVAISYLAMLIPMIIAAASTIVIGYQVLLSNRAMQAVDTASLACEFRGEYD 63

Query: 69  GNGNNRKKLKGGDILCRI----------KNTWNMSFRNELRDNGFVNDIDDIVRSTSLDI 118
            +            + ++          K     S+ +      F +       + S  +
Sbjct: 64  RSIAQGYLDYYKPKIDKVTATLGASSGCKVELGYSYSSIFTSLTFSDASYVAGVTASQKV 123

Query: 119 VVVPQNEGYSISAISRYKIPLKFCTFI--PWYTNSRHIVMPITSSVKVNSQTDARLDMMI 176
            V    +   I  +    I       +       +R +    +    V  Q   ++ ++ 
Sbjct: 124 YVTEVTDSDPIELVLVLDISGSMMGALDELKSILNRGLTTLRSQQANVAGQDHIKVSIVP 183

Query: 177 VLDVSRSMESFFDSSITKI--DMAIKSINAMLEEV-----KLIPDVNNVVQSGLVTFSNK 229
             +     ++ +  S   +  D  + S  +           +  D   V  S   +  + 
Sbjct: 184 FSNGVSVTDAPWLKSGGTLCVDATVNSGGSFSPANTVANLDVTHDQAPVTTSSSSSDCSL 243

Query: 230 IEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQH--CNTEDANY 287
                 L   ++ +   +  L   G ST S  GL +   Q+            N    N 
Sbjct: 244 TSVILPLTSNLNDVVDAVNRLQTIG-STASYQGLLWGLRQLTPNWQSAWRVGPNRNQDNV 302

Query: 288 KKIIVFMTDGENLSTKEDQQSLY-YCNEAKKRGAIVYAIGIRVIRS--HEFLRACASPNS 344
           ++ +V MTDG + ++  D+      C  AK  G  +  IG  V      +F R   S  +
Sbjct: 303 QRKLVLMTDGMDDNSHLDELINAGLCTRAKDLGIELNFIGFGVQSWRLEQFTRCAGSAGA 362

Query: 345 FYLVENPHSMYDAFSHI 361
            +   N   + D FS +
Sbjct: 363 VFSANNTQDLDDYFSQL 379


>gi|163801617|ref|ZP_02195515.1| hypothetical protein 1103602000597_AND4_09192 [Vibrio sp. AND4]
 gi|159174534|gb|EDP59336.1| hypothetical protein AND4_09192 [Vibrio sp. AND4]
          Length = 367

 Score =  102 bits (254), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 32/224 (14%), Positives = 76/224 (33%), Gaps = 29/224 (12%)

Query: 162 VKVNSQTDARLDMMIVLDVSRSMESFFD-----SSITKIDMAIKSINAMLEEVKLIPDVN 216
            +   +     D+M+V+D+S SM           +I++++ A + ++  ++         
Sbjct: 96  GEPQLRESLGRDVMVVVDLSGSMAEQDFTSKAGENISRLNAAKEVLSDFVKT-------R 148

Query: 217 NVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQ 274
              + GL+ F +                  +    ++  G ST+    +  A        
Sbjct: 149 KGDRLGLILFGDAAFVQTPFTPDQKVWLELLNQTDVAMAGQSTHLGDAMGLAIKVF---- 204

Query: 275 GMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR--- 331
              +     + N +K+ + +TDG +       + +     AK +G  ++ I +   +   
Sbjct: 205 EQSKSRIGVEENKEKVAIVLTDGNDTG--SFVEPIEAAKVAKAKGVRIHVIAMGDPQTLG 262

Query: 332 ----SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKR 369
                 + +R  A  S    +   N   +  A+  IG+      
Sbjct: 263 EAALDMKTIRRIAKESGGKAFEAMNRDELAKAYDDIGRLEPQLY 306


>gi|148261962|ref|YP_001236089.1| hypothetical protein Acry_2980 [Acidiphilium cryptum JF-5]
 gi|326405471|ref|YP_004285553.1| hypothetical protein ACMV_33240 [Acidiphilium multivorum AIU301]
 gi|146403643|gb|ABQ32170.1| hypothetical protein Acry_2980 [Acidiphilium cryptum JF-5]
 gi|325052333|dbj|BAJ82671.1| hypothetical protein ACMV_33240 [Acidiphilium multivorum AIU301]
          Length = 431

 Score =  102 bits (254), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 55/429 (12%), Positives = 117/429 (27%), Gaps = 58/429 (13%)

Query: 1   MFSLNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVH 60
           M  L +  +    + +G + I+TA+    +  +LGM I+       K+ + S  D + + 
Sbjct: 1   MLVLFIKFKALCGDRRGNIAIITALVSLTLIFILGMGIDYGLAIDRKSQMESYADAAALA 60

Query: 61  AATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVV 120
           A T  M     ++           +      +++             D    +       
Sbjct: 61  AVTPAMVAAGQSSAITTAQNVFNAQALTMTGVTYNANDVTVSIATSGDKRTATVQYQAQS 120

Query: 121 VP------QNEGYSISAISRYKIPLKF-CTFIPWYTNSRHIVMPITSSV----KVNSQTD 169
                         I   +     +     F     +S  + +  T S       N+   
Sbjct: 121 QAMLPDVMGFGSIKIGGQATATTTIAPNIDFYLLLDDSPSMAIAATQSGINTMVANTTAQ 180

Query: 170 ARLDMMIV-----LDVSRSMESFFD-------SSITKIDMAIKSINAMLEEVKLIPDVNN 217
                         D   +     +           +IDM  ++   ++   +       
Sbjct: 181 GGCAFGCHEENPSADKLGNPYGEDNYALARSLGVTLRIDMLRQATQDLMTTAQTTETQKG 240

Query: 218 -VVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYN-------- 268
              +  + TF   +     L   +S  Q +   +    V +N+        +        
Sbjct: 241 TTYRMAIYTFDIGLNTIGNLTSDLSQAQTEAGNIQLLEVYSNNWLTQNDYNDDEDTNYDT 300

Query: 269 ----QIFDMQGMRQHCNTEDANYKKIIVFMTDG-----ENLSTKEDQQSLYYCNEAKKRG 319
                   M              ++++ F+TDG      N + ++   +   C   K RG
Sbjct: 301 ALNGINAIMPNPGNGTGAAGDTPQEVLFFVTDGVEDEDVNGNRQQSLLNTDLCTAIKNRG 360

Query: 320 AIV---YA--------------IGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIG 362
             +   Y               I          L+ CASP  ++ V++   +  A S + 
Sbjct: 361 IRIAVLYTEYLPLPTNSWYNTYIAPFQNSIAPTLQQCASPGLYFEVKSGGDISAAMSALF 420

Query: 363 KDIVTKRIW 371
           +  V     
Sbjct: 421 QTAVQSSYL 429


>gi|332232509|ref|XP_003265447.1| PREDICTED: collagen alpha-6(VI) chain [Nomascus leucogenys]
          Length = 2264

 Score =  102 bits (253), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 38/267 (14%), Positives = 89/267 (33%), Gaps = 28/267 (10%)

Query: 109 DIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQT 168
           +    T L+ +     E Y     +   +     TF+    N     + + S      ++
Sbjct: 369 EGASDTQLEKIASHPAEQYVSKLKTFADLAAHNQTFLKKLRNQITHTVSVFSERTETLKS 428

Query: 169 D----ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
                   D+ +++D S S ++             +    +   V +     + V+ G V
Sbjct: 429 GCVDTEEADIYLLIDGSGSTQATDFH---------EMKTFLSAVVGMFDIAPHKVRVGAV 479

Query: 225 TFSNKIEEFF--LLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +++  +  F          L + I+ + + G +TN+   L +  + +      +     
Sbjct: 480 QYADSWDLEFEINKYSNRQDLGKAIENIRQMGGNTNTGAALNFTLSLL-----QKAKKQR 534

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
            +     ++V        +       L   N  ++    VYAIG+    +   LR  A  
Sbjct: 535 GNKVPCHLVVL------TNGMSKDSILEPANRLREEHIRVYAIGV-KEANQTQLREIAGE 587

Query: 343 N-SFYLVENPHSMYDAFSHIGKDIVTK 368
               Y V +  ++ D  + + ++I  +
Sbjct: 588 EKRVYYVHDFDALKDIRNQVVQEICAE 614



 Score = 81.4 bits (199), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 47/334 (14%), Positives = 107/334 (32%), Gaps = 30/334 (8%)

Query: 44  FFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGF 103
           F  ++ + + ID+  +    Q    G+  +              N           +   
Sbjct: 680 FMSQSDISNAIDQ--MAHIGQTTLTGSALSFVSQYFSPTKGARPNIRKFLILITDGEAQD 737

Query: 104 VNDIDDIVRSTSLDIVVVPQNEGYSIS----AISRYKIPLKFCTFIPWYTNSRHIVMPIT 159
           +     +V      I+      G +++       R ++      F         +V  I 
Sbjct: 738 IVKEPAVVLRQEGVIIYSVGVFGSNVTQLEEISGRPEMVFYVENFDILQRIEDDLVFGI- 796

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSI--TKIDMAIKSINAMLEEVKLIPDVNN 217
            S +   +    LD++ V+D S S++    + +    I +  K+               N
Sbjct: 797 CSPREECKRIEVLDVVFVIDSSGSIDYDEYNIMKDFMIGLVKKA-----------DVGKN 845

Query: 218 VVQSGLVTFSNKIEEFFL--LEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQG 275
            V+ G + +++  E  F          +   ++     G +T +   L +      D   
Sbjct: 846 QVRFGALKYADDPEVLFYLEDFGTKLEVISVLQNDQAMGGNTYTAEALGF-----SDHMF 900

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF 335
                +  +    ++++ +TDGE+    +  +        + +G +V A+GI      E 
Sbjct: 901 TEARGSRLNKGVPQVLIVITDGESH---DADKLNATAKALRDKGILVLAVGIAGANPAEL 957

Query: 336 LRACASPNSFYLVENPHSMYDAFSHIGKDIVTKR 369
           L    S + ++ VE    +   FS +   +    
Sbjct: 958 LAMAGSSDKYFFVETFGGLKGIFSDVTASVCNSS 991



 Score = 79.9 bits (195), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 35/333 (10%), Positives = 97/333 (29%), Gaps = 26/333 (7%)

Query: 39   EVSHIFFMKTVLHSMIDRSL---VHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFR 95
            +      + +VL +  D+++    + A  +    +     +    +              
Sbjct: 866  DFGTKLEVISVLQN--DQAMGGNTYTAEALGFSDHMFTEARGSRLNKGVPQVLIVITDGE 923

Query: 96   NELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIV 155
            +   D           +   +  V +       + A++       F             V
Sbjct: 924  SHDADKLNATAKALRDKGILVLAVGIAGANPAELLAMAGSSDKYFFVETFGGLKGIFSDV 983

Query: 156  MPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDV 215
                 +         ++D++ ++D S S++              K    +   V+     
Sbjct: 984  TASVCNSSKVDCEIDKVDLVFLMDGSTSIQPNDF---------KKMKEFLASVVQDFDVS 1034

Query: 216  NNVVQSGLVTFSNKIEEFFL--LEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM 273
             N V+ G   FS+     F      G   +  +I+ + +   +T+          +  + 
Sbjct: 1035 LNRVRIGAAQFSDTYHPEFPLGTFIGEKEISFQIENIKQIFGNTHIGAA-----LRKVEH 1089

Query: 274  QGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSH 333
                   +  +    ++++ +TD      +   +        + RG  +Y++GI  +   
Sbjct: 1090 YFRPDMGSRINTGTPQVLLVLTD-----GQSQDEVAQAAEALRHRGIDIYSVGIGDVDDQ 1144

Query: 334  EFLRACASPNSFYLVENPHSMYDAFSHIGKDIV 366
            + ++   +      V N   +      I ++I 
Sbjct: 1145 QLIQITGTAEKKLTVHNFDELKKVNKRIVRNIC 1177



 Score = 56.4 bits (134), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 37/298 (12%), Positives = 90/298 (30%), Gaps = 33/298 (11%)

Query: 57  SLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSL 116
             +     +  E +         G    +      +   +E  D+              +
Sbjct: 104 GSLQIGKAL-QEAHRTYFSAPADGRDKKQFPPILVVVASSESEDDVVEASKALQKDGVKI 162

Query: 117 DIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIV-----------MPITSSVKVN 165
             + V +    ++ A++  +      T       S+++              +       
Sbjct: 163 ISIGVQKASEENLKAMATSQFHFNLRTVRDLSMFSQNMTHIIKDVTKYKEGAVDDIFVEA 222

Query: 166 SQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVT 225
            Q  +  D++ +LD+S       + S    D        + E V  +    N ++ GLV 
Sbjct: 223 CQGPSVADVVFLLDMS------INGSEENFDYLK---GFLEESVSALDIKENCMRVGLVA 273

Query: 226 FSNKIEEFFL--LEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           +SN+ +      +    S + + I+ LS       +      A  ++       ++ + +
Sbjct: 274 YSNETKVINSLSMGINKSEVLQHIQNLSPRTGKAYTGA----AIKKLRKEVFSARNGSRK 329

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACAS 341
           +    +I V +T         +          ++ G  ++ +GI      + L   AS
Sbjct: 330 NQGVPQIAVLVTH-----RDSEDNVTKAAVNLRREGVTIFTLGIEGASDTQ-LEKIAS 381



 Score = 47.5 bits (111), Expect = 0.003,   Method: Composition-based stats.
 Identities = 33/201 (16%), Positives = 70/201 (34%), Gaps = 25/201 (12%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D++ ++D S                       + + +  +P   +  +  L  +S+K+  
Sbjct: 28  DVVFLVDSS------DRLGSRSFPFVKM---FITKMINSLPIEADKYRVALAQYSDKLHS 78

Query: 233 FFL--LEWGVSHLQRKI-KYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
            F      G S +   + K +   G S      L+ A+   F           +   +  
Sbjct: 79  EFHLSTFKGRSPMLNHLRKNVGFIGGSLQIGKALQEAHRTYFSAPADG----RDKKQFPP 134

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYL-- 347
           I+V +      S++ +   +      +K G  + +IG++   S E L+A A+    +   
Sbjct: 135 ILVVVA-----SSESEDDVVEASKALQKDGVKIISIGVQK-ASEENLKAMATSQFHFNLR 188

Query: 348 -VENPHSMYDAFSHIGKDIVT 367
            V +        +HI KD+  
Sbjct: 189 TVRDLSMFSQNMTHIIKDVTK 209


>gi|325927915|ref|ZP_08189139.1| Mg-chelatase subunit ChlD [Xanthomonas perforans 91-118]
 gi|325541755|gb|EGD13273.1| Mg-chelatase subunit ChlD [Xanthomonas perforans 91-118]
          Length = 338

 Score =  102 bits (253), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 31/222 (13%), Positives = 67/222 (30%), Gaps = 45/222 (20%)

Query: 169 DARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
                MM+ +D+S SM           + ++  A   ++  L       D  +  + GL+
Sbjct: 96  REARQMMLAVDLSGSMSEPDMVLGGKVVDRLTAAKAVLSDFL-------DRRDGDRVGLL 148

Query: 225 TFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            F  +      L   ++ ++ ++    +   G  T                  +      
Sbjct: 149 VFGQRAYALTPLTADLTSVRDQLSDSVVGLAGRETAIGDA-----------IALSVKRLR 197

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR-------------- 328
           E    ++++V +TDG N +       L     AK  G  V+ I                 
Sbjct: 198 EQKQGQRVVVLLTDGVNTAG--ALNPLKAAELAKAEGVRVHTIAFGGSGGYSLFGVPIPA 255

Query: 329 ---VIRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                   + LR  A  +   F+   +   +   ++ + +  
Sbjct: 256 GGNDDIDEDGLRKIAQQTGGRFFRARDTEELAGIYAELDRLE 297


>gi|221639828|ref|YP_002526090.1| hypothetical protein RSKD131_1729 [Rhodobacter sphaeroides KD131]
 gi|221160609|gb|ACM01589.1| Hypothetical Protein RSKD131_1729 [Rhodobacter sphaeroides KD131]
          Length = 566

 Score =  102 bits (253), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 29/207 (14%), Positives = 69/207 (33%), Gaps = 34/207 (16%)

Query: 8   IRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMN 67
           +R F  +  G + I     L ++ ++ G+ ++V    F +  L   +DR+++ AA+    
Sbjct: 13  LRRFGRSEDGSILIFGIFMLILMLMIGGLAVDVMRFEFQRARLQGTLDRAVLAAAS---- 68

Query: 68  EGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGY 127
                                           ++                +V        
Sbjct: 69  ------------LTQSRSPAEVVEDYVTKAGLEDYLDEP-----------VVNANTLNVR 105

Query: 128 SISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESF 187
           S++A + Y +P  F        +   +  P  S+ +        +++ +VLD+S SM + 
Sbjct: 106 SVTATAAYSMPTVFM----KLLDIDRLEAPAVSTAEERVSN---VEISLVLDMSNSMVTD 158

Query: 188 FDSSITKIDMAIKSINAMLEEVKLIPD 214
             +   ++D    +    ++ V    +
Sbjct: 159 GTNPRDRLDNLKVAARDFIDIVMAGAN 185



 Score = 57.6 bits (137), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 24/149 (16%), Positives = 49/149 (32%), Gaps = 3/149 (2%)

Query: 223 LVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
           +VT S  +E+        S  + + + +     ST +   L Y         G      +
Sbjct: 418 IVTRSCTVEQVCTRTRNGSCTRWQDQQVCTDTPSTVTAHRLSYPDLWHQARVGWVSGLYS 477

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR-SHEFLRACAS 341
                 +   +++  +       +++   C+ A+ +G  VY++           L+ CAS
Sbjct: 478 SAGVSGRYSSWVSTLDPTVKN--ERTRQICDAARAQGITVYSVAFEAEAGGQALLQYCAS 535

Query: 342 PNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
               Y       +   F  I   I   R+
Sbjct: 536 TTGHYYATVGPQIRTVFHSIASHITQLRL 564


>gi|297286914|ref|XP_001113364.2| PREDICTED: collagen alpha-6(VI) chain-like [Macaca mulatta]
          Length = 2262

 Score =  102 bits (253), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 40/267 (14%), Positives = 89/267 (33%), Gaps = 28/267 (10%)

Query: 109 DIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQT 168
                T L+ +     E Y     +   +     TF+    N     + + S      ++
Sbjct: 369 KGASDTQLEKIASHPAEQYVSKLKTFADLAAHNQTFLKKLRNQITHTVSVFSERTETLKS 428

Query: 169 D----ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
                   D+ +++D S S ++             +    + E V +     + V+ G V
Sbjct: 429 GCVDTEEADIYLLIDGSGSTQATDFH---------EMKIFLSEVVGMFNIAPHKVRVGAV 479

Query: 225 TFSNKIEEFF--LLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +++  +  F          L + I+ + + G +TN+   L +  + +      +     
Sbjct: 480 QYADSWDLEFEINKYSNKQDLGKAIENIRQLGGNTNTGAALNFTLSLL-----QKAKKQR 534

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
            +     ++V        +       L   N  ++    VYAIGI    +   LR  A  
Sbjct: 535 GNKVPCHLVVL------TNGMSKDSILEPANRLREEHIRVYAIGI-KEANQTQLREIAGE 587

Query: 343 N-SFYLVENPHSMYDAFSHIGKDIVTK 368
               Y V +  ++ D  + + ++I  +
Sbjct: 588 EKRVYYVHDFDALKDIRNQVVQEICAE 614



 Score = 85.3 bits (209), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 34/309 (11%), Positives = 90/309 (29%), Gaps = 21/309 (6%)

Query: 61   AATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVV 120
             A  +    +     +    +              +   D           +   +  V 
Sbjct: 889  TAEALGFSDHMFTEARGSRLNKGVPQVLIVITDGDSHDADKLNATAKALRDKGILVLAVG 948

Query: 121  VPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDV 180
            +       + A++       F             V     +         ++D++ ++D 
Sbjct: 949  IADANPVELLAMAGSSDKYFFVETFGGLKGIISDVTASVCNSSKVDCEIDKVDLVFLMDG 1008

Query: 181  SRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFL--LEW 238
            S S++              K    M+  V+     N  V+ G   FS+     F      
Sbjct: 1009 STSIQQTDF---------KKMKEFMVSVVQDFDVSNKRVRIGAAQFSDAYRPEFPLGTFI 1059

Query: 239  GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGE 298
            G   +  +I+ +++   +T+          +  +        +  +    ++++ +TD  
Sbjct: 1060 GAKEISIQIENITQIFGNTHIGAA-----LRKVEHYFRPDMGSRINTGTPQVLLVLTD-- 1112

Query: 299  NLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAF 358
                +   +        ++RG  +Y++GI  +   + ++   +      V N   +    
Sbjct: 1113 ---GQSQDEVAQAAEALRRRGIDIYSVGIGDVDDQQLMQITGTAEKKLTVHNFDELKKVN 1169

Query: 359  SHIGKDIVT 367
              I ++I T
Sbjct: 1170 KRIVRNICT 1178



 Score = 76.4 bits (186), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 45/334 (13%), Positives = 108/334 (32%), Gaps = 30/334 (8%)

Query: 44  FFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGF 103
           F  ++ + + ID+  +    Q    G+  +              +           +   
Sbjct: 680 FMSQSDISNAIDQ--MAHIGQTTLTGSALSFVSQYFSPTKGSRPSVRKFLILITDGEAQD 737

Query: 104 VNDIDDIVRSTSLDIVVVPQNEGYSIS----AISRYKIPLKFCTFIPWYTNSRHIVMPIT 159
           +     +       I+      G +++       R ++      F         +V  I 
Sbjct: 738 IVKEPAVALRQEGVIIYSVGVFGSNVTQLEEISGRPEMVFYVENFDILQRIEDDLVFGI- 796

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSI--TKIDMAIKSINAMLEEVKLIPDVNN 217
            S +   +    LD++ V+D S S++    + +    ID+  K+               N
Sbjct: 797 CSPREECKRIEVLDVVFVIDSSGSIDYDEYNIMKDFMIDIVRKA-----------DVGMN 845

Query: 218 VVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQG 275
            V+ G + +++  E  F L+       +   ++     G +T +   L +      D   
Sbjct: 846 RVRFGALKYADDPEVLFYLDNFGTKPEVISVLQTDQAMGGNTYTAEALGF-----SDHMF 900

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF 335
                +  +    ++++ +TDG++    +  +        + +G +V A+GI      E 
Sbjct: 901 TEARGSRLNKGVPQVLIVITDGDSH---DADKLNATAKALRDKGILVLAVGIADANPVEL 957

Query: 336 LRACASPNSFYLVENPHSMYDAFSHIGKDIVTKR 369
           L    S + ++ VE    +    S +   +    
Sbjct: 958 LAMAGSSDKYFFVETFGGLKGIISDVTASVCNSS 991



 Score = 59.5 bits (142), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 40/298 (13%), Positives = 92/298 (30%), Gaps = 33/298 (11%)

Query: 57  SLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSL 116
             +     +             G D   +      +   +E  D+              +
Sbjct: 104 GSLQIGKALQEAHRTYFSATTNGRD-KKQFPPILVVLASSESEDDVEKASKALQKDGVKI 162

Query: 117 DIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVK-----------VN 165
             V V +    ++ A++  +      T       S+++   I    K             
Sbjct: 163 ISVGVQKASEENLKAMATSQFHFNLRTVRDLSMFSQNMTQIIKDVAKYKEGAVDDIFVEA 222

Query: 166 SQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVT 225
            Q  +  D++ +LD+S       + S   +D        + E V  +    N ++ GLV 
Sbjct: 223 CQGPSMADVVFLLDMS------INGSDENLDYLK---GFLEESVSALDIKENCMRIGLVA 273

Query: 226 FSNKIEEFFL--LEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           +SN+ +      +    S + + I+ LS       +      A  ++       ++ + +
Sbjct: 274 YSNETKVINSLSMGINKSEVLQHIQNLSPRTGKAYTGA----AIKKLRKEVFSARNGSRK 329

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACAS 341
           +    +I V +T         +          ++ G  ++ +GI+     + L   AS
Sbjct: 330 NQGVPQIAVLVTH-----RDSEDNVTKAAVNLRREGVTIFTLGIKGASDTQ-LEKIAS 381



 Score = 46.4 bits (108), Expect = 0.007,   Method: Composition-based stats.
 Identities = 31/212 (14%), Positives = 67/212 (31%), Gaps = 25/212 (11%)

Query: 162 VKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQS 221
                      D++ ++D S                       + + +  +P   +  + 
Sbjct: 17  SVSQDSGPKYADVVFLVDSS------DRLGSRSFPFVKM---FITKMINSLPIEADKYRV 67

Query: 222 GLVTFSNKIEEFFL--LEWGVSHLQRKIK-YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQ 278
            L  +S+K+   F      G S +   +K      G S      L+ A+   F       
Sbjct: 68  ALAQYSDKLHSEFHLSTFKGRSPMLNHLKKNFGFIGGSLQIGKALQEAHRTYF----SAT 123

Query: 279 HCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRA 338
               +   +  I+V +      S++ +          +K G  + ++G++   S E L+A
Sbjct: 124 TNGRDKKQFPPILVVLA-----SSESEDDVEKASKALQKDGVKIISVGVQK-ASEENLKA 177

Query: 339 CASPNSFYL---VENPHSMYDAFSHIGKDIVT 367
            A+    +    V +        + I KD+  
Sbjct: 178 MATSQFHFNLRTVRDLSMFSQNMTQIIKDVAK 209


>gi|126657060|ref|ZP_01728231.1| von Willebrand factor type A domain protein [Cyanothece sp.
           CCY0110]
 gi|126621603|gb|EAZ92313.1| von Willebrand factor type A domain protein [Cyanothece sp.
           CCY0110]
          Length = 328

 Score =  102 bits (253), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 29/219 (13%), Positives = 73/219 (33%), Gaps = 36/219 (16%)

Query: 166 SQTDARLDMMIVLDVSRSMESFFD-----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQ 220
           +Q  +  D+M+++D+S+SME+        + I +++     ++  +E            +
Sbjct: 88  TQVQSARDLMLLVDLSQSMEAKDFQDQQGNKIDRLEAVKLVVDDFIER-------REGDR 140

Query: 221 SGLVTFSNKIEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQ 278
            GL+ F  K          +   +  +    +   G  T     +  A            
Sbjct: 141 IGLILFGTKAYLQVPFTQDLETARFLLDEAQIGMAGAQTMLGDAIGLAIQT--------- 191

Query: 279 HCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR------- 331
               +     ++++ +TDG +  ++           A +R  ++Y I I           
Sbjct: 192 --FEDSKTENRVLILLTDGNDTGSQVPPD--QAAKFAAQRNIVIYTIAIGNPETEGTEKI 247

Query: 332 SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
             E L+  A  +   F+   +   +   +  + +    +
Sbjct: 248 DEETLQLIADQTGGQFFRGSDRQGLIQIYDILDQLEPQE 286


>gi|126462813|ref|YP_001043927.1| hypothetical protein Rsph17029_2052 [Rhodobacter sphaeroides ATCC
           17029]
 gi|126104477|gb|ABN77155.1| conserved hypothetical protein [Rhodobacter sphaeroides ATCC 17029]
          Length = 566

 Score =  102 bits (253), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 29/207 (14%), Positives = 69/207 (33%), Gaps = 34/207 (16%)

Query: 8   IRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMN 67
           +R F  +  G + I     L ++ ++ G+ ++V    F +  L   +DR+++ AA+    
Sbjct: 13  LRRFGRSEDGSILIFGIFMLILMLMIGGLAVDVMRFEFQRARLQGTLDRAVLAAAS---- 68

Query: 68  EGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGY 127
                                           ++                +V        
Sbjct: 69  ------------LTQSRSPAEVVRDYVAKAGLEDYLDEP-----------VVNANTLNVR 105

Query: 128 SISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESF 187
           S++A + Y +P  F        +   +  P  S+ +        +++ +VLD+S SM + 
Sbjct: 106 SVTATAAYSMPTVFM----KLLDIDRLEAPAVSTAEERVSN---VEISLVLDMSNSMVTD 158

Query: 188 FDSSITKIDMAIKSINAMLEEVKLIPD 214
             +   ++D    +    ++ V    +
Sbjct: 159 GTNPRDRLDNLKVAARDFIDIVMAGAN 185



 Score = 57.6 bits (137), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 24/149 (16%), Positives = 49/149 (32%), Gaps = 3/149 (2%)

Query: 223 LVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
           +VT S  +E+        S  + + + +     ST +   L Y         G      +
Sbjct: 418 IVTRSCTVEQVCTRTRNGSCTRWQDQQVCTDTPSTVTAHRLSYPDLWHQARVGWVSGLYS 477

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR-SHEFLRACAS 341
                 +   +++  +       +++   C+ A+ +G  VY++           L+ CAS
Sbjct: 478 SAGVSGRYSSWVSTLDPTVKN--ERTRQICDAARAQGITVYSVAFEAEAGGQALLQYCAS 535

Query: 342 PNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
               Y       +   F  I   I   R+
Sbjct: 536 TTGHYYATVGPQIRTVFHSIASHITQLRL 564


>gi|330959358|gb|EGH59618.1| von Willebrand factor, type A [Pseudomonas syringae pv. maculicola
           str. ES4326]
          Length = 353

 Score =  102 bits (253), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 29/220 (13%), Positives = 66/220 (30%), Gaps = 45/220 (20%)

Query: 171 RLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+++ +DVS SM+          ++++ +  + +   LE            + GL+ F
Sbjct: 89  GRDLLVAVDVSGSMDYPDMQWKNDEVSRLVLVQQLLGDFLEG-------RKGDRVGLILF 141

Query: 227 SNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
             +      L +    ++  +    +   G +T     +  A                  
Sbjct: 142 GTQAFLQAPLTYDRRTVRVWLDEAKIGIAGKNTAIGDAIGLALK-----------RLRMR 190

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR------------- 331
               +++V +TDG N   + D   +     A   G  +Y +GI                 
Sbjct: 191 PANSRVLVLVTDGANNGGQID--PITAARLAADEGVKIYTVGIGSDPDKNALQGVLGLNP 248

Query: 332 ----SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                   L+  A  S   ++   +   +    + +    
Sbjct: 249 SLDLDEPTLKDIASLSGGQYFRARDGAELDKIRTALDALE 288


>gi|297567412|ref|YP_003686384.1| von Willebrand factor type A [Meiothermus silvanus DSM 9946]
 gi|296851861|gb|ADH64876.1| von Willebrand factor type A [Meiothermus silvanus DSM 9946]
          Length = 319

 Score =  102 bits (253), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 35/216 (16%), Positives = 79/216 (36%), Gaps = 33/216 (15%)

Query: 168 TDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFS 227
            D R  +++ LDVSRSM +      ++ + A +++   + E+          + GLVTFS
Sbjct: 82  ADPRTTIVLALDVSRSMRATD-VLPSRFEAAREALKVFIREL------PQGARIGLVTFS 134

Query: 228 NKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287
               E          L   ++ +      T    G+  +   +     + Q  + +D + 
Sbjct: 135 RAATEVVAPTTNRQRLLDSVELIGLE-FGTAIGEGILTSLQAL---PPLEQRKDAKDPSE 190

Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR-----------------VI 330
              I+ +TDG ++S  +    L     A ++   ++ IG+                    
Sbjct: 191 LATIILLTDGRSISGID---PLEAARIAAEQKVRIHTIGVGRVTEGPVPGLESVYQWAAY 247

Query: 331 RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKD 364
              + L+  A  +   ++ V +   + + +  + + 
Sbjct: 248 FDEDVLKQIAAITGGKYFFVNSAGKLRETYQQLSQS 283


>gi|70730104|ref|YP_259843.1| von Willebrand factor type A domain-containing protein [Pseudomonas
           fluorescens Pf-5]
 gi|68344403|gb|AAY92009.1| von Willebrand factor type A domain protein [Pseudomonas
           fluorescens Pf-5]
          Length = 358

 Score =  102 bits (253), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 28/220 (12%), Positives = 68/220 (30%), Gaps = 45/220 (20%)

Query: 171 RLDMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+++ +DVS SM+          ++++++    +   LE            + GL+ F
Sbjct: 89  GRDLLVAVDVSGSMDFPDMQWQDEDVSRLNLVKHLLGDFLE-------HREGDRVGLILF 141

Query: 227 SNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
            +K      L +    ++  +    +   G +T     +  A                + 
Sbjct: 142 GSKAYLQAPLTFDRHTVRVWLDEAKIGIAGKNTAIGDAIGLALK-----------RLRQR 190

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR------------- 331
               ++++ +TDG N   +     +     A + G  +Y IGI                 
Sbjct: 191 PAQSRVLILVTDGANNGGEI--APITAARLAAEEGVKIYPIGIGADPEQSATLGVLGINP 248

Query: 332 ----SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                   L+  A  +   ++   +   +      + +  
Sbjct: 249 SLDLDEPALKELAQVTGGRYFRARDGQELQAIKQTLDQLE 288


>gi|116623631|ref|YP_825787.1| von Willebrand factor, type A [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116226793|gb|ABJ85502.1| von Willebrand factor, type A [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 589

 Score =  102 bits (253), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 34/321 (10%), Positives = 91/321 (28%), Gaps = 28/321 (8%)

Query: 13  YNYKGGMTILTAIFLP-IIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNG 71
               G   ++  + +  ++  ++G+ I+    + ++  L S +D   + AA  + +  N 
Sbjct: 9   RRQGGQAIVMFTLLVSSVLIPMVGLAIDGGRGYLVRLKLSSAVDGGALAAARLLGSGSNA 68

Query: 72  NNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTS----LDIVVVPQNEGY 127
             +  +        +   +   F            +D    S+      +   +   +  
Sbjct: 69  AQQLSMAKATAAQFVNANFPAKFFGASLSGAANVCVDPGTDSSDPCGVGNGSGISTYKVR 128

Query: 128 SISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESF 187
           +++  +   +P  F            + +  + +      +   + +++V+D S SM ++
Sbjct: 129 TVAVKATATMPTLFM----RIIGMPTVTVSGSGTA-----SRRDVRVILVMDRSSSMGTY 179

Query: 188 FDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK---IEEFFLLEWGVSHLQ 244
           +                 +       +     + GLV +            +    +   
Sbjct: 180 YSGINQTPPSINDMALKFVNSFSGAGEFGGRDEVGLVVYGGSGIVAYPPRDITKDYTDYT 239

Query: 245 RKI---KYLSKFGV--------STNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVF 293
           +           G         ++ S  G   A    +         N + A    +IV 
Sbjct: 240 KFTPPDNNFKASGNIPKYIADITSGSNTGTAEALYLAYMTLRADAATNPDLATKLNVIVL 299

Query: 294 MTDGENLSTKEDQQSLYYCNE 314
            TDG               N+
Sbjct: 300 FTDGIPNGVTAMANDKTIANQ 320



 Score = 37.1 bits (84), Expect = 4.4,   Method: Composition-based stats.
 Identities = 10/64 (15%), Positives = 22/64 (34%), Gaps = 16/64 (25%)

Query: 322 VYAIGIRVIR----SHEFLRACASP------------NSFYLVENPHSMYDAFSHIGKDI 365
           ++ IG           + L+  A+                Y  ++P+++  AF  I  +I
Sbjct: 525 IFTIGFESTASDLPDMKLLQLIANDPSSPAPFSTRVQGKAYNAKDPNAVDAAFQQIRSEI 584

Query: 366 VTKR 369
           +   
Sbjct: 585 LRLS 588


>gi|313674519|ref|YP_004052515.1| von willebrand factor type a [Marivirga tractuosa DSM 4126]
 gi|312941217|gb|ADR20407.1| von Willebrand factor type A [Marivirga tractuosa DSM 4126]
          Length = 345

 Score =  102 bits (253), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 41/223 (18%), Positives = 78/223 (34%), Gaps = 45/223 (20%)

Query: 170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229
             +D+M+VLD+S SM+     +  +++ A +  N  +       D     + GL  FS +
Sbjct: 103 EGIDIMLVLDISESMKIQDF-TPNRLEAAKQVANDFI-------DGRFQDRIGLTIFSGE 154

Query: 230 IEEFFLLEWGVSHLQRKIKYLSKFG---VSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
                 L      L+ +I  +         T     L    N++            E  +
Sbjct: 155 AYSLSPLTTDYKMLKNQITDIDFKMMEASGTAIGSALAVGTNRM-----------RESDS 203

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR----VIRSHEF------- 335
             K+++ ++DG+N +   D ++      A   G  +Y I I     V    +F       
Sbjct: 204 KSKVLILLSDGDNNAGNIDPET--SAKLANAYGIKIYTIAIGKEGKVPYGKDFFGRTRYI 261

Query: 336 --------LRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                   L+  A      FY   +  ++ + FS I +    +
Sbjct: 262 ENSMDVTGLKNIAKIGEGQFYRATDNQALEEVFSIIDQYEKAE 304


>gi|188578240|ref|YP_001915169.1| von Willebrand factor type A domain protein [Xanthomonas oryzae pv.
           oryzae PXO99A]
 gi|188522692|gb|ACD60637.1| von Willebrand factor type A domain protein [Xanthomonas oryzae pv.
           oryzae PXO99A]
          Length = 335

 Score =  102 bits (253), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 31/222 (13%), Positives = 68/222 (30%), Gaps = 45/222 (20%)

Query: 169 DARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
                MM+ +D+S SM           + ++  A   ++  L       D  +  + GL+
Sbjct: 96  REARQMMLAVDLSGSMNEPDMVLGGKVVDRLTAAKAVLSDFL-------DRRDGDRVGLL 148

Query: 225 TFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            F  +      L   ++ ++ +++   +   G  T                  +      
Sbjct: 149 VFGQRAYALTPLTADLTSVRDQLRDSVVGLAGRETAIGDA-----------IALSVKRLR 197

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGI--------------- 327
           E    ++++V +TDG N +       L     AK  G  +Y I                 
Sbjct: 198 EQKQGQRVVVLLTDGVNTAG--VLDPLKAAELAKAEGVRIYTIAFGGGGGYSLFGVPIPA 255

Query: 328 --RVIRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                   + LR  A  +   F+   +   +   ++ + +  
Sbjct: 256 GGNDDIDEDGLRKIAQQTGGRFFRARDTEELAGIYAELDRLE 297


>gi|153833319|ref|ZP_01985986.1| von Willebrand factor, type A [Vibrio harveyi HY01]
 gi|148870455|gb|EDL69376.1| von Willebrand factor, type A [Vibrio harveyi HY01]
          Length = 363

 Score =  102 bits (253), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 35/241 (14%), Positives = 78/241 (32%), Gaps = 29/241 (12%)

Query: 145 IPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSIT-----KIDMAI 199
           I W      +  P T   +   +     D+M+V+D+S SM     +S       ++D A 
Sbjct: 80  ISWLLVVTAMAKP-TVLGEPQVRESLGRDVMVVVDLSGSMAEQDFTSKNGEKISRLDAAK 138

Query: 200 KSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVST 257
           + ++   +            + GL+ F +                  +    ++  G ST
Sbjct: 139 EVLSDFAKT-------RKGDRLGLILFGDAAFVQTPFTPDQKVWLELLNQTDVAMAGQST 191

Query: 258 NSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKK 317
           +    +  A       +   +     + + +K+ + +TDG +       + +     AK 
Sbjct: 192 HLGDAIGLAIKV---FEQSEKSRTDVEESKEKVAIVLTDGNDTG--SFVEPIDAAKVAKA 246

Query: 318 RGAIVYAIGIRVIR-------SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
           +   ++ I +   +           ++  A  S    +   N   +  A+  IGK     
Sbjct: 247 KDVRIHVIAMGDPQTVGETALDMNTIKRIAKESGGEAFEALNRDELAKAYDEIGKLEPQL 306

Query: 369 R 369
            
Sbjct: 307 Y 307


>gi|323499301|ref|ZP_08104278.1| hypothetical protein VISI1226_03745 [Vibrio sinaloensis DSM 21326]
 gi|323315689|gb|EGA68723.1| hypothetical protein VISI1226_03745 [Vibrio sinaloensis DSM 21326]
          Length = 322

 Score =  102 bits (253), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 33/230 (14%), Positives = 71/230 (30%), Gaps = 46/230 (20%)

Query: 162 VKVNSQTDARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNN 217
            +  +      D+M+VLD+S SM           + ++    K ++    +         
Sbjct: 75  GEPVTTQPKHRDLMLVLDLSYSMSQEDMSDGSDYVDRLTAVKKVVSDFAIK-------RE 127

Query: 218 VVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYL--SKFGVSTNSTPGLKYAYNQIFDMQG 275
             + G+V F++       L    + +  ++  L     G  T    G+  A         
Sbjct: 128 GDRLGVVLFADHAYLQTPLTLDRTTVADQVNQLVLRLIGDKTAIGEGIGLATKTFI---- 183

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV------ 329
                  +    +++++ ++DG N S   D   +     AKK  A +Y IG+        
Sbjct: 184 -------DSDAPQRVMILLSDGSNTSGVID--PIEAAKIAKKYDATIYTIGVGAGEMMVK 234

Query: 330 ------------IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                           + L   A  +   ++   +   +   +  I    
Sbjct: 235 EFFMTRKVNTAQDLDEKALMQIAQITGGQYFRARDAKELATIYDTINSLE 284


>gi|289662175|ref|ZP_06483756.1| hypothetical protein XcampvN_03493 [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 335

 Score =  102 bits (253), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 32/222 (14%), Positives = 68/222 (30%), Gaps = 45/222 (20%)

Query: 169 DARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
                MM+ +D+S SM           + ++  A   ++  L       D  +  + GL+
Sbjct: 96  REARQMMLAVDLSGSMSEPDMVLGGKVVDRLTAAKAVLSDFL-------DRRDGDRVGLL 148

Query: 225 TFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            F  +      L   ++ ++ +++   +   G  T                  +      
Sbjct: 149 VFGQRAYALTPLTADLTSVRDQLRDSVVGLAGRETAIGDA-----------IALSVKRLR 197

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR-------------- 328
           E    ++++V +TDG N +       L     AK  G  V+ I                 
Sbjct: 198 EQKQGQRVVVLLTDGVNTAG--VLNPLKAAELAKAEGVRVHTIAFGGSGGYSLFGVPIPA 255

Query: 329 ---VIRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                   E LR  A  +   F+   +   +   ++ + +  
Sbjct: 256 GGNDDIDEEGLRKIAQQTGGRFFRARDTEELAGIYAELDRLE 297


>gi|91773457|ref|YP_566149.1| von Willebrand factor, type A [Methanococcoides burtonii DSM 6242]
 gi|91712472|gb|ABE52399.1| hypothetical protein with von Willebrand factor type A domain and
           Invasin domain [Methanococcoides burtonii DSM 6242]
          Length = 892

 Score =  101 bits (252), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 51/316 (16%), Positives = 105/316 (33%), Gaps = 34/316 (10%)

Query: 67  NEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDD---IVRSTSLDIVVVPQ 123
           +  N +N            I    + +F       G  + I+D   I       I     
Sbjct: 505 DGSNESNLINFTTDQYGRVITEFTSSNFVGNCTIIGLSDAINDSLSIEIRNQPFISASID 564

Query: 124 NEGYSIS----AISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLD 179
            E Y ++          I ++    +     +  +++  + S+  +      LD+++VLD
Sbjct: 565 AEPYVVTSGDIVNITTVITVEGELPVSRSAATSMLILDRSGSMDPDYYAGTALDIVLVLD 624

Query: 180 VSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEW- 238
            S SM+   ++    +  A  +    +E +          + G+V+FS+           
Sbjct: 625 RSGSMKFLGNAPEQPLTDAKSAAKIFMENLLS------NTEVGVVSFSSTSTVDRQPVSL 678

Query: 239 ----GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFM 294
                   L   I  +   G  T     +  A N + +             + KKI++ +
Sbjct: 679 NISGNKDLLHNAIDSMVADG-GTAIGDAMADANNLLIN----------GRPDAKKIMIVL 727

Query: 295 TDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR--SHEFLRACA--SPNSFYLVEN 350
           TDG   +  +   S    + A      +Y+IG+          L+  A  +  S+Y   +
Sbjct: 728 TDGVATAGSDRDGS-DAISTANLNNIRIYSIGLGSSEYIDEPMLKRIASETGGSYYNAPS 786

Query: 351 PHSMYDAFSHIGKDIV 366
              +   ++ I K+I 
Sbjct: 787 GSELQTVYNTISKEIS 802


>gi|330829762|ref|YP_004392714.1| von Willebrand factor, type A [Aeromonas veronii B565]
 gi|328804898|gb|AEB50097.1| von Willebrand factor, type A [Aeromonas veronii B565]
          Length = 347

 Score =  101 bits (252), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 34/221 (15%), Positives = 72/221 (32%), Gaps = 26/221 (11%)

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSS-----ITKIDMAIKSINAMLEEVKLIPDVNNVV 219
             +     D+MIVLD+S SM     S      ++++D A + +                 
Sbjct: 91  QVRERFGRDVMIVLDLSGSMAETDFSPDPGKSLSRLDAAKEVLKQFAAT-------REGD 143

Query: 220 QSGLVTFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + GL+ F +           +   Q  ++   ++  G ST+    +  A     +     
Sbjct: 144 RLGLILFGDAAFLQAPFTADLETWQTLLQETDVAMAGQSTHLGDAIGLAIKVFNNSDRHG 203

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR------ 331
           Q  +   A  +K+ + +TDG +               A   G  ++ I +          
Sbjct: 204 QQ-DQNSAKREKVAIILTDGNDTG--SFVSPRDAARVAAVNGVRLHTIAMGDPATVGEQA 260

Query: 332 -SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKR 369
              + L+  A  +    +   +   +  A+  IG+    + 
Sbjct: 261 LDLDTLQQLATLTGGQLFQALDEAQLTRAYQVIGELEPQRY 301


>gi|281357358|ref|ZP_06243847.1| von Willebrand factor type A [Victivallis vadensis ATCC BAA-548]
 gi|281316389|gb|EFB00414.1| von Willebrand factor type A [Victivallis vadensis ATCC BAA-548]
          Length = 342

 Score =  101 bits (252), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 33/237 (13%), Positives = 74/237 (31%), Gaps = 57/237 (24%)

Query: 171 RLDMMIVLDVSRSMESFFDSS-----------------ITKIDMAIKSINAMLEEVKLIP 213
            +D+++ LD+S SME++                       +I++A K I   +E+     
Sbjct: 83  GIDIVLALDMSGSMEAYDVPRNINDARTLIAAVKNKEVENRIEVAKKEIRRFIEQ----- 137

Query: 214 DVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM 273
                 + GL+ F+++   F       + L   ++ L    +   +      A       
Sbjct: 138 --RPNDRIGLIGFADQAYSFAPPTLDHAWLLAHLEQLEPGMIGQQTGIAAPLA------- 188

Query: 274 QGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR----- 328
                +   +    ++++V  TDG N                K+   +++ +GI      
Sbjct: 189 --SGVNRLKKSDAPRRVLVLFTDGRNNVDN-RLTPEQAAALGKEFDVVIHTVGIGSRNAF 245

Query: 329 ----------------VIRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVT 367
                                + LR+ A  +  +++   +   M      I +   T
Sbjct: 246 VLVTDPFGRQQFQGIEDEFDEKLLRSLAEITGGTYFHAADADGMKQVMDEINQLEKT 302


>gi|325917650|ref|ZP_08179844.1| Mg-chelatase subunit ChlD [Xanthomonas vesicatoria ATCC 35937]
 gi|325536114|gb|EGD07916.1| Mg-chelatase subunit ChlD [Xanthomonas vesicatoria ATCC 35937]
          Length = 335

 Score =  101 bits (252), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 31/222 (13%), Positives = 67/222 (30%), Gaps = 45/222 (20%)

Query: 169 DARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
                MM+ +D+S SM         + + ++  A   ++  L       D  +  + GL+
Sbjct: 96  REARQMMLAVDLSGSMSEPDMVLGGNVVDRLTAAKAVLSDFL-------DRRDGDRVGLL 148

Query: 225 TFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            F  +      L   ++ ++ ++    +   G  T                  +      
Sbjct: 149 VFGQRAYALTPLTADLTSVRDQLADSVVGLAGRETAIGDA-----------IALSVKRLR 197

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR-------------- 328
           E    ++++V +TDG N +       L     AK  G  V+ I                 
Sbjct: 198 EQKQGQRVVVLLTDGVNTAG--VLNPLKAAELAKAEGVRVHTIAFGGSGGYSLFGVPIPA 255

Query: 329 ---VIRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                     LR  A  +   F+   +   +   ++ + +  
Sbjct: 256 GGNDDIDEAGLRKIAEQTGGRFFRARDTEELAGIYAELDRLE 297


>gi|189485266|ref|YP_001956207.1| aerotolerance-related cytoplasmic membrane protein BatA [uncultured
           Termite group 1 bacterium phylotype Rs-D17]
 gi|170287225|dbj|BAG13746.1| aerotolerance-related cytoplasmic membrane protein BatA [uncultured
           Termite group 1 bacterium phylotype Rs-D17]
          Length = 333

 Score =  101 bits (252), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/224 (17%), Positives = 74/224 (33%), Gaps = 42/224 (18%)

Query: 168 TDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFS 227
           +D  +D+++ LD S SM S    S+ +++ A K I   ++E           + GLV FS
Sbjct: 86  SDQGIDIIVALDTSTSMRSLDFRSLNRMEAAKKVIRDFMKE-------RKYDRIGLVIFS 138

Query: 228 NKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287
                   L      L   I  ++  G +      +  A            +   +    
Sbjct: 139 GLAFTQCPLTTDKDSLAEFINNINI-GDTGLDGTAIGSAIMT-------SVNRLKDSRAK 190

Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR------------------- 328
            +II+ +TDG N   + D   L     A+     +YA+G+                    
Sbjct: 191 SRIIILVTDGNNNMGEID--PLTASKIARSYDIKIYAVGVGSLDGAIYEVDDPFLGKREI 248

Query: 329 ----VIRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIV 366
                  +   L+  A  +   ++  ++  S  +    I K   
Sbjct: 249 KYRKDAINESVLKEVAYNTSGGYFRAQDVKSFENIMKQIDKLEK 292


>gi|94499146|ref|ZP_01305684.1| hypothetical protein RED65_10169 [Oceanobacter sp. RED65]
 gi|94428778|gb|EAT13750.1| hypothetical protein RED65_10169 [Oceanobacter sp. RED65]
          Length = 340

 Score =  101 bits (252), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 34/218 (15%), Positives = 80/218 (36%), Gaps = 38/218 (17%)

Query: 168 TDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFS 227
                +MM+ +D+S+SM         ++   ++++ A++ +           + GL+ F 
Sbjct: 84  QQTDRNMMLAVDISKSMLEEDMQYQGRLVNRLQTVKAVVTDFVEE---RKGDRLGLILFG 140

Query: 228 NKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDA 285
            +      L + +S ++R +    +   G  T     +     ++ D+            
Sbjct: 141 EQAYIQTPLTFDLSTVKRLLDEAVVGLAGNKTAIGDAIGLGVKRLQDLPESN-------- 192

Query: 286 NYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR-------------- 331
              ++++ +TDG+N + +   + L     A+K G  +YAIGI                  
Sbjct: 193 ---RVLILLTDGQNTAGEI--EPLKAAELAEKAGVKIYAIGIGADEMVIQGFFGPRRVNP 247

Query: 332 ----SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGK 363
                 + L A A  +   +Y   N + +   +  + +
Sbjct: 248 SRDLDEDTLTAIAENTGGQYYRARNVNELEQIYDVLNQ 285


>gi|152985991|ref|YP_001347440.1| hypothetical protein PSPA7_2067 [Pseudomonas aeruginosa PA7]
 gi|150961149|gb|ABR83174.1| hypothetical protein PSPA7_2067 [Pseudomonas aeruginosa PA7]
          Length = 337

 Score =  101 bits (252), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 30/220 (13%), Positives = 69/220 (31%), Gaps = 45/220 (20%)

Query: 171 RLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+++ +DVS SM+          I+++++  K     +E            + GL+ F
Sbjct: 89  GRDLLLAVDVSGSMDYRDMRWQDDEISRLELVKKLFGDFIEG-------RRGDRVGLILF 141

Query: 227 SNKIEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
            ++      L +    ++  +    +   G +T     +  A                + 
Sbjct: 142 GSQAYLQAPLTFDRHTVRVWLDEAQIGIAGKNTAIGDAIGLALK-----------RLRQR 190

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR------------- 331
               +++V +TDG N   +   Q+      A +    +Y IGI                 
Sbjct: 191 PAESRVLVLITDGANTGGQISPQT--AARLAAEERVKIYTIGIGADPQQGGVIGLFGLNP 248

Query: 332 ----SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                   LR  A  +   ++   +   +    + + +  
Sbjct: 249 GLDLDEPVLRGIAETTGGEYFRARSSAELESISATLDRLE 288


>gi|255037594|ref|YP_003088215.1| von Willebrand factor type A [Dyadobacter fermentans DSM 18053]
 gi|254950350|gb|ACT95050.1| von Willebrand factor type A [Dyadobacter fermentans DSM 18053]
          Length = 339

 Score =  101 bits (252), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 35/220 (15%), Positives = 70/220 (31%), Gaps = 41/220 (18%)

Query: 170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229
             +D+M++LD+S SM     S   +++ A +     ++            + GL+ F+ +
Sbjct: 101 EGIDIMLLLDISDSMIEKDLS-PNRLEAAKRMARQFIKG-------RLQDRIGLIVFAGE 152

Query: 230 IEEFFLLEWGVSHLQRKIKYLSK---FGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
                 L      L   +  ++        T     L  A N++ D  G           
Sbjct: 153 AVSLCPLTTDYELLYGFLDEVTPSLIPTPGTAIGSALAVAVNRMRDTAGES--------- 203

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR--------------- 331
             K+ + ++DG+N S      +      A   G  VY I +   +               
Sbjct: 204 --KVAILISDGDNTSGNLGPTT--SAQLANAFGVKVYTISVGKPKSASKADTTASAGALM 259

Query: 332 SHEFLRACAS--PNSFYLVENPHSMYDAFSHIGKDIVTKR 369
               L+  A      ++   +  ++   F  I +    K 
Sbjct: 260 DEGELQNIAGIGNGKYFRATDNTALESVFKQIDQLEKVKS 299


>gi|37676326|ref|NP_936722.1| hypothetical protein VVA0666 [Vibrio vulnificus YJ016]
 gi|37200868|dbj|BAC96692.1| conserved hypothetical protein [Vibrio vulnificus YJ016]
          Length = 362

 Score =  101 bits (252), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 33/220 (15%), Positives = 72/220 (32%), Gaps = 30/220 (13%)

Query: 171 RLDMMIVLDVSRSMESFFDS-----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVT 225
             D+M+V+D+S SM     +     +I+++D   + +    +            + GL+ 
Sbjct: 105 GRDVMVVVDLSGSMAEQDFTSASGANISRLDATKEVLAEFAKT-------RQGDRLGLIL 157

Query: 226 FSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           F +                  +    ++  G ST+    +  A       +    +    
Sbjct: 158 FGDAAFVQTPFTADQKVWLALLNQTDVAMAGQSTHLGDAIGLAIKV---FEQSESNQAAS 214

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR-------SHEFL 336
               +K+ + +TDG +       + +     AK +G  ++ I +             + +
Sbjct: 215 SKPRQKVAIVLTDGNDTG--SFVEPIDAAKVAKAKGVRIHVIAMGDPSTVGESALDLQTI 272

Query: 337 RACA--SPNSFYLVENPHSMYDAFSHIGKDIVT--KRIWY 372
              A  S    +   N   +  A+  IGK      + I Y
Sbjct: 273 ERIASESGGKAFQALNRDELARAYDDIGKLEPQLYQSITY 312


>gi|154089852|emb|CAO81741.1| collagen type VI alpha 6 [Homo sapiens]
          Length = 840

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 41/267 (15%), Positives = 91/267 (34%), Gaps = 28/267 (10%)

Query: 109 DIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQT 168
           +    T L+ +     E Y     +   +     TF+    N     + + S      ++
Sbjct: 367 EGASDTQLEKIASHPAEQYVSKLKTFADLAAHNQTFLKKLRNQITHTVSVFSERTETLKS 426

Query: 169 D----ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
                   D+ +++D S S ++             +    + E V +     + V+ G V
Sbjct: 427 GCVDTEEADIYLLIDGSGSTQATDFH---------EMKTFLSEVVGMFNIAPHKVRVGAV 477

Query: 225 TFSNKIEEFF--LLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +++  +  F          L + I+ + + G +TN+   L +  + +      +     
Sbjct: 478 QYADSWDLEFEINKYSNKQDLGKAIENIRQMGGNTNTGAALNFTLSLL-----QKAKKQR 532

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
            +     ++V        +       L   N  ++    VYAIGI    +   LR  A  
Sbjct: 533 GNKVPCHLVVL------TNGMSKDSILEPANRLREEHIRVYAIGI-KEANQTQLREIAGE 585

Query: 343 N-SFYLVENPHSMYDAFSHIGKDIVTK 368
               Y V +  ++ D  + + ++I T+
Sbjct: 586 EKRVYYVHDFDALKDIRNQVVQEICTE 612



 Score = 61.8 bits (148), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 26/199 (13%), Positives = 63/199 (31%), Gaps = 23/199 (11%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D+M ++D S S+                 +  ++ + ++ PD   +        + +  +
Sbjct: 621 DIMFLVDSSGSI------GPENFSKMKTFMKNLVSKSQIGPDRVQIGVVQFSDINKEEFQ 674

Query: 233 FFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIV 292
                   S +   I  ++  G +T +          +  +            N +K ++
Sbjct: 675 LNRFMS-QSDISNAIDQMAHIGQTTLTGSA-------LSFVSQYFSPTKGARPNIRKFLI 726

Query: 293 FMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIG-IRVIRSHEFLRACAS-PNSFYLVEN 350
            +TD      +            ++ G I+Y++G      +   L   +  P   + VEN
Sbjct: 727 LITD-----GEAQDIVKEPAVVLRQEGVIIYSVGVFGSNVTQ--LEEISGRPEMVFYVEN 779

Query: 351 PHSMYDAFSHIGKDIVTKR 369
              +      +   I + R
Sbjct: 780 FDILQRIEDDLVFGICSPR 798



 Score = 55.2 bits (131), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 39/298 (13%), Positives = 89/298 (29%), Gaps = 33/298 (11%)

Query: 57  SLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSL 116
             +     +             G D   +      +   +E  DN              +
Sbjct: 102 GSLQIGKALQEAHRTYFSAPANGRD-KKQFPPILVVLASSESEDNVEEASKALRKDGVKI 160

Query: 117 DIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIV-----------MPITSSVKVN 165
             V V +    ++ A++  +      T       S+++              +       
Sbjct: 161 ISVGVQKASEENLKAMATSQFHFNLRTVRDLSMFSQNMTHIIKDVIKYKEGAVDDIFVEA 220

Query: 166 SQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVT 225
            Q  +  D++ +LD+S       + S    D        + E V  +    N ++ GLV 
Sbjct: 221 CQGPSMADVVFLLDMS------INGSEENFDYLK---GFLEESVSALDIKENCMRVGLVA 271

Query: 226 FSNKIEEFFL--LEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           +SN+ +      +    S + + I+ LS       +      A  ++       ++ + +
Sbjct: 272 YSNETKVINSLSMGINKSEVLQHIQNLSPRTGKAYTGA----AIKKLRKEVFSARNGSRK 327

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACAS 341
           +    +I V +T         +          ++ G  ++ +GI      + L   AS
Sbjct: 328 NQGVPQIAVLVTH-----RDSEDNVTKAAVNLRREGVTIFTLGIEGASDTQ-LEKIAS 379



 Score = 43.7 bits (101), Expect = 0.046,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 62/186 (33%), Gaps = 22/186 (11%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D++ ++D S                       + + +  +P   +  +  L  +S+K+  
Sbjct: 26  DVVFLVDSS------DRLGSKSFPFVKM---FITKMISSLPIEADKYRVALAQYSDKLHS 76

Query: 233 FFL--LEWGVSHLQRKI-KYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
            F      G S +   + K     G S      L+ A+   F           +   +  
Sbjct: 77  EFHLSTFKGRSPMLNHLRKNFGFIGGSLQIGKALQEAHRTYFSAPA----NGRDKKQFPP 132

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVE 349
           I+V +      S++ +          +K G  + ++G++   S E L+A A+    + + 
Sbjct: 133 ILVVLA-----SSESEDNVEEASKALRKDGVKIISVGVQK-ASEENLKAMATSQFHFNLR 186

Query: 350 NPHSMY 355
               + 
Sbjct: 187 TVRDLS 192


>gi|328951280|ref|YP_004368615.1| von Willebrand factor type A [Marinithermus hydrothermalis DSM
           14884]
 gi|328451604|gb|AEB12505.1| von Willebrand factor type A [Marinithermus hydrothermalis DSM
           14884]
          Length = 320

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 32/211 (15%), Positives = 70/211 (33%), Gaps = 36/211 (17%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
            +++ +D SRSM +      ++++ A  +    +  +         V+ GLV FS+    
Sbjct: 94  TVVLAIDTSRSMRAEDL-EPSRLEAAKAAAREFIRAM------PPGVEVGLVAFSSYATL 146

Query: 233 FFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIV 292
                     L++ +  L      T    GL  A   +           +        +V
Sbjct: 147 LQPPTTDRERLEQAVDLLDLAHR-TAIGDGLVAALRVLPLEDSDAPGGMS--------VV 197

Query: 293 FMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR---------------VIRSHEFLR 337
            ++DG N    +    L    +A+ +G  VY +G+                     E L+
Sbjct: 198 LLSDGRNNYGID---PLEAARQAEAQGVRVYTVGVGLSENTYVFANGYYIRAGLDEETLQ 254

Query: 338 ACA--SPNSFYLVENPHSMYDAFSHIGKDIV 366
             A  +  ++Y   +   +   +  + + + 
Sbjct: 255 EIAALTGGAYYRASSADELRAVYQTLARAVR 285


>gi|320158501|ref|YP_004190879.1| BatA [Vibrio vulnificus MO6-24/O]
 gi|319933813|gb|ADV88676.1| BatA [Vibrio vulnificus MO6-24/O]
          Length = 362

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 33/220 (15%), Positives = 71/220 (32%), Gaps = 30/220 (13%)

Query: 171 RLDMMIVLDVSRSMESFFDS-----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVT 225
             D+M+V+D+S SM     +     +I+++D   + +    +            + GL+ 
Sbjct: 105 GRDVMVVVDLSGSMAEQDFTSASGANISRLDATKEVLAEFAKT-------RQGDRLGLIL 157

Query: 226 FSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           F +                  +    ++  G ST+    +  A       +         
Sbjct: 158 FGDAAFVQTPFTADQKVWLALLNQTDVAMAGQSTHLGDAIGLAIKV---FEQSEPSQAAS 214

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR-------SHEFL 336
               +K+ + +TDG +       + +     AK +G  ++ I +             + +
Sbjct: 215 SKPRQKVAIVLTDGNDTG--SFVEPIDAAKVAKAKGVRIHVIAMGDPSTVGESALDLQTI 272

Query: 337 RACA--SPNSFYLVENPHSMYDAFSHIGKDIVT--KRIWY 372
              A  S    +   N   +  A+  IGK      + I Y
Sbjct: 273 ERIASESGGKAFQALNRDELASAYDDIGKLEPQLYQSITY 312


>gi|307353371|ref|YP_003894422.1| von Willebrand factor type A [Methanoplanus petrolearius DSM 11571]
 gi|307156604|gb|ADN35984.1| von Willebrand factor type A [Methanoplanus petrolearius DSM 11571]
          Length = 317

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 38/222 (17%), Positives = 82/222 (36%), Gaps = 39/222 (17%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
           QT   ++++  LD S SME+       +I  A ++I  ++ ++      +    +G++TF
Sbjct: 84  QTKEGVNIVFALDTSGSMEAADY-QPDRITAAKEAIGTLINQL------DLKDYAGIITF 136

Query: 227 SNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
            +       L      +  K+  ++    ST    GL  A +                 N
Sbjct: 137 DSGASTAAYLSPDKQRVIEKLGMIAASDDSTAIGDGLALAVDMS-----------KSIPN 185

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI---------------- 330
            K +++ ++DGE+ +     ++      AK+ G  V+ + +                   
Sbjct: 186 RKSVVILLSDGESNAGYVSPET--AAEFAKESGVQVFTVAMGSSEKVLVGYDWANNPQYA 243

Query: 331 -RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKR 369
               E L   A  +   FY   +  ++ + +S +   IV ++
Sbjct: 244 TVDEETLEYIADSTGGGFYSSVDEKTLGNIYSQLDDAIVHEK 285


>gi|149376601|ref|ZP_01894361.1| hypothetical protein MDG893_00577 [Marinobacter algicola DG893]
 gi|149359119|gb|EDM47583.1| hypothetical protein MDG893_00577 [Marinobacter algicola DG893]
          Length = 340

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 29/221 (13%), Positives = 70/221 (31%), Gaps = 46/221 (20%)

Query: 171 RLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+++ +D+S SM+         SI ++    + ++  ++            + GL+ F
Sbjct: 88  GRDLLLAVDISPSMDEQDMVIQGRSINRLQAVKRVLDDFIQR-------REGDRLGLLLF 140

Query: 227 SNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
             +      L + ++ ++  +    +   G +T     L  A                + 
Sbjct: 141 GTEPYIQAPLTFDLATVRTLLHEAGIGMAGRATAIGDALGLAVK-----------RLRDR 189

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV--------------- 329
              +++++ +TDG N + +           AK  G  +Y IGI                 
Sbjct: 190 PQEQRVVILLTDGANTAGEIAPD--KAAEIAKAAGVRIYTIGIGAETMVQRGLLGSRRVN 247

Query: 330 ---IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                    L   A  +   ++   +   +   +  I +  
Sbjct: 248 PSRDLDEGLLTRIAQQTGGEYFRARSLPELELIYESINQLE 288


>gi|119775307|ref|YP_928047.1| von Willebrand factor type A domain-containing protein [Shewanella
           amazonensis SB2B]
 gi|119767807|gb|ABM00378.1| von Willebrand factor type A domain protein [Shewanella amazonensis
           SB2B]
          Length = 327

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 29/218 (13%), Positives = 66/218 (30%), Gaps = 38/218 (17%)

Query: 170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229
              D+M+ +D+S SM+        K    +     +   V    +     + GL+ F + 
Sbjct: 81  KGRDLMVAVDLSGSMQIEDMVLDNK---TVDRFTLVQHVVSDFIERRVGDRIGLILFGDH 137

Query: 230 IEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287
                 +      + + ++   +   G  T     +  A  +  +++             
Sbjct: 138 AYLQSPMTQDRRSVAQYLREAQIGLVGKQTAIGESIALAVKRFENLEESN---------- 187

Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV------------------ 329
            +++V +TDG N +             A +R   +Y IG+                    
Sbjct: 188 -RVLVLLTDGTNNAGSISPD--KAAAIAAERKVTIYTIGVGAEMMERRSFFGRDRVNPSM 244

Query: 330 IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
               E L+  A  +   ++   +   +   +  I K  
Sbjct: 245 DLDEEQLQRIANATQGKYFRARSSEDLAAIYQEIDKLE 282


>gi|254775742|ref|ZP_05217258.1| hypothetical protein MaviaA2_13890 [Mycobacterium avium subsp.
           avium ATCC 25291]
          Length = 335

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 36/260 (13%), Positives = 75/260 (28%), Gaps = 30/260 (11%)

Query: 130 SAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFD 189
           S   +     +    I    +     + +            R  +M+V+DVS+SM +   
Sbjct: 55  SVAPKRTSTWRHLPAILLVASLVLFTIAMAGPTNDVRIPRNRAVVMLVIDVSQSMRATD- 113

Query: 190 SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKY 249
            +  ++  A ++     +E+    +       GL+ ++                +  +  
Sbjct: 114 VAPNRMAAAQEAAKQFADELTPGIN------LGLIAYAGTATVLVSPTTNREATKNALDK 167

Query: 250 LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSL 309
           L  F   T +  G+  A   I  +          D      IV  +DG+           
Sbjct: 168 LQ-FADRTATGEGIFTALQAIATV---GAVIGGGDKPPPARIVLFSDGKETMPTNPDNPK 223

Query: 310 ---YYCNEAKKRGAIVYAIGIRVIR--------------SHEFLRACA--SPNSFYLVEN 350
                   AK +G  +  I                      E L+  A  S  + Y   +
Sbjct: 224 GAFTAARTAKDQGVPISTISFGTPYGFVEINDQRQPVPVDDETLKKVAQLSGGNAYNAAS 283

Query: 351 PHSMYDAFSHIGKDIVTKRI 370
              +   ++ + + I  + I
Sbjct: 284 LQELKSVYATLQQQIGYETI 303


>gi|149199796|ref|ZP_01876826.1| hypothetical protein LNTAR_23599 [Lentisphaera araneosa HTCC2155]
 gi|149137084|gb|EDM25507.1| hypothetical protein LNTAR_23599 [Lentisphaera araneosa HTCC2155]
          Length = 333

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 32/214 (14%), Positives = 72/214 (33%), Gaps = 36/214 (16%)

Query: 166 SQTDARLDMMIVLDVSRSMESFFDSS-----ITKIDMAIKSINAMLEEVKLIPDVNNVVQ 220
           ++T A  D+++ +D+S SME+    +     +T++D   + ++  L E           +
Sbjct: 87  TKTIASRDLLLAVDLSGSMETKDFKNKSGENVTRLDSVKEVLSEFLAE-------REGDR 139

Query: 221 SGLVTFSNKIEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQ 278
            GLV F +           +   Q  +    +   G  T                 G+  
Sbjct: 140 VGLVFFGSAAFIQMPFTEDLEICQELMDEAQVRMAGPQTMLGDA-----------IGLSI 188

Query: 279 HCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR------- 331
               +     K+++ +TDG +               A+ +G +++ + +           
Sbjct: 189 SIFDQSELEDKVLILLTDGNDTG--SLVAPEKAAQIARDKGIVIHTVAVGDPAAAGEQAL 246

Query: 332 SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGK 363
               LR+ +  +   +Y   N   +   +  I K
Sbjct: 247 DEATLRSISSLTKGKYYWAGNREELAGIYDEIDK 280


>gi|119599629|gb|EAW79223.1| hCG1743181 [Homo sapiens]
          Length = 1211

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 41/263 (15%), Positives = 91/263 (34%), Gaps = 28/263 (10%)

Query: 109 DIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQT 168
           +    T L+ +     E Y     +   +     TF+    N     + + S      ++
Sbjct: 321 EGTSDTQLEKIASHPAEQYVSKLKTFADLAAHNQTFLKKLRNQITHTVSVFSERTETLKS 380

Query: 169 DARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
               D+ +++D S S ++             +    + E V +     + V+ G V +++
Sbjct: 381 ----DIYLLIDGSGSTQATDFH---------EMKTFLSEVVGMFNIAPHKVRVGAVQYAD 427

Query: 229 KIEEFF--LLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
             +  F          L + I+ + + G +TN+   L +  + +      +      +  
Sbjct: 428 SWDLEFEINKYSNKQDLGKAIENIRQMGGNTNTGAALNFTLSLL-----QKAKKQRGNKV 482

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPN-SF 345
              ++V        +       L   N  ++    VYAIGI    +   LR  A      
Sbjct: 483 PCHLVVL------TNGMSKDSILEPANRLREEHIRVYAIGI-KEANQTQLREIAGEEKRV 535

Query: 346 YLVENPHSMYDAFSHIGKDIVTK 368
           Y V +  ++ D  + + ++I T+
Sbjct: 536 YYVHDFDALKDIRNQVVQEICTE 558



 Score = 77.6 bits (189), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 48/334 (14%), Positives = 107/334 (32%), Gaps = 30/334 (8%)

Query: 44  FFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGF 103
           F  ++ + + ID+  +    Q    G+  +              N           +   
Sbjct: 657 FMSQSDISNAIDQ--MAHIGQTTLTGSALSFVSQYFSPTKGARPNIRKFLILITDGEAQD 714

Query: 104 VNDIDDIVRSTSLDIVVVPQNEGYSIS----AISRYKIPLKFCTFIPWYTNSRHIVMPIT 159
           +     +V      I+      G +++       R ++      F         +V  I 
Sbjct: 715 IVKEPAVVLRQEGVIIYSVGVFGSNVTQLEEISGRPEMVFYVENFDILQRIEDDLVFGI- 773

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSI--TKIDMAIKSINAMLEEVKLIPDVNN 217
            S +   +    LD++ V+D S S++    + +    I +  K+               N
Sbjct: 774 CSPREECKRIEVLDVVFVIDSSGSIDYDEYNIMKDFMIGLVKKA-----------DVGKN 822

Query: 218 VVQSGLVTFSNKIEEFFL--LEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQG 275
            V+ G + +++  E  F          +   ++     G ST +   L +      D   
Sbjct: 823 QVRFGALKYADDPEVLFYLDDFGTKLEVISVLQNDQAMGGSTYTAEALGF-----SDHMF 877

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF 335
                +  +    ++++ +TDGE+    +  +        + +G +V A+GI      E 
Sbjct: 878 TEARGSRLNKGVPQVLIVITDGESH---DADKLNATAKALRDKGILVLAVGIDGANPVEL 934

Query: 336 LRACASPNSFYLVENPHSMYDAFSHIGKDIVTKR 369
           L    S + ++ VE    +   FS +   +    
Sbjct: 935 LAMAGSSDKYFFVETFGGLKGIFSDVTASVCNSS 968



 Score = 68.7 bits (166), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 25/193 (12%), Positives = 65/193 (33%), Gaps = 21/193 (10%)

Query: 171  RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
            ++D++ ++D S S++              K    +   V+      N V+ G   FS+  
Sbjct: 993  KVDLVFLMDGSTSIQPNDF---------KKMKEFLASVVQDFDVSLNRVRIGAAQFSDTY 1043

Query: 231  EEFFL--LEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
               F      G   +  +I+ + +   +T+          +  +        +  +    
Sbjct: 1044 HPEFPLGTFIGEKEISFQIENIKQIFGNTHIGAA-----LREVEHYFRPDMGSRINTGTP 1098

Query: 289  KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLV 348
            ++++ +TD      +   +        + RG  +Y++GI  +   + ++   +      V
Sbjct: 1099 QVLLVLTD-----GQSQDEVAQAAEALRHRGIDIYSVGIGDVDDQQLIQITGTAEKKLTV 1153

Query: 349  ENPHSMYDAFSHI 361
             N   +      I
Sbjct: 1154 HNFDELKKVNKRI 1166



 Score = 53.7 bits (127), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 39/298 (13%), Positives = 89/298 (29%), Gaps = 33/298 (11%)

Query: 57  SLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSL 116
             +     +             G D   +      +   +E  DN              +
Sbjct: 56  GSLQIGKALQEAHRTYFSAPANGRD-KKQFPPILVVLASSESEDNVEEASKALRKDGVKI 114

Query: 117 DIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIV-----------MPITSSVKVN 165
             V V +    ++ A++  +      T       S+++              +       
Sbjct: 115 ISVGVQKASEENLKAMATSQFHFNLRTVRDLSMFSQNMTHIIKDVIKYKEGAVDDIFVEA 174

Query: 166 SQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVT 225
            Q  +  D++ +LD+S       + S    D        + E V  +    N ++ GLV 
Sbjct: 175 CQGPSMADVVFLLDMS------INGSEENFDYLK---GFLEESVSALDIKENCMRVGLVA 225

Query: 226 FSNKIEEFFL--LEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           +SN+ +      +    S + + I+ LS       +      A  ++       ++ + +
Sbjct: 226 YSNETKVINSLSMGINKSEVLQHIQNLSPRTGKAYTGA----AIKKLRKEVFSARNGSRK 281

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACAS 341
           +    +I V +T         +          ++ G  ++ +GI      + L   AS
Sbjct: 282 NQGVPQIAVLVTH-----RDSEDNVTKAAVNLRREGVTIFTLGIEGTSDTQ-LEKIAS 333



 Score = 42.1 bits (97), Expect = 0.15,   Method: Composition-based stats.
 Identities = 24/155 (15%), Positives = 55/155 (35%), Gaps = 13/155 (8%)

Query: 204 AMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFL--LEWGVSHLQRKI-KYLSKFGVSTNST 260
            + + +  +P   +  +  L  +S+K+   F      G S +   + K     G S    
Sbjct: 2   FITKMISSLPIEADKYRVALAQYSDKLHSEFHLSTFKGRSPMLNHLRKNFGFIGGSLQIG 61

Query: 261 PGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGA 320
             L+ A+   F           +   +  I+V +      S++ +          +K G 
Sbjct: 62  KALQEAHRTYFSAPA----NGRDKKQFPPILVVLA-----SSESEDNVEEASKALRKDGV 112

Query: 321 IVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMY 355
            + ++G++   S E L+A A+    + +     + 
Sbjct: 113 KIISVGVQK-ASEENLKAMATSQFHFNLRTVRDLS 146


>gi|114563846|ref|YP_751360.1| von Willebrand factor, type A [Shewanella frigidimarina NCIMB 400]
 gi|114335139|gb|ABI72521.1| von Willebrand factor, type A [Shewanella frigidimarina NCIMB 400]
          Length = 334

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 29/218 (13%), Positives = 64/218 (29%), Gaps = 38/218 (17%)

Query: 170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229
              D+MI +D+S SM+             +     +   +    +     + GL+ F++ 
Sbjct: 81  KGRDLMIAVDLSGSMQIEDMVING---QTVNRFTLIQHVLSDFIERRKGDRLGLILFADH 137

Query: 230 IEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287
                 L      +   +    +   G  T     +  A  +   +              
Sbjct: 138 AYLQAPLTLDRRSVATFLDDAQIGLVGKQTAIGEAIALAVKRFDKVDESN---------- 187

Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV------------------ 329
            ++++ +TDG N +   + +       A KR   +Y IG+                    
Sbjct: 188 -RVLILLTDGSNNAGNIEPEV--AAQIAAKRNITIYTIGVGAEILERRTIFGKERINPSM 244

Query: 330 IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
               + L+  A  +   ++   N   +   +  I K  
Sbjct: 245 DLDEDQLKKLAAMTKGRYFRARNSEELASIYQEIDKLE 282


>gi|77459433|ref|YP_348940.1| von Willebrand factor, type A [Pseudomonas fluorescens Pf0-1]
 gi|77383436|gb|ABA74949.1| putative exported protein [Pseudomonas fluorescens Pf0-1]
          Length = 359

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 30/220 (13%), Positives = 68/220 (30%), Gaps = 45/220 (20%)

Query: 171 RLDMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+++ +DVS SM+          ++++ +    +   LE         +  + GL+ F
Sbjct: 89  GRDLLVAVDVSGSMDFPDMQWNDEDVSRLSLVQHLLGDFLES-------RDGDRVGLILF 141

Query: 227 SNKIEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
            ++      L +    ++  +    +   G +T     +  A                  
Sbjct: 142 GSQAYLQAPLTFDRRTVRVWLDEARIGIAGKNTAIGDAIGLALK-----------RLRMR 190

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR------------- 331
               ++++ +TDG N   + D   L     A   G  +Y IGI                 
Sbjct: 191 PAQSRVLILVTDGANNGGEID--PLTAAKLAASEGVKIYPIGIGADPEESGATALLGGNP 248

Query: 332 ----SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                   L+A A  +   ++   +   +      + +  
Sbjct: 249 TLDLDEPALKAIAEVTGGRYFRARDGKQLQAIKDTLDQLE 288


>gi|152990152|ref|YP_001355874.1| von Willebrand factor A [Nitratiruptor sp. SB155-2]
 gi|151422013|dbj|BAF69517.1| von Willebrand factor type A domain protein [Nitratiruptor sp.
           SB155-2]
          Length = 305

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 36/207 (17%), Positives = 66/207 (31%), Gaps = 22/207 (10%)

Query: 168 TDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFS 227
                D+++ +D S SM+          D      + +   VK           G+V F 
Sbjct: 79  KKKGYDIVLAIDASGSMQEKGFDPT---DPQKTKFDVVRSLVKAFISKRRNDNIGVVIFG 135

Query: 228 NKIEEFFLLEWGVSHLQRKIKYLSK--FGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDA 285
           +       L +    +++ + YL     G  T                         E  
Sbjct: 136 SFAYIASPLTFNKEAVKKILDYLDIGVAGSKTAIDDA-----------LIESVRLLKESQ 184

Query: 286 NYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV--IRSHEFLRACASPN 343
              KI++ +TDG + ++K           AKK G  +Y IGI         FLR  A   
Sbjct: 185 AKSKIVILLTDGIDTASKTPPDV--AVKMAKKYGVKIYTIGIGDKRGIDEAFLRWLAQQG 242

Query: 344 S--FYLVENPHSMYDAFSHIGKDIVTK 368
              ++  ++   +   +  I +   ++
Sbjct: 243 HGYYFYAKDASMLRKIYDEINRLEPSE 269


>gi|166713250|ref|ZP_02244457.1| hypothetical protein Xoryp_17865 [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 335

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 30/222 (13%), Positives = 68/222 (30%), Gaps = 45/222 (20%)

Query: 169 DARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
                MM+ +D+S SM           + ++  A   ++  L       D  +  + GL+
Sbjct: 96  REARQMMLAVDLSGSMNEPDMVLGGKVVDRLTAAKAVLSDFL-------DRRDGDRVGLL 148

Query: 225 TFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            F  +      L   ++ ++ +++   +   G  T                  +      
Sbjct: 149 VFGQRAYALTPLTADLTSVRDQLRDSVVGLAGRETAIGDA-----------IALSVKRLR 197

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGI--------------- 327
           E    ++++V +TDG N +       L     AK  G  ++ I                 
Sbjct: 198 EQKQGQRVVVLLTDGVNTAG--VLDPLKAAELAKAEGVRIHTIAFGGGGGYSLFGVPIPA 255

Query: 328 --RVIRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                   + LR  A  +   F+   +   +   ++ + +  
Sbjct: 256 GGNDDIDEDGLRKIAQQTGGRFFRARDTEELAGIYAELDRLE 297


>gi|58580793|ref|YP_199809.1| hypothetical protein XOO1170 [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|58425387|gb|AAW74424.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
          Length = 335

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 30/222 (13%), Positives = 68/222 (30%), Gaps = 45/222 (20%)

Query: 169 DARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
                MM+ +D+S SM           + ++  A   ++  L       D  +  + GL+
Sbjct: 96  REARQMMLAVDLSGSMNEPDMVLGGKVVDRLTAAKAVLSDFL-------DRRDGDRVGLL 148

Query: 225 TFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            F  +      L   ++ ++ +++   +   G  T                  +      
Sbjct: 149 VFGQRAYALTPLTADLTSVRDQLRDSVVGLAGRETAIGDA-----------IALSVKRLR 197

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGI--------------- 327
           E    ++++V +TDG N +       L     AK  G  ++ I                 
Sbjct: 198 EQKQGQRVVVLLTDGVNTAG--VLDPLKAAELAKAEGVRIHTIAFGGGGGYSLFGVPIPA 255

Query: 328 --RVIRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                   + LR  A  +   F+   +   +   ++ + +  
Sbjct: 256 GGNDDIDEDGLRKIAQQTGGRFFRARDTEELAGIYAELDRLE 297


>gi|148548919|ref|YP_001269021.1| von Willebrand factor, type A [Pseudomonas putida F1]
 gi|148512977|gb|ABQ79837.1| von Willebrand factor, type A [Pseudomonas putida F1]
          Length = 358

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 31/220 (14%), Positives = 70/220 (31%), Gaps = 45/220 (20%)

Query: 171 RLDMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+++ +DVS SM+          I+++D+    +   L++           + GL+ F
Sbjct: 89  GRDLLVAVDVSGSMDFPDMQWKNEDISRLDLVKALMGDFLQD-------REGDRVGLILF 141

Query: 227 SNKIEEFFLLEWGVSHLQRKI--KYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
            ++      L +    ++  +    +   G +T     +  A                E 
Sbjct: 142 GSQAYLQAPLTFDRRTVRTFLIEAQIGIAGKNTAIGDAIGLAVK-----------RLRER 190

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV--------------- 329
               +++V +TDG N   +     L     A + G  +Y IGI                 
Sbjct: 191 PAQSRVLVLITDGANNGGQIH--PLTAARLAAQEGVRIYTIGIGANPEASGTPGLLGLNP 248

Query: 330 --IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                   L+  A  +  +++   +   +      + +  
Sbjct: 249 SLDLDEAALKEIADITHGAYFRAHDGAELDAIGDTLDQLE 288


>gi|26988754|ref|NP_744179.1| von Willebrand factor type A domain-containing protein [Pseudomonas
           putida KT2440]
 gi|24983548|gb|AAN67643.1|AE016394_4 von Willebrand factor type A domain protein [Pseudomonas putida
           KT2440]
 gi|313499848|gb|ADR61214.1| Von Willebrand factor type A domain-containing protein [Pseudomonas
           putida BIRD-1]
          Length = 358

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 31/220 (14%), Positives = 70/220 (31%), Gaps = 45/220 (20%)

Query: 171 RLDMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+++ +DVS SM+          I+++D+    +   L++           + GL+ F
Sbjct: 89  GRDLLVAVDVSGSMDFPDMQWQNEDISRLDLVKALMGDFLQD-------REGDRVGLILF 141

Query: 227 SNKIEEFFLLEWGVSHLQRKI--KYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
            ++      L +    ++  +    +   G +T     +  A                E 
Sbjct: 142 GSQAYLQAPLTFDRRTVRTFLIEAQIGIAGKNTAIGDAIGLAVK-----------RLRER 190

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV--------------- 329
               +++V +TDG N   +     L     A + G  +Y IGI                 
Sbjct: 191 PAQSRVLVLITDGANNGGQIH--PLTAARLAAQEGVRIYTIGIGANPEASGTPGLLGLNP 248

Query: 330 --IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                   L+  A  +  +++   +   +      + +  
Sbjct: 249 SLDLDEAALKEIADITHGAYFRAHDGAELDAIGDTLDQLE 288


>gi|21228580|ref|NP_634502.1| putative chloride channel [Methanosarcina mazei Go1]
 gi|20907073|gb|AAM32174.1| putative chloride channel [Methanosarcina mazei Go1]
          Length = 1004

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 46/311 (14%), Positives = 94/311 (30%), Gaps = 36/311 (11%)

Query: 79  GGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDI-VVVPQNEGYSISAISRYKI 137
                  + N  N +      +    N     +   +  I +   +    ++S +   K 
Sbjct: 207 TKKSFSLVGNYNNPNLLTVDAEVKSENVPITGLNKDNFTIEIGSKKVNDVTVSDVGEGKY 266

Query: 138 PLKF------------CTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSME 185
            L F                  Y         + +        +A  ++M+V+D S SM 
Sbjct: 267 KLSFNPPKQDSNGNYDLNVYVKYKKVTLSDSELNAVRYGEDNANANANVMLVIDRSGSMS 326

Query: 186 SFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQR 245
                  + I  A  S N  ++ ++       V  S    +   +          + +++
Sbjct: 327 G------SPISSAKNSANLFIDYMEAEDMAGVVSFSSSARYDYHLATLTPEV--KNSIKQ 378

Query: 246 KIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKED 305
           KI  +   GV T    G++Y               N  D N    IV ++DG   S +  
Sbjct: 379 KINSIYASGV-TAIGSGMRYGL---------NDLLNYGDPNNPWAIVLLSDGYQNSGENP 428

Query: 306 QQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGK 363
              +      K     VY +G+      + L   A  +   +Y       + + ++ I  
Sbjct: 429 NNVI---PSIKASNIQVYTVGLGPAVDQKLLGNIADQTGGKYYYSPTDSQLQEIYNDIVG 485

Query: 364 DIVTKRIWYDK 374
            I+  +  + +
Sbjct: 486 KIIGWKTVFKR 496


>gi|2811055|sp|O07395|Y335_MYCAV RecName: Full=UPF0353 protein MAV335
 gi|2183263|gb|AAC46199.1| MAV335 [Mycobacterium avium]
          Length = 335

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 35/260 (13%), Positives = 73/260 (28%), Gaps = 29/260 (11%)

Query: 130 SAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFD 189
           S   +     +    I    +     + +            R  +M+V+DVS+SM +   
Sbjct: 55  SVAPKRPSTWRHLPAILLVASLVLFTIAMAGPTNDVRIPRNRAVVMLVIDVSQSMRATD- 113

Query: 190 SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKY 249
            +  ++  A ++     +E+    +       GL+ ++                +  +  
Sbjct: 114 VAPNRMAAAQEAAKQFADELTPGIN------LGLIAYAGTATVLVSPTTNREATKNALDK 167

Query: 250 LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSL 309
           L  F   T +  G+  A                 D      IV  +DG+           
Sbjct: 168 LQ-FADRTATGEGIFTALQVQAIATVGAVIA--GDKPPPARIVLFSDGKETMPTNPDNPK 224

Query: 310 ---YYCNEAKKRGAIVYAIGIRVIR--------------SHEFLRACA--SPNSFYLVEN 350
                   AK +G  +  I                      E L+  A  S  + Y   +
Sbjct: 225 GAFTAARTAKDQGVPISTISFGTPYGFVEINDQRQPVPVDDETLKKVAQLSGGNAYNARS 284

Query: 351 PHSMYDAFSHIGKDIVTKRI 370
              +   ++ + + I  + I
Sbjct: 285 LQELKSVYATLQQQIGYETI 304


>gi|54025448|ref|YP_119690.1| hypothetical protein nfa34780 [Nocardia farcinica IFM 10152]
 gi|81374389|sp|Q5YU15|Y3478_NOCFA RecName: Full=UPF0353 protein NFA_34780
 gi|54016956|dbj|BAD58326.1| hypothetical protein [Nocardia farcinica IFM 10152]
          Length = 335

 Score =  101 bits (250), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 39/268 (14%), Positives = 79/268 (29%), Gaps = 39/268 (14%)

Query: 130 SAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFD 189
                   PL+             + +       V      R  +++V+DVS SME+   
Sbjct: 47  KVAPSRPSPLRHAPIALMLVGLVFLTIAAAGPTSVQKVPRNRATVVLVMDVSLSMEATD- 105

Query: 190 SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKY 249
              +++++A ++    ++ +    +       G VTF+               ++  I  
Sbjct: 106 VPPSRLEVAQQAGKEFVDGLTQGIN------LGFVTFAGTASVMQSPTTNREAVKAAIDN 159

Query: 250 LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKE----- 304
           +      T +  G+  A   I     +       +      IV M+DG+     +     
Sbjct: 160 IKLAER-TATGEGILTALQSIET---LATVLGGAETPPPARIVLMSDGKQTVPDDKDVDN 215

Query: 305 DQQSLYYCNEAKKRGAIVYAIGIRV---------------------IRSHEFLRACA--S 341
            + +      AK +G  V  I                            +E LR  A  S
Sbjct: 216 PRHAFTAARLAKSKGIPVSTISFGTEWGSVEIPDQDGQGGSQRVKVPVDNESLREIAKLS 275

Query: 342 PNSFYLVENPHSMYDAFSHIGKDIVTKR 369
              FY   +   +   +  + + I  + 
Sbjct: 276 GGEFYTASSLEELTAVYDTLEEQIGYET 303


>gi|223936327|ref|ZP_03628239.1| von Willebrand factor type A [bacterium Ellin514]
 gi|223894845|gb|EEF61294.1| von Willebrand factor type A [bacterium Ellin514]
          Length = 338

 Score =  101 bits (250), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 38/227 (16%), Positives = 74/227 (32%), Gaps = 43/227 (18%)

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
            +D+++ LD+S SM +  +  +     A +      + +K   D     + GLV F  + 
Sbjct: 87  GVDIVVALDMSGSMLAEDEGFVLNGQQATR-FIIARDVLKKFVDKRQSDRIGLVVFGTQA 145

Query: 231 EEFFLLEWGVSHLQRKIKYL---SKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287
                       L + ++ L   S  G  T                     +   E  + 
Sbjct: 146 YVAVPPTLDHEFLLKNLERLGIGSINGNQTAIGSA-----------LSTSMNRLRELKSK 194

Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV------------------ 329
            KII+ MTDG+N + K     L     A+  G  +Y IG+                    
Sbjct: 195 SKIIILMTDGQNNAGKVP--PLTAAEAARALGIKIYTIGVGTKGVARMAVGTDPFSGQKI 252

Query: 330 ------IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                       L + +  +   +Y  ++  ++   ++ I +   T+
Sbjct: 253 YQQVPVDIDEGTLTSISKMTNAKYYRADSTATLEKIYADIDRLEKTE 299


>gi|297560911|ref|YP_003679885.1| von Willebrand factor type A [Nocardiopsis dassonvillei subsp.
           dassonvillei DSM 43111]
 gi|296845359|gb|ADH67379.1| von Willebrand factor type A [Nocardiopsis dassonvillei subsp.
           dassonvillei DSM 43111]
          Length = 315

 Score =  101 bits (250), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 48/243 (19%), Positives = 81/243 (33%), Gaps = 35/243 (14%)

Query: 145 IPWYTNSRHIVMPITSSVKVNS---QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKS 201
           +P    +  I + I S         Q   R  +M+ +DVS SM +       +++ A KS
Sbjct: 56  VPAVLFTVTIGVLIASMALPAMPVQQPRERATIMVAVDVSLSMAANDID-PNRLEAAKKS 114

Query: 202 INAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTP 261
               +E +       +    GLV FS+              +   I+ L   G  T    
Sbjct: 115 AQGFVETL------PDRFNVGLVAFSSTATVVSSPTHDHQAVIGSIENLQ-LGPGTAIGE 167

Query: 262 GLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAI 321
           G+  +   I                    IV ++DGEN S ++  Q++     A ++   
Sbjct: 168 GVFASLESISSFDEDADV-----DPPPSAIVLLSDGENTSGRDISQAVAM---AAEQEVP 219

Query: 322 VYAIGIRV--------------IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
           V  I                      E LR  A  +   FY  E+   + + +  IG  +
Sbjct: 220 VSTIAFGTGAAMIEIDGYQVPADIDKEALRGLASDTGGHFYEAESETELDEVYEDIGSSL 279

Query: 366 VTK 368
            T+
Sbjct: 280 GTE 282


>gi|41407305|ref|NP_960141.1| hypothetical protein MAP1207 [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|118463234|ref|YP_882479.1| hypothetical protein MAV_3297 [Mycobacterium avium 104]
 gi|81414471|sp|Q740Y5|Y1207_MYCPA RecName: Full=UPF0353 protein MAP_1207
 gi|41395657|gb|AAS03524.1| hypothetical protein MAP_1207 [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|118164521|gb|ABK65418.1| protein Nfa34780 [Mycobacterium avium 104]
          Length = 335

 Score =  101 bits (250), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 36/260 (13%), Positives = 75/260 (28%), Gaps = 30/260 (11%)

Query: 130 SAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFD 189
           S   +     +    I    +     + +            R  +M+V+DVS+SM +   
Sbjct: 55  SVAPKRPSTWRHLPAILLVASLVLFTIAMAGPTNDVRIPRNRAVVMLVIDVSQSMRATD- 113

Query: 190 SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKY 249
            +  ++  A ++     +E+    +       GL+ ++                +  +  
Sbjct: 114 VAPNRMAAAQEAAKQFADELTPGIN------LGLIAYAGTATVLVSPTTNREATKNALDK 167

Query: 250 LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSL 309
           L  F   T +  G+  A   I  +          D      IV  +DG+           
Sbjct: 168 LQ-FADRTATGEGIFTALQAIATV---GAVIGGGDKPPPARIVLFSDGKETMPTNPDNPK 223

Query: 310 ---YYCNEAKKRGAIVYAIGIRVIR--------------SHEFLRACA--SPNSFYLVEN 350
                   AK +G  +  I                      E L+  A  S  + Y   +
Sbjct: 224 GAFTAARTAKDQGVPISTISFGTPYGFVEINDQRQPVPVDDETLKKVAQLSGGNAYNAAS 283

Query: 351 PHSMYDAFSHIGKDIVTKRI 370
              +   ++ + + I  + I
Sbjct: 284 LQELKSVYATLQQQIGYETI 303


>gi|330973664|gb|EGH73730.1| von Willebrand factor, type A [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 352

 Score =  101 bits (250), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 31/220 (14%), Positives = 69/220 (31%), Gaps = 45/220 (20%)

Query: 171 RLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+++ +DVS SM+          ++++ +  + +   LE            + GL+ F
Sbjct: 89  GRDLLVAVDVSGSMDYPDMQWKSDEVSRLVLVQQLLGDFLEG-------RKGDRVGLILF 141

Query: 227 SNKIEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
             +      L +    ++  +    +   G +T     +  A                  
Sbjct: 142 GTQAFVQAPLTYDRRTVRVWLDEARIGIAGKNTALGDAIGLALK-----------RLRMR 190

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHE---------- 334
               + +V +TDG N + + D   +     A + G  +YAIGI      +          
Sbjct: 191 PATSRALVLVTDGANNAGQID--PVTAARLAAEEGVKIYAIGIGSDPDKDALQSVLGLNP 248

Query: 335 -------FLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                   L+  A  S   ++   +   +    + +    
Sbjct: 249 SLDLDEPTLKEIASLSGGQYFRARDGDQLEKIRATLDALE 288


>gi|66044963|ref|YP_234804.1| von Willebrand factor, type A [Pseudomonas syringae pv. syringae
           B728a]
 gi|63255670|gb|AAY36766.1| von Willebrand factor, type A [Pseudomonas syringae pv. syringae
           B728a]
          Length = 352

 Score =  101 bits (250), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 31/220 (14%), Positives = 69/220 (31%), Gaps = 45/220 (20%)

Query: 171 RLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+++ +DVS SM+          ++++ +  + +   LE            + GL+ F
Sbjct: 89  GRDLLVAVDVSGSMDYPDMQWKSDEVSRLVLVQQLLGDFLEG-------RKGDRVGLILF 141

Query: 227 SNKIEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
             +      L +    ++  +    +   G +T     +  A                  
Sbjct: 142 GTQAFVQAPLTYDRRTVRVWLDEARIGIAGKNTALGDAIGLALK-----------RLRMR 190

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHE---------- 334
               + +V +TDG N + + D   +     A + G  +YAIGI      +          
Sbjct: 191 PATSRALVLVTDGANNAGQID--PVTAARLAAEEGVKIYAIGIGSDPDKDALQSVLGLNP 248

Query: 335 -------FLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                   L+  A  S   ++   +   +    + +    
Sbjct: 249 SLDLDEPTLKEIASLSGGQYFRARDGDQLEKIRATLDALE 288


>gi|327541056|gb|EGF27607.1| von Willebrand factor type A [Rhodopirellula baltica WH47]
          Length = 497

 Score =  101 bits (250), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 51/421 (12%), Positives = 103/421 (24%), Gaps = 65/421 (15%)

Query: 14  NYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNN 73
           + +GG+T+L A  LP++ L+    I ++ +  +KT L    D +          E     
Sbjct: 81  SRRGGITVLMAFVLPMLALLAAFCINLAQMQLVKTELAIATDAAARAGGRAFSEEQTVEA 140

Query: 74  RKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDI---VVVPQNEGYSIS 130
            K                     +   N F   +       +       V   +   ++ 
Sbjct: 141 AKAAARLTAAMNEVAGEPYQLNTDDSANEFEFGVSAQTDGNTGRFYFTKVPTSDVAANLV 200

Query: 131 AISRYKIPLKFCTFIPW----YTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMES 186
           A+S  +I  K           +       +   S V   +      D+ +VLD S SM+ 
Sbjct: 201 AVSSVRINGKRTDDSLLGPVPFIFPNTFSIGDFSPVASATAMQVDRDISLVLDRSGSMDW 260

Query: 187 FFDSSITK--------IDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEW 238
                           +  A  +    LE          + +       ++ + +     
Sbjct: 261 KTYDWPDDADPWGEDSLISAEDAGIVDLEWKYRNGQPQYIRRVSYNRGYDEYDLYDHAWE 320

Query: 239 ---------------------------GVSHLQRKIKYLSKFGVST-------------- 257
                                        +    ++   S     T              
Sbjct: 321 EVFGLGPAPNTPWEDLVLAVDAFLRVLDQTPQNEQVSIASYNSHGTLDCWLLDDFDSVRA 380

Query: 258 ---NSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNE 314
                 P          +                K +V MTDG +    +          
Sbjct: 381 AVAQLGPNGSTGIGNGMNSGKTAFTHENARPYASKTMVVMTDGNHNYGTQPNTVAQ--QL 438

Query: 315 AKKRGAIVYAIGIRVIRSHEFLRACA-SP-NSFYLVENPHSMYDAFSHIGKDIVTKRIWY 372
                  +  +        E ++  A +     Y  ++   +  AF  I  ++ T  I  
Sbjct: 439 MSSSNLNIQTVTFGGGADQETMQEVAVTGLGRHYHADSGDELVSAFEEIANNLPT--ILT 496

Query: 373 D 373
           +
Sbjct: 497 N 497


>gi|284046349|ref|YP_003396689.1| von Willebrand factor A [Conexibacter woesei DSM 14684]
 gi|283950570|gb|ADB53314.1| von Willebrand factor type A [Conexibacter woesei DSM 14684]
          Length = 319

 Score =  101 bits (250), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 31/220 (14%), Positives = 70/220 (31%), Gaps = 38/220 (17%)

Query: 170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229
            R  + +V DVS SM +       ++  A ++    ++EV    +       G+++F+N 
Sbjct: 84  ERASIALVTDVSGSMLATD-VQPNRMIAAKRAARRFVDEVPRTVN------LGVISFNNT 136

Query: 230 IEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
                      S +   I  L      T +   +  A   + +  G              
Sbjct: 137 ATVLQSPTRNRSDVLTAIDRL-AVSGGTATGEAIATATEMLRNQPGE------NGRRPPS 189

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR------------------ 331
            IV ++DG + + ++    +    EA++    +Y +     +                  
Sbjct: 190 AIVLISDGTSTNGRD---PIEAAAEARRLRIPIYTVAFGTDQGTITVPGRDGVERTERVP 246

Query: 332 -SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                L   A  +    +  ++   +   F  +G  + T+
Sbjct: 247 PDPTALAQIAEMTGGETFTADSADRLDTVFERLGSQLGTR 286


>gi|83647467|ref|YP_435902.1| von Willebrand factor type A (vWA) domain-containing protein
           [Hahella chejuensis KCTC 2396]
 gi|83635510|gb|ABC31477.1| uncharacterized protein containing a von Willebrand factor type A
           (vWA) domain [Hahella chejuensis KCTC 2396]
          Length = 345

 Score =  101 bits (250), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 29/222 (13%), Positives = 68/222 (30%), Gaps = 46/222 (20%)

Query: 170 ARLDMMIVLDVSRSMESFF----DSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVT 225
              D+++ +D+S SM+        +  T++D+    +   ++       V    + GL+ 
Sbjct: 92  EARDLLLAVDISPSMQETDLQLKGNQATRLDVVKSVVTDFIQ-------VRQGDRLGLIL 144

Query: 226 FSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           F  +      L + +  +   +    L   G +T     +                   E
Sbjct: 145 FGAQPYIQAPLTYDLVTVGELLNEATLGIAGNATAIGDAIGLGIK-----------RLRE 193

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR------------ 331
                +++V +TDG N   +   +       A   G  +Y +G+                
Sbjct: 194 RPADSRVLVLLTDGANTGGEVSPE--QAAKLAADAGIKIYTVGVGADEIIRRGIFGYRKE 251

Query: 332 ------SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                     L++ A  +   ++   N   +   +  I +  
Sbjct: 252 NPSADLDETLLQSIADETDGQYFRARNTGELELIYESINQLE 293


>gi|226943994|ref|YP_002799067.1| von Willebrand factor, type A (VWA) domain-containing protein
           [Azotobacter vinelandii DJ]
 gi|226718921|gb|ACO78092.1| von Willebrand factor, type A (VWA) domain protein [Azotobacter
           vinelandii DJ]
          Length = 335

 Score =  101 bits (250), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 30/220 (13%), Positives = 69/220 (31%), Gaps = 45/220 (20%)

Query: 171 RLDMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+++ +DVS SME         SI ++++    +   +E+           + GL+ F
Sbjct: 89  GRDLLLAVDVSGSMEYADMHWQGESIGRLELVKHLLGQFIED-------RRGDRVGLILF 141

Query: 227 SNKIEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
            ++      L +    ++  ++   +   G  T     +                   + 
Sbjct: 142 GSQAYLQAPLTFDRRTVRTWLEEAAIGIAGKDTAIGDAIGLGLK-----------RLRQR 190

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR------------- 331
               ++++ +TDG N + +           A   G  ++ IGI                 
Sbjct: 191 PAQSRVLILVTDGANTAGEIAPSV--AARLAAAEGVRIHTIGIGADPRQDGPPGLLGLTP 248

Query: 332 ----SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                   LRA A  +  S++   +   +      + +  
Sbjct: 249 GLDLDEPTLRAIAEETGGSYFRARSSEELRAIEETLARLE 288


>gi|87121300|ref|ZP_01077190.1| batB protein, putative [Marinomonas sp. MED121]
 gi|86163457|gb|EAQ64732.1| batB protein, putative [Marinomonas sp. MED121]
          Length = 333

 Score =  101 bits (250), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 35/232 (15%), Positives = 82/232 (35%), Gaps = 46/232 (19%)

Query: 162 VKVNSQTDARLDMMIVLDVSRSMESFFDSSIT----KIDMAIKSINAMLEEVKLIPDVNN 217
            +  S T +  D++I LD+S SM++           ++D A + +N  + E         
Sbjct: 81  GEPKSVTPSGRDLLIALDLSGSMQTADMKINQQAANRLDAAKQVLNRFITE-------RQ 133

Query: 218 VVQSGLVTFSNKIEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQG 275
             + G++ F +K      L + +  + + +    +   G +T     +     ++ ++  
Sbjct: 134 GDRIGIIVFGSKAYLQAPLSYDLDTIAQLVNETQIGFAGENTAIGDAIGLGIKRLANIDA 193

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR------- 328
                       K++++ MTDG N + +           A K+G  ++ IGI        
Sbjct: 194 D-----------KRVMILMTDGANTAGRVKPD--QAAQFAAKQGVKIHTIGIGAEQMVSQ 240

Query: 329 -----------VIRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVT 367
                           E L+  A  +   ++  ++   +   ++ +     T
Sbjct: 241 GFFGPRVINPSTDLDEELLQKVADLTQGQYFRAKSTQELASIYATLDALEPT 292


>gi|152993961|ref|YP_001359682.1| von Willebrand factor type A domain-containing protein [Sulfurovum
           sp. NBC37-1]
 gi|151425822|dbj|BAF73325.1| von Willebrand factor type A domain protein [Sulfurovum sp.
           NBC37-1]
          Length = 325

 Score =  100 bits (249), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 44/252 (17%), Positives = 84/252 (33%), Gaps = 37/252 (14%)

Query: 129 ISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFF 188
           +S ISR     KF  FI +      +  P     +  ++  ++ +++I +D+S SM +  
Sbjct: 51  VSGISRATKGEKFLLFILYVLVLSALAKP-NLIGEPVTKDVSQRELLISVDLSGSMMTKD 109

Query: 189 DSSI-----TKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHL 243
             +       +++     +   L+E           + GL+ F N           +  L
Sbjct: 110 FVNKEGKAIDRLEAVKMVLRDFLKE-------RKGEKIGLILFGNAAFVQAPFTQDLDAL 162

Query: 244 QRKIKYLSKFGVS--TNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLS 301
           +  +  L        T     +  A                E     ++++ M+DG++  
Sbjct: 163 EHLLDSLRVGMAGPQTAMGDSIGLAVKM-----------FRESNVTDRMLIVMSDGDDTG 211

Query: 302 TKEDQQSLYYCNEAKKRGAIVYAIGIRVI-------RSHEFLRACA--SPNSFYLVENPH 352
           +K           A K G  V+ IGI             + L+  A  +   FY   N  
Sbjct: 212 SKVP--PKTSAELAAKNGVNVFTIGIGDPKNAGEHPIDTDTLKEIAAITGGKFYYAWNLD 269

Query: 353 SMYDAFSHIGKD 364
            + D +  I K 
Sbjct: 270 DLQDIYKQIDKL 281


>gi|120554865|ref|YP_959216.1| von Willebrand factor, type A [Marinobacter aquaeolei VT8]
 gi|120324714|gb|ABM19029.1| von Willebrand factor, type A [Marinobacter aquaeolei VT8]
          Length = 339

 Score =  100 bits (249), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 32/222 (14%), Positives = 71/222 (31%), Gaps = 46/222 (20%)

Query: 170 ARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVT 225
              D+M+V+D+S SM+         SI ++    + ++  +++           + GL+ 
Sbjct: 87  TGRDLMLVVDISPSMDEQDMVLQGRSINRLQAVKRVLDDFIDQ-------REGDRLGLIL 139

Query: 226 FSNKIEEFFLLEWGVSHLQRKI--KYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           F  +      L +    ++  +    L   G +T                 G+      E
Sbjct: 140 FGTEPYVQAPLTFDRETVRTLLFEAGLGMAGRATAIGDA-----------IGLSVKRLRE 188

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR------------ 331
               +++++ +TDG N + +           A+  G  +Y IGI                
Sbjct: 189 RPQEQRVVILLTDGANTAGQVSPD--KATEIAQAAGVRLYTIGIGADTMIQRGLLGSRRV 246

Query: 332 ------SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                   E L   A  +   ++   +   +   +  I +  
Sbjct: 247 NPSRDLDEELLTRMAEQTGGRYFRARSLPELEMIYDSINQLE 288


>gi|330810109|ref|YP_004354571.1| hypothetical protein PSEBR_a3255 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327378217|gb|AEA69567.1| Conserved hypothetical protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 359

 Score =  100 bits (249), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 29/220 (13%), Positives = 70/220 (31%), Gaps = 45/220 (20%)

Query: 171 RLDMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+++ +DVS SM+          ++++ +    +   LE            + GL+ F
Sbjct: 89  GRDLLVAVDVSGSMDFPDMQWKDEEVSRLALVQHMLGDFLEG-------REGDRVGLILF 141

Query: 227 SNKIEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
            ++      L +    ++  +    +   G +T     +  A                + 
Sbjct: 142 GSQAYLQAPLTFDRRTVRHWLDEARIGIAGKNTAIGDAIGLALK-----------RLRQR 190

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV--------------- 329
             + ++++ +TDG N   + D   L     A   G  +Y IGI                 
Sbjct: 191 PAHSRVLILVTDGANNGGEID--PLTAARLAADEGVKIYPIGIGAAPEQSGTTGSLGVNP 248

Query: 330 --IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                   L+  A  +   ++  ++   +    + + +  
Sbjct: 249 SLDLDEPTLKEIAEVTGGQYFRAQDGEQLLGIKTTLDQLE 288


>gi|325922265|ref|ZP_08184046.1| Mg-chelatase subunit ChlD [Xanthomonas gardneri ATCC 19865]
 gi|325547218|gb|EGD18291.1| Mg-chelatase subunit ChlD [Xanthomonas gardneri ATCC 19865]
          Length = 335

 Score =  100 bits (249), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 32/222 (14%), Positives = 66/222 (29%), Gaps = 45/222 (20%)

Query: 169 DARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
                MM+ +D+S SM         S + ++  A   ++  L       D     + GL+
Sbjct: 96  REARQMMLAVDLSGSMSEPDMVLGGSVVDRLTAAKAVLSDFL-------DRREGDRVGLL 148

Query: 225 TFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            F  +      L   ++ ++ ++    +   G  T                  +      
Sbjct: 149 VFGQRAYALTPLTADLTSVRDQLADSVVGLAGRETAIGDA-----------IALSVKRLR 197

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR-------------- 328
           E    ++++V +TDG N +       L     AK  G  V+ I                 
Sbjct: 198 EQKQGQRVVVLLTDGVNTAG--VLNPLKAAELAKAEGVRVHTIAFGGSGGYSLFGVPIPA 255

Query: 329 ---VIRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                     LR  A  +   F+   +   +   ++ + +  
Sbjct: 256 GGNDDIDEAGLRKIAEQTGGRFFRARDTEELAGIYAELDRLE 297


>gi|109897980|ref|YP_661235.1| von Willebrand factor, type A [Pseudoalteromonas atlantica T6c]
 gi|109700261|gb|ABG40181.1| von Willebrand factor, type A [Pseudoalteromonas atlantica T6c]
          Length = 343

 Score =  100 bits (249), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 28/218 (12%), Positives = 66/218 (30%), Gaps = 38/218 (17%)

Query: 170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229
              D+MI +D+S SM+        +    +  +  +   +          + GL+ F++ 
Sbjct: 85  EGRDLMIAVDLSGSMKIDDMQVNGRQ---VDRLQMIKSVLHDFIQRRIGDRLGLIFFADT 141

Query: 230 IEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287
                 L +    + + +    +   G  T     +  A                     
Sbjct: 142 AYLQAPLTYDRETVSQLLNESLIGLVGEQTAIGDAIGLAIK-----------RFKSKEES 190

Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR---------------- 331
            K+++ +TDG+N +     +       A   G  +Y IG+   +                
Sbjct: 191 NKVLILLTDGQNTAGNITPE--QANELAINNGVTLYTIGVGADQMLVQSIFGSRQVNPSQ 248

Query: 332 --SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                 L   A  +   ++   +  S+ + +S + +  
Sbjct: 249 ELDEGMLTTLAESTGGRYFRARDAQSLTEIYSKLDELE 286


>gi|103487755|ref|YP_617316.1| hypothetical protein Sala_2274 [Sphingopyxis alaskensis RB2256]
 gi|98977832|gb|ABF53983.1| hypothetical protein Sala_2274 [Sphingopyxis alaskensis RB2256]
          Length = 666

 Score =  100 bits (249), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 24/225 (10%), Positives = 71/225 (31%), Gaps = 29/225 (12%)

Query: 9   RNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNE 68
           ++   + +G   +LTA  +  +   +G  +++   +  +  L    D  ++     +   
Sbjct: 14  KSLISDQRGNAFMLTAAAIIPVIGFVGSAVDIGRAYMTQLRLQQACDAGVLAGRRAM--- 70

Query: 69  GNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYS 128
                                +N +F         +      + ++              
Sbjct: 71  -----GGASYDEAAQAEANKMFNFNFPEAKYGATGILFSSRALNASD------------- 112

Query: 129 ISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSM-ESF 187
           +   +   +P +      +        +    + K+       +D+M+VLDV+ SM ++ 
Sbjct: 113 VEGQASAVLPTELM----FMFGKEEFRLSADCTAKLEISN---VDVMLVLDVTGSMAQTN 165

Query: 188 FDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
              S+ +I     +     + +      +  ++ G+V +S+    
Sbjct: 166 AGDSVNRITALKDATMDFFDTLTNADVGDGRLRFGVVPYSSTANV 210



 Score = 74.5 bits (181), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 31/219 (14%), Positives = 63/219 (28%), Gaps = 32/219 (14%)

Query: 180 VSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWG 239
            S S     +   +  D      +      +             V  +  ++   +    
Sbjct: 450 PSSSDPMTVNVFNS--DGTRNITSDTSSNGRWQRYSKYWGSGWGVCPAAAMKLTTMTASD 507

Query: 240 VSHLQRKIKYLSKFGVSTNSTPGLKYA--YNQIFDMQGMRQHCNTEDANYKKIIVFMTDG 297
            +     ++ L   G  T    G+ +         +          D    + IVFMTDG
Sbjct: 508 RATFNTYVQSLQPLG-GTYHDAGMVWGARLLSPTGLFADENATAPNDRPISRHIVFMTDG 566

Query: 298 E--------------------------NLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR 331
                                      +L  + + +    C  A++RG  ++ +   V  
Sbjct: 567 AMAPNMGNLTFQGYEFLMHRVGGTSDSDLRDRHNNRFTQLCRAARQRGITIWVVSFGVGS 626

Query: 332 SHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           + + L  CAS    +  +N   + + F  I + I   R+
Sbjct: 627 N-DSLNNCASSGQAFEADNAAELNEQFQAIARQISKLRL 664


>gi|315126124|ref|YP_004068127.1| von Willebrand factor type A [Pseudoalteromonas sp. SM9913]
 gi|315014638|gb|ADT67976.1| von Willebrand factor type A [Pseudoalteromonas sp. SM9913]
          Length = 327

 Score =  100 bits (249), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 31/221 (14%), Positives = 70/221 (31%), Gaps = 44/221 (19%)

Query: 169 DARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           +   D+M+ +D+S SM           + ++ M    ++  +E+           + GL+
Sbjct: 84  NEGRDIMLAVDLSGSMTEQDMAYNGQYVDRLTMVKAVLSDFIEQ-------RQGDRLGLI 136

Query: 225 TFSNKIEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            F +       L   V  + + +    +   G +T                 G+      
Sbjct: 137 LFGDTAFLQTPLTRDVKTVSKMLSEAQIGLVGRATAIGDA-----------LGLSVKRFA 185

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR----------- 331
                 +I+V +TDG+N +             A++ G  VY IG+               
Sbjct: 186 SKKESNRIVVLLTDGQNTAGN--LNPEDALLLAREEGIKVYTIGVGSDNPRGFSLFNMGS 243

Query: 332 -----SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                    L+  A  +   ++  ++   +   ++ + K  
Sbjct: 244 GGSNLDEGLLKKIAEQTGGLYFRAKDVAGLQQIYAELDKLE 284


>gi|110598614|ref|ZP_01386881.1| von Willebrand factor, type A [Chlorobium ferrooxidans DSM 13031]
 gi|110339783|gb|EAT58291.1| von Willebrand factor, type A [Chlorobium ferrooxidans DSM 13031]
          Length = 336

 Score =  100 bits (249), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 42/238 (17%), Positives = 80/238 (33%), Gaps = 43/238 (18%)

Query: 154 IVMPITSSVKVNSQTDA-RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLI 212
             +     V   ++ +A  +D+M+ LD+S SM     S  +++D A +     +      
Sbjct: 80  FALAGPRMVVRQTEAEARGIDVMLALDISESMLQKDGSGKSRLDAAREVARKFVLR---- 135

Query: 213 PDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGV---STNSTPGLKYAYNQ 269
               +  + GLV F  K      L      L   I ++S   +    T     +  A   
Sbjct: 136 ---RSSDRIGLVVFRGKGYTQCPLTIDHDVLAMLIDHISPQVIQDEGTAIGSAILIAT-- 190

Query: 270 IFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAI--GI 327
                    +      + +K+I+ +TDGEN +   D         A + G  +Y +  G 
Sbjct: 191 ---------NRFKGSTSLQKVIILITDGENNTG--DVGPATAATLAAQNGIRIYVVNAGF 239

Query: 328 RVIR---------------SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
           +                      LR  A  +   ++  E+P  + +    IG+    +
Sbjct: 240 KSGGSAGNLSAESSAHAAMDEASLRGIARTTGGGYFRAEDPSVLDNTIKTIGRLETAR 297


>gi|296170658|ref|ZP_06852233.1| von Willebrand factor [Mycobacterium parascrofulaceum ATCC BAA-614]
 gi|295894647|gb|EFG74381.1| von Willebrand factor [Mycobacterium parascrofulaceum ATCC BAA-614]
          Length = 335

 Score =  100 bits (249), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 37/245 (15%), Positives = 73/245 (29%), Gaps = 30/245 (12%)

Query: 145 IPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINA 204
           I    +   + + +            R  +M+V+DVS+SM +       ++  A ++   
Sbjct: 70  ILLVASLVLLTIAMAGPTNDVRIPRNRAVVMLVIDVSQSMRATD-VQPNRMAAAQEAAKQ 128

Query: 205 MLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLK 264
             +E+    +       GL+ ++                +R +  L  F   T +  G+ 
Sbjct: 129 FADELTPGIN------LGLIAYAGTATVLVSPTTNRDSTKRALDKLQ-FADRTATGEGIF 181

Query: 265 YAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSL---YYCNEAKKRGAI 321
            A   I  +          DA     IV  +DG+                   AK +G  
Sbjct: 182 TALQAIATV---GAVIGGGDAPPPARIVLFSDGKETMPTNPDNPKGAFTAARTAKDQGVP 238

Query: 322 VYAIGIRVIR--------------SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
           +  I                      E L+  A  S  + Y       +   ++ + + I
Sbjct: 239 ISTISFGTPYGFVEINDQRQPVPVDDETLKKVAQLSGGNAYNAATLQELKSVYATLQQQI 298

Query: 366 VTKRI 370
             + I
Sbjct: 299 GYETI 303


>gi|307825379|ref|ZP_07655598.1| von Willebrand factor type A [Methylobacter tundripaludum SV96]
 gi|307733554|gb|EFO04412.1| von Willebrand factor type A [Methylobacter tundripaludum SV96]
          Length = 326

 Score =  100 bits (248), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 33/229 (14%), Positives = 69/229 (30%), Gaps = 46/229 (20%)

Query: 167 QTDARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSG 222
           Q  +  D+M+ +D+S SME         S+ ++  A       +       +     + G
Sbjct: 84  QAVSGRDLMLAVDLSGSMEEQDFVINKRSVDRLTAAKMVAADFI-------NRRVGDRVG 136

Query: 223 LVTFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHC 280
           L+ F  +      L +    +   +    +   G +T     +  A              
Sbjct: 137 LILFGTQAYLQTPLTFDRKTVMTLLNEAVIGLAGDNTAIGDAIGLAVK-----------R 185

Query: 281 NTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR--------- 331
              +    +++V MTDG N + +     L     A      +Y IGI             
Sbjct: 186 LKSEQVNSRVLVLMTDGANTAGE--VSPLKAAELAAANHLKIYTIGIGADEMIVRSFFGN 243

Query: 332 ---------SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKR 369
                      + L   A  +   +Y   N   + + +  + +    ++
Sbjct: 244 RKINPSVDLDEKTLIKIAESTGGQYYRARNTDELNNIYMRLDELEPVEK 292


>gi|240137370|ref|YP_002961839.1| hypothetical protein MexAM1_META1p0632 [Methylobacterium extorquens
           AM1]
 gi|240007336|gb|ACS38562.1| Conserved hypothetical protein containing a von Willebrand factor
           type A (vWA) domain; putative membrane protein
           [Methylobacterium extorquens AM1]
          Length = 339

 Score =  100 bits (248), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 41/237 (17%), Positives = 84/237 (35%), Gaps = 35/237 (14%)

Query: 152 RHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLE 207
             +V+P T+      +      +++ LD+S SME    S    +++++    +     + 
Sbjct: 84  PRLVLPATALPASARE------IVLALDLSGSMERKDFSLDGETVSRLAAVKRVGAEFIR 137

Query: 208 EVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKY 265
                       + GLV F+++        +  + + R ++   +   G ST    GL  
Sbjct: 138 R-------RAGDRIGLVEFADQAYVAAAPTFDTATVARTLEEATIGLVGRSTGIGDGLGL 190

Query: 266 AYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAI 325
           A  ++   Q           +  K++V ++DG N + +           AK  G  VY I
Sbjct: 191 ALKRLAPAQVAAADGAGPPPSRDKVVVLLSDGANNAGQT--APKDVAALAKDLGVRVYTI 248

Query: 326 GIR------VIRSH------EFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
            +          +       E LRA A  S    + V+    + +  + I +    +
Sbjct: 249 ALGPIDMADNPNNEQDVVDVETLRAMAETSGGRAFRVKTTDDLENVANAIDELEGGR 305


>gi|260425757|ref|ZP_05779737.1| conserved hypothetical protein [Citreicella sp. SE45]
 gi|260423697|gb|EEX16947.1| conserved hypothetical protein [Citreicella sp. SE45]
          Length = 479

 Score =  100 bits (248), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 54/458 (11%), Positives = 131/458 (28%), Gaps = 92/458 (20%)

Query: 3   SLNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAA 62
           +L    R F  +  G MT +  +   ++ +  G+ I++ +    +T + + +DR+++ AA
Sbjct: 22  ALATRARRFAGDESGSMTYMAVVLSMMMMIFGGLGIDMIYAELQRTKVQNTLDRAVLAAA 81

Query: 63  ------------TQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDI 110
                          M++    +       D     +      ++    +   +  +D++
Sbjct: 82  DLDNELEAQGVVEDYMDKMALADALISVDVDEGLNYRTVVAEGYKTMPSNFMQILGVDNL 141

Query: 111 VRSTSLDIVVVPQNEGYSISAISRYKIP------------LKFCTFIPWYTNSRHIVMPI 158
                 +          S+       +               F   +    N   + + +
Sbjct: 142 QAYGLAEATERINKVEVSLVLDISGSMDDNDKLANMQDAAGTFIDTLLAEGNEDLVSISL 201

Query: 159 TSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNV 218
               +  +     L   +  +         +   +    A    +   E+++      + 
Sbjct: 202 VPYSEQVNAGPEILS-YLSANWKHGYSHCIEMPNSVFGSAALDFSRTYEQMQHYQWNYDG 260

Query: 219 VQSGL---VTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAY-------- 267
             + L   V      E         S L+ ++  L      T+   G+K+          
Sbjct: 261 YNNTLSDTVCPRYGYERIQAWSHDASALKAQVNQLQPR-AGTSIFMGMKWGTALLDPSTR 319

Query: 268 --------NQIFDMQGMRQHCNTEDANYKKIIVFMTDGE--------NLSTKEDQQSL-- 309
                       D     +    +D +  K +V MTDG+        + +   + +    
Sbjct: 320 PIASGMIARGSVDQVFEGRPVAYDDTDVLKTVVLMTDGQHDRSYRIQDWAYNSESEYAHW 379

Query: 310 ------------------------------------YYCNEAKKRGAIVYAIGIRV-IRS 332
                                                 C  AK +G I++++G  V    
Sbjct: 380 NRYNLWYYLSRYVSSYERSSFYYQKYNADLGDALLGSICAAAKAQGIIIWSVGFEVGDHG 439

Query: 333 HEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
            + + +CAS  + +       + +AFS I   +   R+
Sbjct: 440 ADVMESCASSPAHFFRVEGVEITEAFSTIAHTLNQLRL 477


>gi|254819550|ref|ZP_05224551.1| hypothetical protein MintA_06484 [Mycobacterium intracellulare ATCC
           13950]
          Length = 335

 Score =  100 bits (248), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 35/245 (14%), Positives = 71/245 (28%), Gaps = 30/245 (12%)

Query: 145 IPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINA 204
           I    +     + +            R  +M+V+DVS+SM +       ++  A ++   
Sbjct: 70  ILLVASLVLFTIAMAGPTNDVRIPRNRAVVMLVIDVSQSMRATD-VQPNRMAAAQEAAKQ 128

Query: 205 MLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLK 264
             +E+    +       GL+ ++                +  +  L  F   T +  G+ 
Sbjct: 129 FADELTPGIN------LGLIAYAGTATVLVSPTTNRDSTKAALDKLQ-FADRTATGEGIF 181

Query: 265 YAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSL---YYCNEAKKRGAI 321
            A   I  +          D      IV  +DG+                   AK +G  
Sbjct: 182 TALQAIATV---GAVIGGGDKPPPARIVLFSDGKETMPTNPDNPKGAFTAARTAKDQGVP 238

Query: 322 VYAIGIRVIR--------------SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
           +  I                      E L+  A  S  + Y   +   +   ++ + + I
Sbjct: 239 ISTISFGTPYGFVEINDQRQPVPVDDETLKKVAQLSGGNAYNAASLQELKAVYATLQQQI 298

Query: 366 VTKRI 370
             + I
Sbjct: 299 GYETI 303


>gi|84386025|ref|ZP_00989055.1| von Willebrand factor type A domain protein [Vibrio splendidus
           12B01]
 gi|84379341|gb|EAP96194.1| von Willebrand factor type A domain protein [Vibrio splendidus
           12B01]
          Length = 345

 Score =  100 bits (248), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 31/218 (14%), Positives = 74/218 (33%), Gaps = 36/218 (16%)

Query: 167 QTDARLDMMIVLDVSRSMESFFD-----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQS 221
           Q  +  ++M+ LD+S SM          +   ++ +A + +     +           + 
Sbjct: 89  QKKSAREIMVALDLSGSMSEEDFADKKGNKHDRLTIAKQVLREFAAQ-------REHDRL 141

Query: 222 GLVTFSNKIEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQH 279
           GL+ F++           ++  Q  ++   L   G  T                 G+   
Sbjct: 142 GLILFADSAYVQAPFTEDINVWQSLLEDVELGYAGFKTAFGDA-----------IGLSIA 190

Query: 280 CNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR-------S 332
              ++ + +++++ +TDG++ S+K     +     A K G  +Y I I            
Sbjct: 191 VFEQEQSRQRVMILLTDGDDTSSKMP--PVKAAEIAAKYGVKIYTIAIGDPSTKGRYKMD 248

Query: 333 HEFLRAC--ASPNSFYLVENPHSMYDAFSHIGKDIVTK 368
              L     A+    +   +   +  A++ I +    +
Sbjct: 249 LPTLEKVSAATGGQMFHAMDRKQLDQAYATIDQLEQQE 286


>gi|84385834|ref|ZP_00988864.1| hypothetical protein V12B01_12445 [Vibrio splendidus 12B01]
 gi|84379150|gb|EAP96003.1| hypothetical protein V12B01_12445 [Vibrio splendidus 12B01]
          Length = 359

 Score =  100 bits (248), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 31/227 (13%), Positives = 71/227 (31%), Gaps = 28/227 (12%)

Query: 162 VKVNSQTDARLDMMIVLDVSRSMESFFD-----SSITKIDMAIKSINAMLEEVKLIPDVN 216
            +   +     D+M+V+D+S SM            I+++D   + +              
Sbjct: 91  GEPQVREQLGRDVMVVVDLSGSMAEQDFTSKRGDKISRLDATKEVLADFATT-------R 143

Query: 217 NVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQ 274
              + GL+ F +                  +    ++  G ST+    +  A       +
Sbjct: 144 KGDRLGLILFGDAAFVQTPFTADQDVWLELLNQTDVAMAGQSTHLGDAIGLAIKVFEQSE 203

Query: 275 GMRQHCNTEDANYK---KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR 331
                      +     K+++ +TDG +       + +     AK +G  ++ I +   +
Sbjct: 204 KQSAAVQDSSVDANEKEKVVIVLTDGNDTG--SFVEPIDAAKVAKAKGVRIHVIAMGDPQ 261

Query: 332 -------SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKR 369
                    E ++  A  S    +   N   +  A++ IG+      
Sbjct: 262 TVGEVALDMETIKRVAQESGGEAFEALNRDELTKAYAQIGELEPQLY 308


>gi|291399639|ref|XP_002716220.1| PREDICTED: collagen, type VI, alpha 6 [Oryctolagus cuniculus]
          Length = 2273

 Score =  100 bits (248), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 38/272 (13%), Positives = 89/272 (32%), Gaps = 28/272 (10%)

Query: 109 DIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQT 168
           +   +T L+ +     E Y     +   +     TF+    N     + + +      ++
Sbjct: 367 EGASATQLEKIASHPAEQYVSKLPTFSDLAAHNQTFVKKLRNQITHTVSVLAERTETLKS 426

Query: 169 D----ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
                   D+ +++D S S ++             +    + E   +     + V+ G V
Sbjct: 427 GCVDTEEADIYLLIDGSGSTQATDF---------QEMKTFLSEVASMFHIGPHKVRVGAV 477

Query: 225 TFSNKIEEFFLL--EWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +++  +  F +        L R I+ + + G  TN+   L +    +   +        
Sbjct: 478 QYASSWDLEFEIGKYSNKHDLGRAIENIRQLGGDTNTGAALNFTLRLLQKAKQQ-----R 532

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
            +     ++V        +       L      ++    VYAIG+    +   LR  A  
Sbjct: 533 GNKVPCHLVVL------TNGMSKDSILEPAKRLREENIRVYAIGV-KEANQTQLREIAGD 585

Query: 343 N-SFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
               Y V +  ++ D  + + ++I  +    D
Sbjct: 586 EKRVYYVHDFDALKDIRNQVVQEICAEEACKD 617



 Score = 79.9 bits (195), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 31/252 (12%), Positives = 76/252 (30%), Gaps = 21/252 (8%)

Query: 118  IVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIV 177
             V +       + A++       F             V     +         ++D++ +
Sbjct: 944  AVGIAGANPVELLAMAGSSDKYFFVETFGGLQGIFSDVSASVCNSSKVDCEIEKVDLVFL 1003

Query: 178  LDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFL-- 235
            +D S S++              K    +   V+      N VQ G   FS+  +  F   
Sbjct: 1004 MDGSNSIDPSDF---------KKMKEFVASVVQDFDVSLNRVQIGAAQFSHTYQPEFPLG 1054

Query: 236  LEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMT 295
                   +   I+ + +    T+                      +  +    ++++ +T
Sbjct: 1055 TFTDEKEVSFHIENIQQIFGYTHIGAA-----LHQVGRYFQPDMGSRINTGTPQVLLVLT 1109

Query: 296  DGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMY 355
            D      +   +      E +  G  +Y++GI  +   + ++   + +    V+N   + 
Sbjct: 1110 D-----GQSQDEVAQAAEELRHNGVDIYSVGIGNVDHQQLIQITGTADKKLTVDNFDELK 1164

Query: 356  DAFSHIGKDIVT 367
                 I ++I T
Sbjct: 1165 KIKKRIVRNICT 1176



 Score = 79.5 bits (194), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 43/332 (12%), Positives = 102/332 (30%), Gaps = 26/332 (7%)

Query: 44  FFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGF 103
           F  ++ + + IDR      T +         +              + +   +    +  
Sbjct: 678 FMSQSDISNAIDRMAHIGETTLTGGALTFVSQYFSPAKGARPNVRKFLILITDGEAQDVV 737

Query: 104 VNDIDDIVRSTSLDIVVVPQNEGYS--ISAISRYKIPLKFCTFIPWYTNSRHIVMPITSS 161
                 + +   +   V       +       R ++      F         +V  I  S
Sbjct: 738 KEPAVALRQEGVIIYSVGVFGSNVTQLEEISGRPEMVFYVENFDILQRIEDDLVFGI-CS 796

Query: 162 VKVNSQTDARLDMMIVLDVSRSMESFFDSSI--TKIDMAIKSINAMLEEVKLIPDVNNVV 219
            +   +    LD++ V+D S S++    + +    I +  K+                 V
Sbjct: 797 PREECKRIEVLDVVFVIDSSGSIDYDEYNIMKDFMIGLVKKA-----------DVGKAQV 845

Query: 220 QSGLVTFSNKIEEFFL--LEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + G + +++  E  F          +   ++     G +T +   L +      D     
Sbjct: 846 RFGALKYADDPEVLFYLGDLDTKMEVISMLQNDQPMGGNTYTAEALAF-----SDHMFTE 900

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
              +       ++++ +TDGE+    + ++        + +G +V A+GI      E L 
Sbjct: 901 ARGSRLHKGVPQVLIVITDGESH---DAEKLNGTTKALRDKGILVLAVGIAGANPVELLA 957

Query: 338 ACASPNSFYLVENPHSMYDAFSHIGKDIVTKR 369
              S + ++ VE    +   FS +   +    
Sbjct: 958 MAGSSDKYFFVETFGGLQGIFSDVSASVCNSS 989



 Score = 48.7 bits (114), Expect = 0.002,   Method: Composition-based stats.
 Identities = 36/226 (15%), Positives = 78/226 (34%), Gaps = 32/226 (14%)

Query: 129 ISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARL-----------DMMIV 177
           + A++  +      T     T S ++   I  +V+        +           D++ +
Sbjct: 173 VKAMATSQFHFSLRTVRDLSTFSHNVTQAIRDAVQYRDAAVDDILVEVCQGPSVADVVFL 232

Query: 178 LDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLE 237
           LDV        + S+   D        + E V  +    + ++ GLV +SN+ E    L 
Sbjct: 233 LDV------AVNGSLEDFDHLK---GFLQESVSALDIKESCMRVGLVAYSNETEVIGSLS 283

Query: 238 W--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMT 295
                S +  +I+ LS       +      A  +I       +  + ++    +I+V +T
Sbjct: 284 EGVNRSAVLHRIQSLSPGAGEAYTGA----ALRKIRKEVFGARGGSRKNQGVPQIVVLVT 339

Query: 296 DGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACAS 341
                    +          +++G  V+ +G+    + + L   AS
Sbjct: 340 H-----RASEDNVTRAAVNLRRQGVTVFTLGVEGASATQ-LEKIAS 379



 Score = 43.7 bits (101), Expect = 0.051,   Method: Composition-based stats.
 Identities = 22/197 (11%), Positives = 63/197 (31%), Gaps = 22/197 (11%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D++ ++D S          I            + + +  +P   +  +  L  +S+++  
Sbjct: 26  DVVFLVDSS------DHLGIKNFPFVK---AFLNKMITSLPIEASKFRVALAQYSDQLHS 76

Query: 233 FFL--LEWGVSHLQRKIK-YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
            F      G   +   +K  +   G S      L+ A+   F           +   +  
Sbjct: 77  EFELGTFKGKGPMLNHLKKNVEFLGGSLRVGNALREAHRTYF----SAAPNGRDKKEFPP 132

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVE 349
           ++V +   E      +          ++ G  + ++G++     +  +A A+    + + 
Sbjct: 133 VLVVLASAE-----SEDDVGAAAEALRRDGVRIISVGVQKAAEEDV-KAMATSQFHFSLR 186

Query: 350 NPHSMYDAFSHIGKDIV 366
               +     ++ + I 
Sbjct: 187 TVRDLSTFSHNVTQAIR 203


>gi|294508603|ref|YP_003572662.1| von Willebrand factor type A domain protein [Salinibacter ruber M8]
 gi|294344932|emb|CBH25710.1| von Willebrand factor type A domain protein [Salinibacter ruber M8]
          Length = 317

 Score =  100 bits (248), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 42/232 (18%), Positives = 81/232 (34%), Gaps = 48/232 (20%)

Query: 170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229
             +D+M+VLD S SM++      T+ + A ++  A +E            + GL+ F+ +
Sbjct: 77  EGIDIMMVLDASTSMQAEDF-QPTRFEAAREAAGAFVEG-------RVSDRVGLIVFAAE 128

Query: 230 IEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287
                 L    S LQR ++   +      T     L  A N              +    
Sbjct: 129 AYTQAPLTLDYSFLQRMLEDVEVGAVEDGTAVGTALATAVN-----------RLKDSEAE 177

Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRA--------- 338
            K+ + +TDG N   + D ++      A+  G  VYAIG+      +             
Sbjct: 178 SKVAILLTDGRNNRGQIDPRT--AAEVAQTMGVRVYAIGVGSSEDRDTWEEPLPQGQRDE 235

Query: 339 -------------CASPNSFYLVENPHSMYDAFSHIGKDIVT---KRIWYDK 374
                         ++   ++   N  ++   ++ I     T   +R++ D+
Sbjct: 236 SAGVDAEMLRSVSTSTGGQYFSATNRDALERIYAEIDTMEATPVDERVYTDR 287


>gi|311746225|ref|ZP_07720010.1| BatA protein [Algoriphagus sp. PR1]
 gi|126576455|gb|EAZ80733.1| BatA protein [Algoriphagus sp. PR1]
          Length = 347

 Score =  100 bits (248), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 38/263 (14%), Positives = 82/263 (31%), Gaps = 47/263 (17%)

Query: 137 IPLKFCTFIPWYTNSRHIVMPITSSVKVNSQT-DARLDMMIVLDVSRSMESFFDSSITKI 195
           + L    F         I +          +     +D+M+V+D+S SM+        ++
Sbjct: 71  LRLIPTGFFFLALIMVIIALARPQKSNERVEQFTEGIDIMLVMDISESMDLQDFK-PNRL 129

Query: 196 DMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGV 255
           + A  +    +       +     + G+V F+ +      L      L   I+ +S   +
Sbjct: 130 EAAKATAIDFI-------NGRFGDRIGMVVFAGEAYSLAPLTNDYKLLTDLIQDISFNMM 182

Query: 256 ---STNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYC 312
               T     +  A N++            E  +  K+++ ++DGE+ +   D   L+  
Sbjct: 183 EAKGTAIGSAIASATNRM-----------KESESASKVLILLSDGESNAGNVD--PLFAA 229

Query: 313 NEAKKRGAIVYAIGIRVIR-------------------SHEFLRACA--SPNSFYLVENP 351
             A      +Y I +                           LR  A      F+   + 
Sbjct: 230 QLASALDIKIYTIAVGKDGMVPYGTDFFGRPQMVESYLDETNLREIAKIGNGEFFRASDG 289

Query: 352 HSMYDAFSHIGKDIVTKRIWYDK 374
            ++ + F  I      + I  ++
Sbjct: 290 GTLNNIFDRIDTMEKAE-ILENR 311


>gi|157374763|ref|YP_001473363.1| von Willebrand factor, type A [Shewanella sediminis HAW-EB3]
 gi|157317137|gb|ABV36235.1| von Willebrand factor, type A [Shewanella sediminis HAW-EB3]
          Length = 330

 Score =   99 bits (247), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 36/218 (16%), Positives = 67/218 (30%), Gaps = 38/218 (17%)

Query: 170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229
              D+M+ +D+S SM+        K    +     +   V    +     + GL+ F++ 
Sbjct: 81  KGRDLMMAVDLSGSMQIEDMVLDGK---TVDRFTMIQAVVSDFIERRKGDKLGLILFADH 137

Query: 230 IEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287
                 L      + + +K   +   G  T     +  A  +   +              
Sbjct: 138 AYLQAPLTQDRRSVAQFLKEAQIGLVGKQTAIGEAIALAVKRFDRVDESN---------- 187

Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR---------------- 331
            +I+V +TDG N S     +       A KRG  +Y+IG+                    
Sbjct: 188 -RILVLLTDGSNNSGSISPE--QAAAIAAKRGVKIYSIGVGAEVMERRTLFGKERVNPSM 244

Query: 332 --SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                 L A A  +   ++   N   +   +  I K  
Sbjct: 245 DLDETQLTALAQTTGGLYFRARNAQELESIYQEIDKLE 282


>gi|77359908|ref|YP_339483.1| von Willebrand factor type A [Pseudoalteromonas haloplanktis
           TAC125]
 gi|76874819|emb|CAI86040.1| conserved protein of unknown function; putative Von Willebrand
           factor type A domain protein [Pseudoalteromonas
           haloplanktis TAC125]
          Length = 328

 Score =   99 bits (247), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 31/222 (13%), Positives = 69/222 (31%), Gaps = 45/222 (20%)

Query: 169 DARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           +   D+M+ +D+S SM           + ++ M    +   +E+           + GL+
Sbjct: 84  NEGRDIMLAVDLSGSMTEQDMAYNGQYVDRLTMVKAVLTDFIEQ-------RQGDRLGLI 136

Query: 225 TFSNKIEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            F +       L   V  + + +    +   G +T                 G+      
Sbjct: 137 LFGDTAFLQTPLTRDVKTVSKMLSEAQIGLVGRATAIGDA-----------LGLSVKRFA 185

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR----------- 331
                 +I+V +TDG+N +     +       A+  G  VY IG+               
Sbjct: 186 NKDKSNRIVVLLTDGQNTAGN--LKPEEALLLARDAGIKVYTIGVGSDNPRGFSLFNMGG 243

Query: 332 ------SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                     L+  A  +   ++  ++   +   ++ + K  
Sbjct: 244 MSGDTIDEGLLKRIAEQTGGLYFRAKDVAGLQQIYAELDKLE 285


>gi|118468162|ref|YP_887464.1| hypothetical protein MSMEG_3149 [Mycobacterium smegmatis str. MC2
           155]
 gi|118169449|gb|ABK70345.1| conserved hypothetical protein [Mycobacterium smegmatis str. MC2
           155]
          Length = 327

 Score =   99 bits (247), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 31/216 (14%), Positives = 66/216 (30%), Gaps = 30/216 (13%)

Query: 174 MMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEF 233
           +M+V+DVS+SM +    + +++  A ++     +++    +       GL+ ++      
Sbjct: 91  VMLVIDVSQSMRATD-VAPSRLVAAQEAAKQFADQLTPGIN------LGLIAYAGTATVL 143

Query: 234 FLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVF 293
                     +  +  L      T +  G+  A   I  +          D      IV 
Sbjct: 144 VQPTTNREATKNGLDKLQ-LADRTATGEGIFTALQAIATV---GAVIGGGDEPPPARIVL 199

Query: 294 MTDGENLSTKEDQQSL---YYCNEAKKRGAIVYAIGIRVIR--------------SHEFL 336
           M+DG+                   AK +G  +  +                      E L
Sbjct: 200 MSDGKETVPSNPDNPKGAFTAARTAKDQGVPISTVSFGTPYGYVEINDQRQPVPVDDEML 259

Query: 337 RACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
              A  S    +   +   +   F+ + + I  + I
Sbjct: 260 EKIAQLSGGDAFTASSLEQLKAVFTSLQQQIGYETI 295


>gi|329896848|ref|ZP_08271743.1| BatA [gamma proteobacterium IMCC3088]
 gi|328921553|gb|EGG28934.1| BatA [gamma proteobacterium IMCC3088]
          Length = 328

 Score =   99 bits (247), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 29/214 (13%), Positives = 65/214 (30%), Gaps = 36/214 (16%)

Query: 168 TDARLDMMIVLDVSRSMESFFD-----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSG 222
                D+M+ +D+S SME+            ++  A + +   +             + G
Sbjct: 90  EKTARDLMLAVDISGSMEATDFVDATGKQTDRLSAAKQVLKQFVAG-------REGDRLG 142

Query: 223 LVTFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHC 280
           L+ F +                  +    ++  G ST                 G+    
Sbjct: 143 LIVFGSAAYLQAPFTDDRETWLALLDESIVNMAGPSTALGDA-----------IGLSIAH 191

Query: 281 NTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR-------SH 333
             E     ++++ +TDG +  +K     L     AK  G  +Y + +             
Sbjct: 192 FRESKTKNRVLIVLTDGNDTGSKVP--PLDAAQVAKAEGVTIYTVAVGDPETVGEEALDL 249

Query: 334 EFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
           E L + A  +    +   +  ++ + +  I +  
Sbjct: 250 EVLDSIAQTTGGVSFNAADLKALQETYQRIDELE 283


>gi|218528855|ref|YP_002419671.1| von Willebrand factor type A [Methylobacterium chloromethanicum
           CM4]
 gi|254559548|ref|YP_003066643.1| hypothetical protein METDI1003 [Methylobacterium extorquens DM4]
 gi|218521158|gb|ACK81743.1| von Willebrand factor type A [Methylobacterium chloromethanicum
           CM4]
 gi|254266826|emb|CAX22625.1| Conserved hypothetical protein containing a von Willebrand factor
           type A (vWA) domain; putative membrane protein
           [Methylobacterium extorquens DM4]
          Length = 339

 Score =   99 bits (247), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 41/237 (17%), Positives = 83/237 (35%), Gaps = 35/237 (14%)

Query: 152 RHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLE 207
             +V+P T+      +      +++ LD+S SME    S    +++++    +     + 
Sbjct: 84  PRLVLPATALPASARE------IVLALDLSGSMERKDFSLDGETVSRLAAVKRVGAEFIR 137

Query: 208 EVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKY 265
                       + GLV F+++        +  + + R ++   +   G ST    GL  
Sbjct: 138 R-------RAGDRIGLVEFADQAYVAAAPTFDTATVARTLEEATIGLVGRSTGIGDGLGL 190

Query: 266 AYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAI 325
           A  ++   Q              K++V ++DG N + +           AK  G  VY I
Sbjct: 191 ALKRLAPAQVAAADGEGPPPARDKVVVLLSDGANNAGQT--APKDVAALAKDLGVRVYTI 248

Query: 326 GIR------VIRSH------EFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
            +          +       E LRA A  S    + V+    + +  + I +    +
Sbjct: 249 ALGPIDMADNPNNEQDVVDVETLRAMAETSGGRAFRVKTTDDLENVANAIDELEGGR 305


>gi|84515372|ref|ZP_01002734.1| hypothetical protein SKA53_01901 [Loktanella vestfoldensis SKA53]
 gi|84510655|gb|EAQ07110.1| hypothetical protein SKA53_01901 [Loktanella vestfoldensis SKA53]
          Length = 485

 Score =   99 bits (247), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 61/466 (13%), Positives = 120/466 (25%), Gaps = 107/466 (22%)

Query: 8   IRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAAT---- 63
           +  F  +  G + I+T + L  + ++ GM ++       +  L S+ DR+++ AA+    
Sbjct: 22  LHAFGRDEDGSVIIMTILLLVTMLIMGGMAVDFMRYEARRATLQSVSDRAVLAAASLNQT 81

Query: 64  ------------------------QIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELR 99
                                    +++ GN          D+         M       
Sbjct: 82  LDSRDVVEDYFAKAGFPNALVGAPIVVDNGNSRTVTVRSALDVNTFYLRLAGMDRLTAPA 141

Query: 100 DNGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPIT 159
            +     +  +  S  LDI    +     ++  +     + F   +    N   + + I 
Sbjct: 142 RSSATEGVGKVEISLVLDISGSMRFSNRFVNMQAAA---IAFAEEVLDPANGGTVSLTII 198

Query: 160 SSVKVNSQTDARLDMM---------IVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVK 210
                 +        M         +  D                       +       
Sbjct: 199 PYAGATNPGPEMFAFMGGVRYPDTLLAGDDGILGTEDDYFFPQVSSCVEMVGSDWSSAGL 258

Query: 211 LIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHL----------QRKIKYLSKFGVSTNST 260
                  V    +   +  + ++       S +          +  I  L      T + 
Sbjct: 259 PGAGRAQVPHFQVWDIARSVMDWGWCPQDRSSIQYAMATPAQARSFINGLRMH-DGTGTH 317

Query: 261 PGLKYAYNQIFDMQG------------------MRQHCNTEDANYKKIIVFMTDGE---- 298
             +KYA   +                         +    +D   KKIIV MTDG+    
Sbjct: 318 YAMKYALATLDPSSQPAFMHLSHPGRGLVPPQFANRPAAWDDPETKKIIVLMTDGDITQQ 377

Query: 299 -----------------------NLSTKEDQQS------LYYCNEAKK--RGAIVYAIGI 327
                                  +   +    +         C  A +  R   VY +  
Sbjct: 378 ERPRIAQQERDIDYIISRSINGRDNRGQFVDAATNVGRFEAICTLANQPARSVDVYTVAF 437

Query: 328 RVIRSHEF---LRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
            V  +      +R CAS  S +   +   + D FS I + I   R+
Sbjct: 438 EVQPNSAADLQMRNCASDPSMFFRTSGAELIDVFSGIAERITDLRL 483


>gi|119504633|ref|ZP_01626712.1| BatB protein, putative [marine gamma proteobacterium HTCC2080]
 gi|119459655|gb|EAW40751.1| BatB protein, putative [marine gamma proteobacterium HTCC2080]
          Length = 332

 Score =   99 bits (247), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 32/212 (15%), Positives = 71/212 (33%), Gaps = 30/212 (14%)

Query: 168 TDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFS 227
            ++  D+++ +D+S SM+         +   I ++ A+  +           + GL+ F 
Sbjct: 86  ANSGRDLLLAIDLSGSMQIEDMQIGNSLVSRITAVKAIAADF---ASRRTGDRVGLILFG 142

Query: 228 NKIEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDA 285
            +      L + V  +++ I+   L   G  T     L  A                E  
Sbjct: 143 TRAYVQAPLTFDVKTVKQFIEEAQLGFAGEDTAIGDALGLAVK-----------RLRERP 191

Query: 286 NYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR----------VIRSHEF 335
              ++++ +TDG++ +       +     A +    +Y IGI                  
Sbjct: 192 ADSRVLILLTDGQDTA--STVDPMEAAALASEMNVKIYTIGISRRLGTSSNSSGEVDEAL 249

Query: 336 LRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
           L A A  +   ++    P  + D +  + +  
Sbjct: 250 LTAIAQATGGRYFRARTPKELQDIYQVLDELE 281


>gi|159045656|ref|YP_001534450.1| von Willebrand factor type A domain-containing protein
           [Dinoroseobacter shibae DFL 12]
 gi|157913416|gb|ABV94849.1| von Willebrand factor type A domain protein [Dinoroseobacter shibae
           DFL 12]
          Length = 328

 Score =   99 bits (247), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 26/213 (12%), Positives = 68/213 (31%), Gaps = 32/213 (15%)

Query: 166 SQTDARLDMMIVLDVSRSMESFFDSSI-----TKIDMAIKSINAMLEEVKLIPDVNNVVQ 220
           + T A  D+++ +D+S SM+    ++       ++      + A + E           +
Sbjct: 89  TITSAARDLVLAVDISGSMDDRDMTAPDGTRLQRLQAVKDVVGAFVAE-------REGDR 141

Query: 221 SGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHC 280
             L+ F  K          +  +   +  +       N+  G                  
Sbjct: 142 ISLIVFGAKPFIQAPFTEDLDSVVELLNQVQTGMAGPNTAIGDAIGL---------AIRS 192

Query: 281 NTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR-------SH 333
             +    +++++ ++DG + +       +     A + G  +Y IG+             
Sbjct: 193 FEDSEIEERLLILLSDGADTA--STMTPINAAQIAAQEGITIYTIGVGNPDGSGEERLDP 250

Query: 334 EFLRACAS--PNSFYLVENPHSMYDAFSHIGKD 364
             L   A+    +FY  ++   + + ++ I   
Sbjct: 251 ATLEDIATRGGGAFYFADDVEGLSEIYAEIDAL 283


>gi|86145196|ref|ZP_01063527.1| hypothetical protein MED222_04745 [Vibrio sp. MED222]
 gi|85836773|gb|EAQ54893.1| hypothetical protein MED222_04745 [Vibrio sp. MED222]
          Length = 359

 Score =   99 bits (247), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 31/227 (13%), Positives = 72/227 (31%), Gaps = 28/227 (12%)

Query: 162 VKVNSQTDARLDMMIVLDVSRSMESFFD-----SSITKIDMAIKSINAMLEEVKLIPDVN 216
            +   +     D+M+V+D+S SM            I+++D   + +    +         
Sbjct: 91  GEPQVREQLGRDVMVVVDLSGSMAEQDFTSKQGDKISRLDATKEVLADFAKT-------R 143

Query: 217 NVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQ 274
              + GL+ F +                  +    ++  G ST+    +  A       +
Sbjct: 144 KGDRLGLILFGDAAFVQTPFTADQDVWLELLNQTDVAMAGQSTHLGDAIGLATKVFEQSE 203

Query: 275 GMRQHCNTEDANYK---KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR 331
                      +     K+++ +TDG +       + +     AK +G  ++ I +   +
Sbjct: 204 KQSAAVQDSSIDANVKEKVVIVLTDGNDTG--SFVEPIDAAKVAKAKGVRIHVIAMGDPQ 261

Query: 332 -------SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKR 369
                    E ++  A  S    +   N   +  A++ IG+      
Sbjct: 262 TVGEVALDMETIKRVAQESGGEAFEALNRDELTKAYAQIGELEPQLY 308


>gi|107102622|ref|ZP_01366540.1| hypothetical protein PaerPA_01003686 [Pseudomonas aeruginosa PACS2]
          Length = 340

 Score =   99 bits (247), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 30/220 (13%), Positives = 70/220 (31%), Gaps = 45/220 (20%)

Query: 171 RLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+++ +DVS SM+          I+++++  K     +E+           + GL+ F
Sbjct: 89  GRDLLLAVDVSGSMDYRDMRWQDDEISRLELIKKLFGDFIED-------RRGDRVGLILF 141

Query: 227 SNKIEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
            ++      L +    ++  +    +   G +T     +  A                + 
Sbjct: 142 GSQAYLQAPLTFDRHTVRVWLDEAQIGIAGKNTAIGDAIGLAVK-----------RLRQR 190

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR------------- 331
               +++V +TDG N   +   Q       A ++   +Y IGI                 
Sbjct: 191 PAESRVLVLITDGANTGGQIAPQI--AAQLAAEQQVKIYTIGIGADPQQGGVPGLFGFNP 248

Query: 332 ----SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                   LR  A  +   ++   +   +    + + +  
Sbjct: 249 GLDLDEPTLRGIAESTGGEYFRARSSAELESISATLDRLE 288


>gi|15598269|ref|NP_251763.1| hypothetical protein PA3073 [Pseudomonas aeruginosa PAO1]
 gi|9949180|gb|AAG06461.1|AE004731_9 hypothetical protein PA3073 [Pseudomonas aeruginosa PAO1]
          Length = 340

 Score =   99 bits (247), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 30/220 (13%), Positives = 70/220 (31%), Gaps = 45/220 (20%)

Query: 171 RLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+++ +DVS SM+          I+++++  K     +E+           + GL+ F
Sbjct: 89  GRDLLLAVDVSGSMDYRDMRWQDDEISRLELIKKLFGDFIED-------RRGDRVGLILF 141

Query: 227 SNKIEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
            ++      L +    ++  +    +   G +T     +  A                + 
Sbjct: 142 GSQAYLQAPLTFDRHTVRVWLDEAQIGIAGKNTAIGDAIGLAVK-----------RLRQR 190

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR------------- 331
               +++V +TDG N   +   Q       A ++   +Y IGI                 
Sbjct: 191 PAESRVLVLITDGANTGGQIAPQI--AAQLAAEQQVKIYTIGIGADPQQGGVPGLFGFNP 248

Query: 332 ----SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                   LR  A  +   ++   +   +    + + +  
Sbjct: 249 GLDLDEPTLRGIAESTGGEYFRARSSAELESISATLDRLE 288


>gi|254241773|ref|ZP_04935095.1| hypothetical protein PA2G_02484 [Pseudomonas aeruginosa 2192]
 gi|126195151|gb|EAZ59214.1| hypothetical protein PA2G_02484 [Pseudomonas aeruginosa 2192]
          Length = 340

 Score =   99 bits (247), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 30/220 (13%), Positives = 70/220 (31%), Gaps = 45/220 (20%)

Query: 171 RLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+++ +DVS SM+          I+++++  K     +E+           + GL+ F
Sbjct: 89  GRDLLLAVDVSGSMDYRDMRWQDDEISRLELIKKLFGDFIED-------RRGDRVGLILF 141

Query: 227 SNKIEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
            ++      L +    ++  +    +   G +T     +  A                + 
Sbjct: 142 GSQAYLQAPLTFDRHTVRVWLDEAQIGIAGKNTAIGDAIGLAVK-----------RLRQR 190

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR------------- 331
               +++V +TDG N   +   Q       A ++   +Y IGI                 
Sbjct: 191 PAESRVLVLITDGANTGGQIAPQI--AAQLAAEQQVKIYTIGIGADPQQGGVPGLFGFNP 248

Query: 332 ----SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                   LR  A  +   ++   +   +    + + +  
Sbjct: 249 GLDLDEPTLRGIAESTGGEYFRARSSAELESISATLDRLE 288


>gi|218890727|ref|YP_002439591.1| putative von Willebrand factor type A domain [Pseudomonas
           aeruginosa LESB58]
 gi|254236045|ref|ZP_04929368.1| hypothetical protein PACG_02002 [Pseudomonas aeruginosa C3719]
 gi|126167976|gb|EAZ53487.1| hypothetical protein PACG_02002 [Pseudomonas aeruginosa C3719]
 gi|218770950|emb|CAW26715.1| putative von Willebrand factor type A domain [Pseudomonas
           aeruginosa LESB58]
          Length = 340

 Score =   99 bits (247), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 30/220 (13%), Positives = 70/220 (31%), Gaps = 45/220 (20%)

Query: 171 RLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+++ +DVS SM+          I+++++  K     +E+           + GL+ F
Sbjct: 89  GRDLLLAVDVSGSMDYRDMRWQEDEISRLELIKKLFGDFIED-------RRGDRVGLILF 141

Query: 227 SNKIEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
            ++      L +    ++  +    +   G +T     +  A                + 
Sbjct: 142 GSQAYLQAPLTFDRHTVRVWLDEAQIGIAGKNTAIGDAIGLAVK-----------RLRQR 190

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR------------- 331
               +++V +TDG N   +   Q       A ++   +Y IGI                 
Sbjct: 191 PAESRVLVLITDGANTGGQIAPQI--AAQLAAEQQVKIYTIGIGADPQQGGVPGLFGFNP 248

Query: 332 ----SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                   LR  A  +   ++   +   +    + + +  
Sbjct: 249 GLDLDEPTLRGIAESTGGEYFRARSSAELESISATLDRLE 288


>gi|170720775|ref|YP_001748463.1| von Willebrand factor type A [Pseudomonas putida W619]
 gi|169758778|gb|ACA72094.1| von Willebrand factor type A [Pseudomonas putida W619]
          Length = 358

 Score =   99 bits (247), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 28/220 (12%), Positives = 69/220 (31%), Gaps = 45/220 (20%)

Query: 171 RLDMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+++ +DVS SM+          ++++D+    +   L++           + GL+ F
Sbjct: 89  GRDLLVAVDVSGSMDFPDMQWKDEEVSRLDLVKALLGDFLQD-------REGDRVGLILF 141

Query: 227 SNKIEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
            ++      L +    ++  +    +   G +T     +  A                + 
Sbjct: 142 GSQAYLQAPLTFDRRTVRTFLDEAQIGIAGKNTAIGDAIGLAVK-----------RLRQR 190

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV--------------- 329
               +++V +TDG N   +     L     A +    +Y IGI                 
Sbjct: 191 PAQSRVLVLITDGANNGGRIH--PLTAARLAAQEDVRIYTIGIGANPEASGTPGLLGLNP 248

Query: 330 --IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                   L+  A  +  +++   +   +      + +  
Sbjct: 249 SLDLDEASLKEIADLTHGAYFRAHDGAELDAIGDTLDQLE 288


>gi|326424188|ref|NP_762140.2| aerotolerance operon protein BatA [Vibrio vulnificus CMCP6]
 gi|319999572|gb|AAO07130.2| BatA (Bacteroides aerotolerance operon) [Vibrio vulnificus CMCP6]
          Length = 362

 Score =   99 bits (247), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 33/220 (15%), Positives = 71/220 (32%), Gaps = 30/220 (13%)

Query: 171 RLDMMIVLDVSRSMESFFDS-----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVT 225
             D+M+V+D+S SM     +      I+++D   + +    +            + GL+ 
Sbjct: 105 GRDVMVVVDLSGSMAEQDFTSASGAKISRLDATKEVLADFAKT-------RQGDRLGLIL 157

Query: 226 FSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           F +                  +    ++  G ST+    +  A       +  +      
Sbjct: 158 FGDAAFVQTPFTADQKVWLALLNQTDVAMAGQSTHLGDAIGLAIKVFEQSEPSQAAF--- 214

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR-------SHEFL 336
               +K+ + +TDG +       + +     AK +G  ++ I +             + +
Sbjct: 215 SKPRQKVAIVLTDGNDTG--SFVEPIDAAKVAKAKGVRIHVIAMGDPSTVGESALDLQTI 272

Query: 337 RACA--SPNSFYLVENPHSMYDAFSHIGKDIVT--KRIWY 372
              A  S    +   N   +  A+  IGK      + I Y
Sbjct: 273 ERIASESGGKAFQALNRDELASAYDDIGKLEPQLYQSITY 312


>gi|188580059|ref|YP_001923504.1| von Willebrand factor type A [Methylobacterium populi BJ001]
 gi|179343557|gb|ACB78969.1| von Willebrand factor type A [Methylobacterium populi BJ001]
          Length = 339

 Score =   99 bits (247), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 38/216 (17%), Positives = 77/216 (35%), Gaps = 29/216 (13%)

Query: 173 DMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
           ++++ LD+S SME    S    +++++    +     +             + GLV F++
Sbjct: 99  EIVLALDLSGSMERKDFSLDGETVSRLAAVKRVGAEFIRR-------RAGDRIGLVEFAD 151

Query: 229 KIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
           +        +  + + R ++   +   G ST    GL  A  ++   Q           +
Sbjct: 152 QAYVAAAPTFDTAAVARTLEEATIGLVGRSTGIGDGLGLALKRLAPAQLADAEGGGPPPS 211

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR------VIRSH------E 334
             K++V ++DG N + +           AK  G  VY I +          +       E
Sbjct: 212 RDKVVVLLSDGANNAGQT--APKDVAALAKDLGVRVYTIALGPIDMADNPNNEQDVVDVE 269

Query: 335 FLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
            LRA A  S    + V+    +    + I +    +
Sbjct: 270 TLRAMAETSGGRAFRVKTTDDLESVAAAIDELEGGR 305


>gi|189912860|ref|YP_001964749.1| BatA [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
 gi|189913185|ref|YP_001964414.1| Hypothetical BatA protein; putative von Willebrand factor, type A
           domain containing protein [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Paris)']
 gi|167777536|gb|ABZ95836.1| BatA [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
 gi|167781253|gb|ABZ99550.1| Hypothetical BatA protein; putative von Willebrand factor, type A
           domain containing protein [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Paris)']
          Length = 317

 Score =   99 bits (247), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 42/237 (17%), Positives = 83/237 (35%), Gaps = 28/237 (11%)

Query: 143 TFIPWYTNSRHIVMPITSSVKV---NSQTDARLDMMIVLDVSRSM-ESFFDSSITKIDMA 198
           T    Y +   +V+           +  +   +D+MI LD+S SM  S+      ++ ++
Sbjct: 59  TEFLVYLSMVFLVVAAAGPGSKYKLSPDSTKGVDIMIALDISGSMVNSYDFLPRNRLSVS 118

Query: 199 IKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTN 258
              +   +++           + G+V F+        L          +  L      T+
Sbjct: 119 KDLLREFVKK-------RLYDRIGIVVFAGAAYLQSPLSSDRF----ALDELIA---GTS 164

Query: 259 STPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKR 318
           S    +     + D   +  +         K+I+ +TDG + + K D  +  Y    K  
Sbjct: 165 SEDIEEQG-TAVGDALVLSSYRLKNSEAKSKVIILLTDGVSNTGKLDPDTAAYTT--KTM 221

Query: 319 GAIVYAIGIRVIRSH-----EFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
           G  VY IGI           E L+  +  +   F+  E+P  +    + I +  V +
Sbjct: 222 GIKVYCIGIGKEEGQYEINYESLQKISSNTNGKFFRAESPEVLESVLNEIDQLEVVE 278


>gi|116051069|ref|YP_790101.1| von Willebrand factor type A domain-containing protein [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|296388430|ref|ZP_06877905.1| von Willebrand factor type A domain-containing protein [Pseudomonas
           aeruginosa PAb1]
 gi|313108364|ref|ZP_07794396.1| putative von Willebrand factor type A domain-containing protein
           [Pseudomonas aeruginosa 39016]
 gi|115586290|gb|ABJ12305.1| putative von Willebrand factor type A domain [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|310880898|gb|EFQ39492.1| putative von Willebrand factor type A domain-containing protein
           [Pseudomonas aeruginosa 39016]
          Length = 340

 Score =   99 bits (247), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 29/220 (13%), Positives = 70/220 (31%), Gaps = 45/220 (20%)

Query: 171 RLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+++ +DVS SM+          I+++++  K     +E+           + GL+ F
Sbjct: 89  GRDLLLAVDVSGSMDYRDMRWQDDEISRLELIKKLFGDFIED-------RRGDRVGLILF 141

Query: 227 SNKIEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
            ++      L +    ++  +    +   G +T     +  A                + 
Sbjct: 142 GSQAYLQAPLTFDRHTVRVWLDEAQIGIAGKNTAIGDAIGLAVK-----------RLRQR 190

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR------------- 331
               +++V +TDG N   +   Q       A ++   +Y IG+                 
Sbjct: 191 PAESRVLVLITDGANTGGQIAPQI--AAQLAAEQQVKIYTIGVGADPQQGGVPGLFGFNP 248

Query: 332 ----SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                   LR  A  +   ++   +   +    + + +  
Sbjct: 249 GLDLDEPTLRGIAEITGGEYFRARSSAELESISATLDRLE 288


>gi|114762302|ref|ZP_01441760.1| von Willebrand factor type A domain protein [Pelagibaca bermudensis
           HTCC2601]
 gi|114544920|gb|EAU47924.1| von Willebrand factor type A domain protein [Roseovarius sp.
           HTCC2601]
          Length = 335

 Score = 99.5 bits (246), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 24/213 (11%), Positives = 69/213 (32%), Gaps = 32/213 (15%)

Query: 166 SQTDARLDMMIVLDVSRSMESFFDSSI-----TKIDMAIKSINAMLEEVKLIPDVNNVVQ 220
           +  +A  D+++ +D+S SM++   ++       ++    + + A +             +
Sbjct: 88  TIENAARDVVMAIDISGSMDARDFATPEGERIQRLSGVREVVRAFV-------SGREGDR 140

Query: 221 SGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHC 280
             L+ F         L   +  +   +          ++  G                  
Sbjct: 141 MALIVFGTSAYLQAPLTDDLETIIALLDRTEVGMAGPHTALGDAIGL---------SIRT 191

Query: 281 NTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR-------SH 333
                  +++++ ++DG + +++     +     A  RG  +Y IG+             
Sbjct: 192 FETSEIDQRLLILLSDGSDTASR--MSPVNAAEIAADRGVEIYTIGVGDPDATGENRVDL 249

Query: 334 EFLRACA--SPNSFYLVENPHSMYDAFSHIGKD 364
             L+  A  +   ++  E+  S+   +  I + 
Sbjct: 250 TTLKEVAQRTGGQYFFAEDAASLEAVYDRIDEL 282


>gi|226366409|ref|YP_002784192.1| hypothetical protein ROP_70000 [Rhodococcus opacus B4]
 gi|226244899|dbj|BAH55247.1| hypothetical membrane protein [Rhodococcus opacus B4]
          Length = 328

 Score = 99.5 bits (246), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 33/255 (12%), Positives = 70/255 (27%), Gaps = 30/255 (11%)

Query: 130 SAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFD 189
                     +    +          + +    +       R  +++V+DVS SM++   
Sbjct: 49  KVAPSRPGRARHIPALLMVLALVFFSVALAGPTEDKRVPRNRATVILVIDVSLSMKATD- 107

Query: 190 SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKY 249
              T++  A  +  +  + +    +       GLV F+                +  I  
Sbjct: 108 VEPTRLAAAQDAAKSFADGLTPGIN------LGLVAFAGTASVLVSPTTNREATKVAIDN 161

Query: 250 LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSL 309
           L      T +   +  +   I     +       D      IV ++DG+    +      
Sbjct: 162 LQLSER-TATGEAIFTSLQSIDT---LAAVLGGSDQAPPARIVLLSDGKQTVPENPDDPR 217

Query: 310 ---YYCNEAKKRGAIVYAIGIRV--------------IRSHEFLRACA--SPNSFYLVEN 350
                  +AK +   +  I                        LR  A  S  SF+   +
Sbjct: 218 GGFTAARQAKDKDVPISTISFGTSYGKVEIEDERIPVPVDDPSLREIANLSGGSFFTASS 277

Query: 351 PHSMYDAFSHIGKDI 365
              + D +  + + I
Sbjct: 278 LEELRDVYDTLEEQI 292


>gi|49087064|gb|AAT51411.1| PA3073 [synthetic construct]
          Length = 341

 Score = 99.5 bits (246), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 30/220 (13%), Positives = 70/220 (31%), Gaps = 45/220 (20%)

Query: 171 RLDMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+++ +DVS SM+          I+++++  K     +E+           + GL+ F
Sbjct: 89  GRDLLLAVDVSGSMDYRDMRWQDYEISRLELIKKLFGDFIED-------RRGDRVGLILF 141

Query: 227 SNKIEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
            ++      L +    ++  +    +   G +T     +  A                + 
Sbjct: 142 GSQAYLQAPLTFDRHTVRVWLDEAQIGIAGKNTAIGDAIGLAVK-----------RLRQR 190

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR------------- 331
               +++V +TDG N   +   Q       A ++   +Y IGI                 
Sbjct: 191 PAESRVLVLITDGANTGGQIAPQI--AAQLAAEQQVKIYTIGIGADPQQGGVPGLFGFNP 248

Query: 332 ----SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                   LR  A  +   ++   +   +    + + +  
Sbjct: 249 GLDLDEPTLRGIAESTGGEYFRARSSAELESISATLDRLE 288


>gi|296125842|ref|YP_003633094.1| von Willebrand factor type A [Brachyspira murdochii DSM 12563]
 gi|296017658|gb|ADG70895.1| von Willebrand factor type A [Brachyspira murdochii DSM 12563]
          Length = 328

 Score = 99.5 bits (246), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 44/233 (18%), Positives = 88/233 (37%), Gaps = 48/233 (20%)

Query: 168 TDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFS 227
               + + +V+DVS SM +      T+++ + K++   +++        N  +  LV F+
Sbjct: 82  NGEGIYISLVVDVSPSMMAEDM-MPTRLEASKKTMIDFIKK-------RNFDKISLVAFA 133

Query: 228 NKIEEFFLLEWGVSHLQRKIKYLSKFG-VSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
            +        +  + L+ +IK +      ST+   G+  A + +  ++G  +        
Sbjct: 134 LRASVLSPSTFDYTLLEEEIKNIKIDEEGSTSIGLGIATAVDMLRSVKGDNE-------- 185

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR--------------- 331
             KII+ +TDGEN S + D         A      +Y IGI                   
Sbjct: 186 --KIIILLTDGENNSGEID--PKLASEIASNFNIKIYTIGIGDANGSHAWVTYDDPNYGK 241

Query: 332 ---------SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
                    + E L   A  +   ++  +N  ++ + ++ I + I  K I  D
Sbjct: 242 RRIRADFSLNEEALIDIASTTGGKYFNAQNASALDNVYNTIDR-IEKKPILDD 293


>gi|330975134|gb|EGH75200.1| von Willebrand factor, type A [Pseudomonas syringae pv. aptata str.
           DSM 50252]
          Length = 352

 Score = 99.5 bits (246), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 30/220 (13%), Positives = 68/220 (30%), Gaps = 45/220 (20%)

Query: 171 RLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+++ +DVS SM+          ++++ +  + +   LE            + GL+ F
Sbjct: 89  GRDLLVAVDVSGSMDYPDMQWKSDEVSRLVLVQQLLGDFLEG-------RKGDRVGLILF 141

Query: 227 SNKIEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
             +      L +    ++  +    +   G +T     +  A                  
Sbjct: 142 GTQAFVQAPLTYDRRTVRVWLDEARIGIAGKNTALGDAIGLALK-----------RLRMR 190

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHE---------- 334
               + +V +TDG N + + D   +     A + G  +Y IGI      +          
Sbjct: 191 PATSRALVLVTDGANNAGQID--PITAARLAAEEGVKIYPIGIGSDPDKDALQSVLGLNP 248

Query: 335 -------FLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                   L+  A  S   ++   +   +    + +    
Sbjct: 249 SLDLDEPTLKEIASLSGGQYFRARDGDQLEKIRATLDALE 288


>gi|187251530|ref|YP_001876012.1| von Willebrand factor type A [Elusimicrobium minutum Pei191]
 gi|186971690|gb|ACC98675.1| Von Willebrand factor type [Elusimicrobium minutum Pei191]
          Length = 373

 Score = 99.5 bits (246), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 36/239 (15%), Positives = 68/239 (28%), Gaps = 27/239 (11%)

Query: 139 LKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMA 198
             F         +   +     + K        +D+++ +D S SM +       +I  A
Sbjct: 114 FCFTLITLGLIFAVLALAKPRDAQKTVLPPTEGVDIILAIDTSGSMAAQDFD-PNRITAA 172

Query: 199 IKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTN 258
             +    +             + G+V F++       L      L   +  +    V T+
Sbjct: 173 KVAAANFIAN-------RLSDRIGIVVFASDAMLQSPLTLDYESLLDFLADVRIGMVRTD 225

Query: 259 STPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKR 318
               +  A                      K+I+ +TDGE+ S       L     A   
Sbjct: 226 -GTAIGDAIAVSSVHLER-------SPARSKVIILLTDGESNSGVIS--PLDAAKTAALY 275

Query: 319 GAIVYAIGI-------RVIRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
           G  VY I          +    + L   A  +   +Y   N   +   ++ I     T+
Sbjct: 276 GIKVYTIATISKNSRDSLDFKPDDLEQIAKLTGGKYYRAYNEAELTKIYAEIDSLEKTE 334


>gi|332307030|ref|YP_004434881.1| von Willebrand factor type A [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332174359|gb|AEE23613.1| von Willebrand factor type A [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 338

 Score = 99.5 bits (246), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 28/217 (12%), Positives = 66/217 (30%), Gaps = 38/217 (17%)

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
             D+MI +D+S SM+        +    +  +  +   +          + GL+ F++  
Sbjct: 86  GRDLMIAVDLSGSMKIDDMQVNGRQ---VDRLQMIKSVLHDFIQRRVGDRLGLIFFADTA 142

Query: 231 EEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
                L +    + + +    +   G  T     +  A  +    +              
Sbjct: 143 YLQAPLTYDRETVSQLLGESLIGLVGEQTAIGDAIGLAIKRFQSKKESN----------- 191

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR----------------- 331
           K+++ +TDG+N +     Q       A   G  +Y IG+   +                 
Sbjct: 192 KVLILLTDGQNTAGNISPQ--QANELAINNGVTLYTIGVGADQMMVQSIFGSRQVNPSQE 249

Query: 332 -SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                L   A  +   ++   +  S+   +  + +  
Sbjct: 250 LDESMLTQLAESTGGRYFRARDAESLKAIYDKLDELE 286


>gi|154244802|ref|YP_001415760.1| von Willebrand factor type A [Xanthobacter autotrophicus Py2]
 gi|154158887|gb|ABS66103.1| von Willebrand factor type A [Xanthobacter autotrophicus Py2]
          Length = 345

 Score = 99.5 bits (246), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 29/221 (13%), Positives = 69/221 (31%), Gaps = 45/221 (20%)

Query: 170 ARLDMMIVLDVSRSMESFF----DSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVT 225
              +MM+ +D+S SM S           ++ +  +  +  +             + GL+ 
Sbjct: 89  EGREMMLAVDLSASMSSPDLVQSGVPANRLQVVKRVADDFIAR-------RTGDRIGLIL 141

Query: 226 FSNKIEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           FS +      L    + +++ +    +   G +T+    +  A                +
Sbjct: 142 FSTRAYVQAPLTLDRNVVRQLLAEASIGMTGRNTSIGDAIGLAVKT-----------LRD 190

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR------------ 331
                ++++ +TDG N S       +     A K    ++ IG+                
Sbjct: 191 RPAKDRVLILLTDGANTSG--VLDPMEAAAIAAKENVRIHTIGVGADSNFTDIQPGMLMN 248

Query: 332 -----SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                  E L+  A  +   ++   N   +   ++ I +  
Sbjct: 249 PSGDLDEEALKKIAGLTGGQYFRARNDKGLAAIYADIDRLE 289


>gi|254820233|ref|ZP_05225234.1| hypothetical protein MintA_09911 [Mycobacterium intracellulare ATCC
           13950]
          Length = 339

 Score = 99.5 bits (246), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 35/248 (14%), Positives = 77/248 (31%), Gaps = 33/248 (13%)

Query: 145 IPWYTNSRHIVMPITSSVKVNSQTDARLD---MMIVLDVSRSMESFFDSSITKIDMAIKS 201
           +P    +  +V+  T+     S     L+   +M+V+DVS SM S       ++  A ++
Sbjct: 71  VPTILLATSLVLLTTAMAGPTSDVRIPLNRAVVMLVIDVSESMASND-VPPNRLAAAKEA 129

Query: 202 INAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTP 261
                +++    +       GLV F+               ++  I  L      T +  
Sbjct: 130 GKQFADQLTPAIN------LGLVEFAANATLLVPPTTNRGAVKSGIDSLQPA-PKTATGE 182

Query: 262 GLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSL---YYCNEAKKR 318
           G+  A   I  +          +      IV  +DG      +             AK +
Sbjct: 183 GIFTALQAIATV---GSVMGGGEGPPPARIVLESDGAENVPLDPNAPQGAFTAARAAKGQ 239

Query: 319 GAIVYAIGIRVIR--------------SHEFLRACA--SPNSFYLVENPHSMYDAFSHIG 362
           G  +  I                      + L+     +    +  ++  S+ + ++ + 
Sbjct: 240 GVQISTISFGTPYGTVDYEGATIPVPVDDQTLQKICEITDGEAFHADSLDSLKNVYTTLQ 299

Query: 363 KDIVTKRI 370
           + I  + +
Sbjct: 300 RQIGYETV 307


>gi|146282738|ref|YP_001172891.1| von Willebrand factor type A domain-containing protein [Pseudomonas
           stutzeri A1501]
 gi|145570943|gb|ABP80049.1| von Willebrand factor type A domain protein [Pseudomonas stutzeri
           A1501]
          Length = 339

 Score = 99.5 bits (246), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 32/220 (14%), Positives = 72/220 (32%), Gaps = 45/220 (20%)

Query: 171 RLDMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+++ +DVS SM+          +T++++    +   +E+        +  + GL+ F
Sbjct: 89  GRDLLLAVDVSGSMDYPDMQWQGEELTRLELVKVLLGDFIEQ-------RHGDRVGLILF 141

Query: 227 SNKIEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
            +K      L +    ++  +    +   G +T     +  A                E 
Sbjct: 142 GSKAYLQAPLTFDRRTVRVWLDEARVGIAGSNTAIGDAIGLAVK-----------RLRER 190

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV--------------- 329
               +++V +TDG N   + D   L     A +    ++ IGI                 
Sbjct: 191 PTNSRVLVLITDGANNGGELD--PLLAATLAAEESVRIHTIGIGAVPEEGGVLSRFGFNP 248

Query: 330 --IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                   LRA A  +   ++   +   +    + + +  
Sbjct: 249 GLDLDEPTLRAIAEQTGGEYFRAASSAELKAIGAALDRLE 288


>gi|296445280|ref|ZP_06887239.1| von Willebrand factor type A [Methylosinus trichosporium OB3b]
 gi|296257235|gb|EFH04303.1| von Willebrand factor type A [Methylosinus trichosporium OB3b]
          Length = 575

 Score = 99.5 bits (246), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 31/238 (13%), Positives = 71/238 (29%), Gaps = 33/238 (13%)

Query: 11  FFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGN 70
           F    +G + ++  +    + L+LG  ++       K+ L    D + +  A  I+    
Sbjct: 16  FSSCDRGNVAVIFGLSFIPLVLMLGAGVDYGRAVSTKSNLQQATDSAALAVAKTIVATTT 75

Query: 71  GNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSIS 130
               +      +L  ++N   +  + E+  +                          ++ 
Sbjct: 76  NQQAQSQAQVYLLTNVRNAVAVVTKAEISAD------------------------RLTLC 111

Query: 131 AISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDS 190
             S  +IP           +   I    T+  +     +   ++ +VLD S SM      
Sbjct: 112 LDSTAQIPTTIM----KIAHIETITTKATTCAQTPGGMNGTYEIALVLDNSGSMSKS-AG 166

Query: 191 SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIK 248
             +KI     +  + +  +         V+  +V FS  +          +     I 
Sbjct: 167 GKSKIAALRDAATSFVNNIYSKTT---DVKMSIVPFSAGVRVLDPSVSS-NRTLSWID 220



 Score = 64.1 bits (154), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 26/179 (14%), Positives = 58/179 (32%), Gaps = 17/179 (9%)

Query: 205 MLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLK 264
            +   + I               +  +    +  G ++ Q     ++     +       
Sbjct: 399 FMWGWRTISPTGPFAAGRAYATKDNHKIIVFMTDGFNNWQSATSTVT----GSAYQAAGY 454

Query: 265 YAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKE------DQQSLYYCNEAKKR 318
           Y+YN   + +         +    +  +    G +    +      D+ +L  C  AK  
Sbjct: 455 YSYNGTANQRFPDGTATNGNGVNYQTTLEAAAGSSTDYHDTSRNMQDELTLEACTNAKTA 514

Query: 319 GAIVYAIGIRVIRSH------EFLRACASP-NSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           G  +Y IG  V          + ++ CA+  N ++   +  S+  AF+ IG  +   R+
Sbjct: 515 GVEIYTIGFSVPVDPIDAQGLKMMQDCATDANHYFAATDVDSLNAAFASIGSGVGKLRL 573


>gi|291295702|ref|YP_003507100.1| von Willebrand factor type A [Meiothermus ruber DSM 1279]
 gi|290470661|gb|ADD28080.1| von Willebrand factor type A [Meiothermus ruber DSM 1279]
          Length = 318

 Score = 99.5 bits (246), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 34/216 (15%), Positives = 77/216 (35%), Gaps = 33/216 (15%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
           Q D +  +++ +D+S SM++      ++ + A  ++   + E+         ++  LVTF
Sbjct: 80  QADPKAAVVLAVDISLSMQATD-VQPSRFEAARAALRTFIREL------PEGLRLALVTF 132

Query: 227 SNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
           +        L      L   + +L    + T     +      I  +  + +     D  
Sbjct: 133 ARDAHLVVPLTTDRGRLLEAVDFLQLN-LGTAIGDAI---LESIQALPPLSERAEDPDPR 188

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI---------------- 330
               I+ +TDG +L   +    +    EA ++   V+ IGI                   
Sbjct: 189 RLATIILLTDGRSLGGVD---PVVAAQEAARQQIRVHTIGIGRTTSGPVPGLPEVYAQAA 245

Query: 331 -RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGK 363
               E L+  A      ++ V++   + +A+  + +
Sbjct: 246 LFDEETLKEVARVGDGQYFYVDSAEKLKEAYRDLTR 281


>gi|163850298|ref|YP_001638341.1| von Willebrand factor type A [Methylobacterium extorquens PA1]
 gi|163661903|gb|ABY29270.1| von Willebrand factor type A [Methylobacterium extorquens PA1]
          Length = 339

 Score = 99.5 bits (246), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 41/237 (17%), Positives = 83/237 (35%), Gaps = 35/237 (14%)

Query: 152 RHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLE 207
             +V+P T+      +      +++ LD+S SME    S    +++++    +     + 
Sbjct: 84  PRLVLPATALPASARE------IVLALDLSGSMERKDFSLDGETVSRLAAVKRVGAEFIR 137

Query: 208 EVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKY 265
                       + GLV F+++        +  + + R ++   +   G ST    GL  
Sbjct: 138 R-------RAGDRIGLVEFADQAYVAAAPTFDTATVARTLEEATIGLVGRSTGIGDGLGL 190

Query: 266 AYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAI 325
           A  ++   Q              K++V ++DG N + +           AK  G  VY I
Sbjct: 191 ALKRLAPAQVAAADGEGPPPARDKVVVLLSDGANNAGQT--APKDVAALAKDLGVRVYTI 248

Query: 326 GIR------VIRSH------EFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
            +          +       E LRA A  S    + V+    + +  + I +    +
Sbjct: 249 ALGPIDMADNPNNEQDVVDVETLRAMAETSGGRAFRVKTTDDLENVANAIDELEGGR 305


>gi|21244101|ref|NP_643683.1| hypothetical protein XAC3376 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|21109728|gb|AAM38219.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri
           str. 306]
          Length = 323

 Score = 99.5 bits (246), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 31/222 (13%), Positives = 68/222 (30%), Gaps = 45/222 (20%)

Query: 169 DARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
                MM+ +D+S SM           + ++  A   ++  L       D  +  + GL+
Sbjct: 84  REARQMMLAVDLSGSMSEPDMVLGGKVVDRLTAAKAVLSDFL-------DRRDGDRVGLL 136

Query: 225 TFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            F  +      L   ++ ++ +++   +   G  T                  +      
Sbjct: 137 VFGQRAYALTPLTADLTSVRDQLRDSVVGLAGRETAIGDA-----------IALSVKRLR 185

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF------- 335
           E    ++++V +TDG N +       L     AK  G  V+ I       +         
Sbjct: 186 EQKQGQRVVVLLTDGVNTAG--VLNPLKAAELAKAEGVRVHTIAFGGSGGYSLFGVPIPA 243

Query: 336 ----------LRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                     LR  A  +   F+   +   +   ++ + +  
Sbjct: 244 GGDDDIDEDGLRKIAQQTGGRFFRARDTDELAGIYAELDRLE 285


>gi|149909171|ref|ZP_01897828.1| hypothetical protein PE36_09171 [Moritella sp. PE36]
 gi|149807695|gb|EDM67641.1| hypothetical protein PE36_09171 [Moritella sp. PE36]
          Length = 402

 Score = 99.5 bits (246), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 50/394 (12%), Positives = 113/394 (28%), Gaps = 39/394 (9%)

Query: 12  FYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNG 71
               +G +T+     LP I  +L + +  +    +        D +++  A Q  + G  
Sbjct: 4   IQRQRGAITLTFTFMLPAIVSLLAITVFFAMYSQVVIRAGQAADSAVLACAYQQNDTGVV 63

Query: 72  NNRKKLK------------------------GGDILCRIKNTWNMSFRNELRDNGFVNDI 107
                                                       +    +       N  
Sbjct: 64  TEGILDYYRPNFVLPELNKSVKLNSNNGCQISAQYRFEPAMVNALPVAIDSDTEVVSNSQ 123

Query: 108 DDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVK---V 164
                  ++++  +     +S+       +           T+    ++P ++ V+   V
Sbjct: 124 SSAKLVQNVNVNGIQNPVDFSLVLDISGSMTWHLPELKKIITDVISDIVPSSNQVRFSIV 183

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITK---IDMAIKSINAMLEEVKLIPDVNNVVQS 221
             QT   +     L  S +     D  + +   +D      +      +L  +     + 
Sbjct: 184 PFQTGVGVSGAPWLLSSEASPKCVDGLVYRNGNLDADKTVQSLNYSSDRLDFNEVTPGR- 242

Query: 222 GLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCN 281
             +   ++      L   ++ + R ++ L   G ST S  G  +    + D         
Sbjct: 243 -WLDRCSETSFILPLTNNLNRVIRYVESLDTSGGSTASYQGFIWGVRTLTDQWQKEWQVT 301

Query: 282 T-EDANYKKIIVFMTDGENLSTKEDQQSLYY--CNEAK-KRGAIVYAIGIRVIRSH-EFL 336
             + ++  + ++  TDG++         +    C+  +      V  IG  V     +  
Sbjct: 302 PVQSSSLTQRLILFTDGDDNRRDYFNDLMSAGLCDVIQQDLNIQVSFIGFGVSADRIKQF 361

Query: 337 RACAS-PNSFYLVENPHSMYDAFSH-IGKDIVTK 368
           + CA    S +   N   + D F   I  +I TK
Sbjct: 362 KQCAGRNGSVFDANNTAELADYFEDAININIETK 395


>gi|218672263|ref|ZP_03521932.1| hypothetical protein RetlG_11787 [Rhizobium etli GR56]
          Length = 256

 Score = 99.5 bits (246), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 36/239 (15%), Positives = 79/239 (33%), Gaps = 18/239 (7%)

Query: 11  FFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGN 70
           F  +  G   I+TA+ +  +    GM ++ +H   ++T L++  D + V +  +  +   
Sbjct: 8   FISDRSGNFGIMTALLMVPLVGTAGMAVDFAHALSLRTQLYAAADAAAVGSIAEKSSAVA 67

Query: 71  GNNRKKLKGGDI--LCRIKNTWNMSFRNELRDNGFVNDID------------DIVRSTSL 116
                   G         +N +      EL +      ID                +   
Sbjct: 68  AAMAMNGNGTISLGKTDARNIFMSQVSGELAEVHVDLGIDVTKTANKLNSQVSFTATVPT 127

Query: 117 DIVVVPQNEGYSISAISRYKIPL-KFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMM 175
             + +   +  +IS  +  +     F  F     N+  + +  T S     +        
Sbjct: 128 TFMQIFGRDSITISGTATAEYQTAAFMDFYILLDNTPSMGVGATPSDVSKLEAKTGCAFA 187

Query: 176 IV-LDVSRSME--SFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
              +D S +    +       +ID+  ++  A+ +  K     ++  + G+ TF  K E
Sbjct: 188 CHQMDKSTNNYTIAKSLGVAMRIDVVRQATQALTDTAKTERISSDQFRMGVYTFGTKAE 246


>gi|90410254|ref|ZP_01218271.1| hypothetical protein P3TCK_05786 [Photobacterium profundum 3TCK]
 gi|90329607|gb|EAS45864.1| hypothetical protein P3TCK_05786 [Photobacterium profundum 3TCK]
          Length = 370

 Score = 99.2 bits (245), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 32/231 (13%), Positives = 71/231 (30%), Gaps = 32/231 (13%)

Query: 162 VKVNSQTDARLDMMIVLDVSRSMESFFDSSIT-----KIDMAIKSINAMLEEVKLIPDVN 216
            K  ++T    D+M+V+D+S SM      +       ++D   + +    +         
Sbjct: 84  GKSQTRTLIGRDVMVVVDLSGSMAEKDFLTPYGEKHTRLDAVKQVLAQFSQ-------HR 136

Query: 217 NVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQ 274
           +  + GL+ F +                  +    +   G ST+    +  A     D  
Sbjct: 137 DGDRLGLILFGDAAYLQAPFTADHETWLALLDETQVGMAGQSTHLGDAIGLAIKVFNDQA 196

Query: 275 GMRQHCNT-------EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGI 327
              +   T            +K+++ +TDG +         +     A  R   ++ I +
Sbjct: 197 DAAKQAATQQGSAVVTRPVKEKVVIVLTDGNDT--DSLVPPIDAAKVAASRDIRIHMIAM 254

Query: 328 RVIR-------SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKR 369
              R         E +   A  +    +   +P  +   +  IG+    + 
Sbjct: 255 GDPRTVGEQALDMEVIEQVASLTGGQSFQALSPAELTRVYKKIGELEPQQY 305


>gi|254504856|ref|ZP_05117007.1| hypothetical protein SADFL11_4895 [Labrenzia alexandrii DFL-11]
 gi|222440927|gb|EEE47606.1| hypothetical protein SADFL11_4895 [Labrenzia alexandrii DFL-11]
          Length = 455

 Score = 99.2 bits (245), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 51/455 (11%), Positives = 122/455 (26%), Gaps = 97/455 (21%)

Query: 11  FFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGN 70
              +  G + ILTA+    + L+    ++V  +   +  L S +D + + AA+ + N  +
Sbjct: 1   MGADRSGNVAILTALAFVPLMLITIGSLDVVRMTTAQAKLQSTLDSATLAAAS-LSNTAD 59

Query: 71  GNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSIS 130
             +         L        +        +       +I  +  +++ ++        S
Sbjct: 60  IEDTVDEYIQANLPDTAPWTTLKLTMGDVTDSLNAKSVEITATVDIEMTILKLAGIDKTS 119

Query: 131 AISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMI-------------- 176
            ++                      M  +    +       +D M+              
Sbjct: 120 VLASSVAQQAAQNIEVSVVLDISSSMGGSKITSLREAAKGFIDTMLKEDEDKEYTSLSII 179

Query: 177 -----------------------VLDVSRSMESFFDSSIT----KIDMAIKSINAMLEEV 209
                                  V+D   S   + + ++           +      ++ 
Sbjct: 180 PFGGTVNIGDFYDTYAVNSSTPGVIDSPSSANYYVNKNVPYGKFMFSTEREGCIEYTDDD 239

Query: 210 KLIPDVNNVVQSGLVTFSNKIEEFFLLEW----------GVSHLQRKIKYLS-KFGVSTN 258
             +  +    +  +  F+  +                    + L+  I  +    G   +
Sbjct: 240 FDMAAIPANSRPQVPDFTKWVATNPWCPSEDSAMVLNSNNTTDLKALIDDMDLSDGTGMD 299

Query: 259 STPGLKY-----AYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGE--------------- 298
                       +           +  +  D +  K+ V MTDG                
Sbjct: 300 IGALWGAKVLSGSMRGQLGGDFSDRPADFNDEDTLKVAVIMTDGAITAQFRPRDYTTTGK 359

Query: 299 ---------------NLSTKEDQQSLY----YCNEAKKRGAIVYAIGIRVIRS---HEFL 336
                          N ++ +   ++      C         VY IG ++       + L
Sbjct: 360 IKNKTQQTIVSKGNINTASTKADDAVAYFKRVCEYLNDNNVQVYTIGFQINSGSLPDQLL 419

Query: 337 RACASP-NSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           + CAS  +++Y VE   ++ DAF+ I   +   R+
Sbjct: 420 KYCASSLSNYYFVE-GLNIEDAFNAIASAVNNLRV 453


>gi|254292617|ref|YP_003058640.1| hypothetical protein Hbal_0241 [Hirschia baltica ATCC 49814]
 gi|254041148|gb|ACT57943.1| hypothetical protein Hbal_0241 [Hirschia baltica ATCC 49814]
          Length = 514

 Score = 99.2 bits (245), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 40/258 (15%), Positives = 86/258 (33%), Gaps = 25/258 (9%)

Query: 1   MFSLNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVH 60
           M S+   ++ F      G+  + A+FL +I  ++G  I+   +   K  L +  D +++ 
Sbjct: 1   MRSIQKTLKQFLNATNAGVAPMFALFLTVILFIIGFTIDFRRMDSAKMHLQAATDSAVLA 60

Query: 61  AATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVV 120
           AA   +         K +            +    ++      ++  ++   +    +  
Sbjct: 61  AARAYLTSSVQVKETKRQED----------SQKIASDYLTANLLSSSNNFENNQIQLVFK 110

Query: 121 VPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDV 180
                   I   +  KI L F            +V+P  ++         +L++++VLD 
Sbjct: 111 EDG----EIVGNASTKIKLIFG----GLFGKSDVVLPALAAA--TVGDSRKLEIVLVLDT 160

Query: 181 SRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGV 240
           S SM S       ++     +    +  V         VQ G+V ++  +          
Sbjct: 161 SGSMSSQ-----NRMKQLRTASINFVNSVFDNAVYERTVQVGVVPWNATVNINMDRPGTW 215

Query: 241 SHLQRKIKYLSKFGVSTN 258
                   + S +G  TN
Sbjct: 216 DASPGPAIHNSNYGNGTN 233



 Score = 47.2 bits (110), Expect = 0.004,   Method: Composition-based stats.
 Identities = 23/194 (11%), Positives = 52/194 (26%), Gaps = 8/194 (4%)

Query: 179 DVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN--KIEEFFLL 236
           D    M +   S    I    +   +      +       + S    ++N          
Sbjct: 315 DCPSPMLAMSQSRPQIIKKLNQLNPSGNTHADIGLMWGYRMFSQQANWNNFFGYNSDTKP 374

Query: 237 EWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTD 296
           +   S   RKI  +   G +T +       Y          +      +     +    +
Sbjct: 375 DSFHSTKSRKIMIMLTDGENTATNSEGYSYYGWCTYTNHYNKWGRYTGSTKDCEVPKGIN 434

Query: 297 GENLSTKE-DQQSLYYCNEAKKRGAIVYAIGIR--VIRSH---EFLRACASPNSFYLVEN 350
            + +S  + +   L  C   + +   ++ I +             LR CA  +S      
Sbjct: 435 KDEISNNDLNSLMLDACEVIRSKDVELFTIALDLHSYYDSTAIALLRECAGSDSHAYNIK 494

Query: 351 PHSMYDAFSHIGKD 364
            + + + F  +   
Sbjct: 495 GNELDETFQELASK 508


>gi|237800421|ref|ZP_04588882.1| von Willebrand factor, type A [Pseudomonas syringae pv. oryzae str.
           1_6]
 gi|331023280|gb|EGI03337.1| von Willebrand factor, type A [Pseudomonas syringae pv. oryzae str.
           1_6]
          Length = 352

 Score = 99.2 bits (245), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 31/212 (14%), Positives = 65/212 (30%), Gaps = 45/212 (21%)

Query: 171 RLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+++ +DVS SM+          ++++ +  + +   LE            + GL+ F
Sbjct: 89  GRDLLVAVDVSGSMDYPDMQWKNDEVSRLVLVQQLLGDFLES-------RKGDRVGLILF 141

Query: 227 SNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
             +      L +    ++  +    +   G +T     +  A                  
Sbjct: 142 GTQAFLQAPLTYDRQTVRVWLDEAKIGIAGKNTAVGDAIGLALK-----------RLRMR 190

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR------------- 331
               +++V +TDG N + + D   L     A   G  +Y IGI                 
Sbjct: 191 PANSRVLVLVTDGANNAGQID--PLTAARLAADEGVKIYTIGIGSDPEKNALQSALGLSA 248

Query: 332 ----SHEFLRACA--SPNSFYLVENPHSMYDA 357
                   L+  A  S   ++   +   +   
Sbjct: 249 SLDLDEPTLKEIARLSGGQYFRTRDGDQLEKI 280


>gi|302188504|ref|ZP_07265177.1| von Willebrand factor type A domain-containing protein [Pseudomonas
           syringae pv. syringae 642]
          Length = 352

 Score = 99.2 bits (245), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 30/220 (13%), Positives = 69/220 (31%), Gaps = 45/220 (20%)

Query: 171 RLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+++ +DVS SM+          ++++ +  + +   LE            + GL+ F
Sbjct: 89  GRDLLVAVDVSGSMDYPDMQWKSDEVSRLVLVQQLLGDFLEG-------RKGDRVGLILF 141

Query: 227 SNKIEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
             +      L +    ++  +    +   G +T     +  A                  
Sbjct: 142 GTQAFVQAPLTYDRRTVRIWLDEARIGIAGKNTALGDAIGLALK-----------RLRLR 190

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHE---------- 334
               +++V +TDG N + + D   +     A + G  +Y IGI      +          
Sbjct: 191 PATSRVLVLVTDGANNAGQID--PITAARLAAEEGVKIYPIGIGSDPDKDALQSVLGLNP 248

Query: 335 -------FLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                   L+  A  S   ++   +   +    + +    
Sbjct: 249 SLDLDEPTLKEIASLSGGQYFRARDGDQLEKIRATLDALE 288


>gi|262403351|ref|ZP_06079911.1| protein BatA [Vibrio sp. RC586]
 gi|262350850|gb|EEY99983.1| protein BatA [Vibrio sp. RC586]
          Length = 248

 Score = 99.2 bits (245), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/217 (12%), Positives = 69/217 (31%), Gaps = 42/217 (19%)

Query: 173 DMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
           D+M+V+D+S SM           + ++    + ++  + +           + GL+ F++
Sbjct: 15  DLMLVVDLSYSMSQEDMQSGQQMVDRLTAVKQVLSEFIAQ-------REGDRIGLILFAD 67

Query: 229 KIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
                  L      +  ++       + T +  G                    + A  +
Sbjct: 68  HAYLQTPLTLDRQTVTEQLNQAVLKLIGTQTAMGEGIGL---------ATKTFIDSAAPQ 118

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV------------------I 330
           ++++ ++DG N +       L   N AK+    +Y +G+                     
Sbjct: 119 RVMILLSDGSNTAG--VLDPLEAANIAKQYQTTIYTVGVGAGEMIVKDFLFSRKVNTAQD 176

Query: 331 RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
              + L+  A  +   ++   N   +   +  I +  
Sbjct: 177 LDEKTLQTIASTTGGQYFRARNQQDLQSIYDTINQLE 213


>gi|260777338|ref|ZP_05886232.1| protein BatA [Vibrio coralliilyticus ATCC BAA-450]
 gi|260607004|gb|EEX33278.1| protein BatA [Vibrio coralliilyticus ATCC BAA-450]
          Length = 271

 Score = 99.2 bits (245), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 31/226 (13%), Positives = 69/226 (30%), Gaps = 46/226 (20%)

Query: 166 SQTDARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQS 221
           +      DMM+V+D+S SM           I ++    + ++  + +           + 
Sbjct: 28  TTQPKHRDMMLVVDLSYSMSKEDMQFNGDYIDRLSAVKQVLSDFISK-------RQGDRL 80

Query: 222 GLVTFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQH 279
           GLV F++       L      +  ++    L   G  T    G+  A             
Sbjct: 81  GLVLFADHAYLQTPLTLDRHTVAEQLNQTVLRLIGTKTAIGEGIGLATKTFV-------- 132

Query: 280 CNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV---------- 329
              +    +++++ ++DG N +       +     AKK  A +Y +G+            
Sbjct: 133 ---DSDAPQRVMILLSDGSNTAG--VLDPIEAAKIAKKYNATIYTVGVGAGEMMVKEFFM 187

Query: 330 --------IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                       + L   A  +   ++   +   +   +  I    
Sbjct: 188 TRKVNTAQDLDEKSLMEIAKLTGGQYFRARDSKELATIYDTINNLE 233


>gi|154250683|ref|YP_001411507.1| von Willebrand factor type A [Parvibaculum lavamentivorans DS-1]
 gi|154154633|gb|ABS61850.1| von Willebrand factor type A [Parvibaculum lavamentivorans DS-1]
          Length = 436

 Score = 99.2 bits (245), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 57/440 (12%), Positives = 131/440 (29%), Gaps = 76/440 (17%)

Query: 1   MFSLNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVH 60
           M  +   +   + + +G    + AI +  +    G  +++S  + +++ L + +D S + 
Sbjct: 1   MRRIQKLLGALWQDRRGNFAAIFAIAIIPVVAAAGATVDISRAYIVESRLKAALDASALA 60

Query: 61  AATQIMNEGNGNNRKKLKG-GDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRST----- 114
                    +                 K     +       N     +   + +T     
Sbjct: 61  VGGATGMTTSQMQAMAQSFFNANYPASKLGVPGTLSVSQSGNVVSLSVHAQLPTTLMGVV 120

Query: 115 ---------SLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVN 165
                    +  +  + +    ++   +   +       +        I    T S    
Sbjct: 121 GINTLNVSATSQVTRMGKKLEVALVLDNTGSMASGGRMTVLKTAAKNLIT---TVSAAAT 177

Query: 166 SQTDARLDMM-IVLDVSR-------SMESFFDSSITKIDMAIKSINAM------------ 205
           +  D ++ ++   +DV+        S   + + + +           +            
Sbjct: 178 NPGDVKVAIVPFNVDVNIGTTNENVSWLHWDEFTPSGGGGNGNGNCNIIQILLGLCNNNN 237

Query: 206 ----LEEVKLIPDVNNVVQSGLVTF-----------------------SNKIEEFFLLEW 238
                   +      +       TF                       +  ++    L  
Sbjct: 238 NSNSHAGWEGCVMDRDQNYDAQNTFPPPNPGGSNATRYPASNSDSDNSNCNLQTIMPLST 297

Query: 239 GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGE 298
             S L   I  +     +TN+T GL + +N +     +         N  K+IVF+TDG+
Sbjct: 298 NWSALNSHIDAM-ASAGNTNTTIGLAWGWNMLTQGGPLSSAAAPAA-NLDKVIVFLTDGD 355

Query: 299 N-------LSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACAS-PNSFYLVEN 350
           N        S   + ++   CN  K  G  VY++ + +  +   +R CA+ P  +Y V  
Sbjct: 356 NTRNRWSNNSNTINARTTLICNNIKAAGIKVYSVRV-IEGNATLIRNCATEPGMYYSVTT 414

Query: 351 PHSMYDAFSHIGKDIVTKRI 370
              +   F+ I + +   RI
Sbjct: 415 ASELTSVFASIAQSLSNLRI 434


>gi|257062895|ref|YP_003142567.1| hypothetical protein Shel_01450 [Slackia heliotrinireducens DSM
           20476]
 gi|256790548|gb|ACV21218.1| uncharacterized protein [Slackia heliotrinireducens DSM 20476]
          Length = 744

 Score = 99.2 bits (245), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 40/206 (19%), Positives = 66/206 (32%), Gaps = 28/206 (13%)

Query: 174 MMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEF 233
           +++ LD S SM+         ++    +       +             LV++ +     
Sbjct: 382 VVLALDTSGSMDGE------PLNETKTATREFASTIFKSDAD-----VCLVSYDSSARNV 430

Query: 234 FLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVF 293
                    L+  ++ LS  G  TN                 +         + K+IIV 
Sbjct: 431 IDSTDNEYALKAAVRDLSA-GGGTNIEDA-----------LRVSYERLEGSGSDKRIIVL 478

Query: 294 MTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGI-----RVIRSHEFLRACASPNSFYLV 348
           M+DGE          + Y NE K  G  +Y +G              +   ASP   Y V
Sbjct: 479 MSDGEANEGLVGDDLIAYANEIKDDGVTIYTLGFFQSVSDKAECQRVMEGIASPGCHYEV 538

Query: 349 ENPHSMYDAFSHIGKDIVTKRIWYDK 374
           ++   +   F  IG DI   R  Y +
Sbjct: 539 DDASQLRYFFGDIGDDINGTRFIYVR 564


>gi|111024162|ref|YP_707134.1| hypothetical protein RHA1_ro07212 [Rhodococcus jostii RHA1]
 gi|110823692|gb|ABG98976.1| conserved hypothetical protein [Rhodococcus jostii RHA1]
          Length = 326

 Score = 99.2 bits (245), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 33/255 (12%), Positives = 70/255 (27%), Gaps = 30/255 (11%)

Query: 130 SAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFD 189
                     +    +          + +    +       R  +++V+DVS SM++   
Sbjct: 47  KVAPSRPGRARHIPALLMVLALVFFSVALAGPTEDKRVPRNRATVILVIDVSLSMKATD- 105

Query: 190 SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKY 249
              T++  A  +  +  + +    +       GLV F+                +  I  
Sbjct: 106 VEPTRLAAAQDAAKSFADGLTPGIN------LGLVAFAGTASVLVSPTTNREASKVAIDN 159

Query: 250 LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSL 309
           L      T +   +  +   I     +       D      IV ++DG+    +      
Sbjct: 160 LQLSER-TATGEAIFTSLQSIDT---LAAVLGGSDQAPPARIVLLSDGKQTVPENPDDPR 215

Query: 310 ---YYCNEAKKRGAIVYAIGIRV--------------IRSHEFLRACA--SPNSFYLVEN 350
                  +AK +   +  I                        LR  A  S  SF+   +
Sbjct: 216 GGFTAARQAKDKDVPISTISFGTSYGKVEIEDERIPVPVDDPSLREIANLSGGSFFTASS 275

Query: 351 PHSMYDAFSHIGKDI 365
              + D +  + + I
Sbjct: 276 LEELRDVYDTLEEQI 290


>gi|114764812|ref|ZP_01443994.1| hypothetical protein 1100011001322_R2601_10469 [Pelagibaca
           bermudensis HTCC2601]
 gi|114542698|gb|EAU45721.1| hypothetical protein R2601_10469 [Roseovarius sp. HTCC2601]
          Length = 477

 Score = 98.8 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 56/458 (12%), Positives = 129/458 (28%), Gaps = 91/458 (19%)

Query: 2   FSLNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHA 61
            +L   ++ F     G MTI+      ++ +  G+ I++ +    +T + + +DR+++ A
Sbjct: 20  SALVAQLQGFRRAESGSMTIMAVALSLLMMIFGGIGIDMMYAELQRTKIQNTLDRAVLAA 79

Query: 62  ATQIMNEGNG------------NNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDD 109
           A                      +       D     +      +R    +   +  I++
Sbjct: 80  ADLDNELDAQGVVEDYMSKMSLADALVSVNVDEGLNYRTVTADGYRTMPSNFMQLIGIEN 139

Query: 110 IVRSTSLDIVVVPQNEGYSISAISRYKI---------PLKFCTFIPWYTNSRHIVMPITS 160
           +        +        S+       +               F+    +     +   S
Sbjct: 140 MQAGGHSQAMERINKVEVSMVLDISGSMDDGDKMAELQTAASDFVDTLLDDGSEDLVSIS 199

Query: 161 SVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAM-----LEEVKLIPDV 215
            V  +   +A  +++  L+V+  M                +   +       +       
Sbjct: 200 LVPYSEHVNAGPEILSYLNVNY-MHDDSYCLEMPNSAFNSAALDLSLTYDQMQHFQWNYS 258

Query: 216 NNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQ- 274
            +   +  V      E+          L+ +I  L      T+   G+K+A   +     
Sbjct: 259 GSNSLTDTVCPRYAYEQIRPWSQDAGALKTQISQLQPR-AGTSIFMGMKWASALLDPSTR 317

Query: 275 ---------------GMRQHCNTEDANYKKIIVFMTDGE--------NLSTKEDQQSL-- 309
                             +     D +  K IV MTDG+        N +  ++ +    
Sbjct: 318 PIASGMIADGTVDAVFEGRPVAYSDTDVLKTIVLMTDGQHDRSFRIQNWAYNDENEVEHW 377

Query: 310 ------------------------------------YYCNEAKKRGAIVYAIGIR-VIRS 332
                                                 C  AK++G ++++IG       
Sbjct: 378 SQYNLWHYLNYYVNSWNRSSFYYQKYDAATGDTLLSSVCTAAKRQGILIWSIGFEVSDHG 437

Query: 333 HEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
              + +CAS  + +       + +AFS I + +   R+
Sbjct: 438 ANVMESCASSPAHFFRVEGVEISEAFSTIAQTLNQLRL 475


>gi|308050346|ref|YP_003913912.1| von Willebrand factor type A [Ferrimonas balearica DSM 9799]
 gi|307632536|gb|ADN76838.1| von Willebrand factor type A [Ferrimonas balearica DSM 9799]
          Length = 322

 Score = 98.8 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 28/223 (12%), Positives = 70/223 (31%), Gaps = 42/223 (18%)

Query: 168 TDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFS 227
                D+M+ +D+S SM+        +    +     +   +    +  +  + GL+ F+
Sbjct: 80  KREGRDLMLAVDLSGSMQIEDMELGNR---VVDRFTMVRHVLSDFIERRDGDRLGLILFA 136

Query: 228 NKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDA 285
           ++      L +    + R +    L   G  T     +     +  D++           
Sbjct: 137 DQAYLQAPLTFDRFAVARFLDEAVLGLVGQQTAIGDAIALGVKRFNDLEQSS-------- 188

Query: 286 NYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV---------------- 329
              +++V +TDGEN + +         + A++ G  +Y IGI                  
Sbjct: 189 ---RVLVLLTDGENNAGR--FTPAQAVSLARQSGVKLYTIGIGSAEIRRRGLLGTRTVNP 243

Query: 330 --IRSHEF-----LRACASPNSFYLVENPHSMYDAFSHIGKDI 365
                        L   ++   ++   +   +   +  + +  
Sbjct: 244 SSDLDQAEKSFIQLSE-STGGRYFRARSTEELESIYQELDQLE 285


>gi|114778216|ref|ZP_01453088.1| batB protein, putative [Mariprofundus ferrooxydans PV-1]
 gi|114551463|gb|EAU54018.1| batB protein, putative [Mariprofundus ferrooxydans PV-1]
          Length = 355

 Score = 98.8 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/221 (12%), Positives = 70/221 (31%), Gaps = 40/221 (18%)

Query: 171 RLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+++ +D+S SM+          ++++          +             + GL+ F
Sbjct: 106 GRDLLLAVDISGSMQIKDFEMNGQQVSRLTATKAVARQFISR-------RVGDRVGLILF 158

Query: 227 SNKIEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
            +       L +    +   +    +   G +T     +  A  ++      ++  + E 
Sbjct: 159 GSNAYVQTPLTFDRKTVITLLDEAAVGLAGKATAIGDAIGLAVKRLEQSNRDKRIASKE- 217

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR------------- 331
               ++++ +TDG N + +    +      A + G  +Y IGI                 
Sbjct: 218 ----QVLILLTDGVNTAGQ--LSAPQAAELAAEHGLTIYTIGIGADAMTVQSFFGTQRVN 271

Query: 332 -----SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                  + L   A  +   ++   +   +   ++ I K  
Sbjct: 272 PSADLDEKMLTDIATKTGGRYFRAHDTQELQKIYAMIDKLE 312


>gi|149911739|ref|ZP_01900346.1| von Willebrand factor type A domain protein [Moritella sp. PE36]
 gi|149805212|gb|EDM65230.1| von Willebrand factor type A domain protein [Moritella sp. PE36]
          Length = 330

 Score = 98.8 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 33/217 (15%), Positives = 78/217 (35%), Gaps = 38/217 (17%)

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
             +MM+ +D+SRSM++       ++   +  ++ +   V          + GL+ F++  
Sbjct: 84  GREMMLAVDLSRSMQAEDMQINNRM---VDRLSLVKTVVADFIQQRKGDRVGLIFFADNA 140

Query: 231 EEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
                L + +  +   ++   L   G  T    G+  A                   N +
Sbjct: 141 YLQAPLTFDLKTVSGYMQQAVLGLVGEQTAIGEGIGLALK-----------RFDAADNPQ 189

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR----------------- 331
           K+++ +TDG+N + +   + L     A+++G  +Y IG+                     
Sbjct: 190 KVLILLTDGQNSAGE--VKPLDAAKFAQEQGVKIYTIGVGADAYYKRTLFGNQKVDPSRD 247

Query: 332 -SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                L+  A  +   ++   +  S+   ++ + K  
Sbjct: 248 LDEVTLKTIAAQTGGQYFRARDASSLAAIYAELDKLE 284


>gi|312886236|ref|ZP_07745850.1| von Willebrand factor type A [Mucilaginibacter paludis DSM 18603]
 gi|311301261|gb|EFQ78316.1| von Willebrand factor type A [Mucilaginibacter paludis DSM 18603]
          Length = 335

 Score = 98.8 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 31/213 (14%), Positives = 55/213 (25%), Gaps = 47/213 (22%)

Query: 182 RSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVS 241
            SM +       +++         ++            + GLV FS +      L     
Sbjct: 104 GSMLAEDFK-PNRLEAGKNIAIDFIKN-------RPDDRIGLVIFSGESFTQCPLTIDHD 155

Query: 242 HLQRKIKYLSKFG--VSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGEN 299
            L      +        T    GL  A N                    K+++ +TDG N
Sbjct: 156 VLINLYHDIKNGMIEDGTAIGMGLATAVN-----------RLRGSEAKSKVVILLTDGVN 204

Query: 300 LSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI----------------------RSHEFLR 337
            +       +     AK+ G  VY +GI                              L 
Sbjct: 205 NAGSIP--PITAAEIAKQFGIRVYTVGIGTQGYAPYPVPSPYGGVVYQRMEVQIDEPTLT 262

Query: 338 ACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
             A  +   ++   N  ++   +  I +    K
Sbjct: 263 KIAAITGGKYFRATNNDALTRIYKQIDQLEKAK 295


>gi|221135318|ref|ZP_03561621.1| von Willebrand factor, type A [Glaciecola sp. HTCC2999]
          Length = 342

 Score = 98.8 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 28/221 (12%), Positives = 73/221 (33%), Gaps = 46/221 (20%)

Query: 169 DARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           +   D+M+ +D+S SM++       + + ++ M    +   ++            + GL+
Sbjct: 94  NEGRDLMVAVDLSGSMQTQDMVVNGNEVDRLVMVKTVLGDFIQR-------RVGDRIGLI 146

Query: 225 TFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            F++       L +  + +++ +    +   G ST     +  A               +
Sbjct: 147 LFADTAYLQAPLTFDRTTVEQLLSETVIGLVGDSTAIGDAIGLA-----------AKRFS 195

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR----------- 331
           +  N  K++V +TDG+N +           + A  +   +Y IG+               
Sbjct: 196 DKPNVNKVLVLLTDGQNTAGNITPD--QALSLAVDQNIKIYPIGVGADAMTVNSLFGQRQ 253

Query: 332 -------SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGK 363
                      L   A  +   ++   +   +   +  + +
Sbjct: 254 VNPSADLDEGLLTRLAKDTGGQYFRARDTQELEQIYRLLDR 294


>gi|294664114|ref|ZP_06729507.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292606114|gb|EFF49372.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 451

 Score = 98.8 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 31/222 (13%), Positives = 68/222 (30%), Gaps = 45/222 (20%)

Query: 169 DARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
                MM+ +D+S SM           + ++  A   ++  L       D  +  + GL+
Sbjct: 209 REARQMMLAVDLSGSMSEPDMVLGGKVVDRLTAAKAVLSDFL-------DRRDGDRVGLL 261

Query: 225 TFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            F  +      L   ++ ++ +++   +   G  T                  +      
Sbjct: 262 VFGQRAYALTPLTADLTSVRDQLRDSVVGLAGRETAIGDA-----------IALSVKRLR 310

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF------- 335
           E    ++++V +TDG N +       L     AK  G  V+ I       +         
Sbjct: 311 EQKQGQRVVVLLTDGVNTAG--VLNPLKAAELAKAEGVRVHTIAFGGSGGYSLFGVPIPA 368

Query: 336 ----------LRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                     LR  A  +   F+   +   +   ++ + +  
Sbjct: 369 GGDDDIDEDGLRKIAQQTGGRFFRARDTEELAGIYAELDRLE 410


>gi|294627092|ref|ZP_06705680.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292598525|gb|EFF42674.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
          Length = 451

 Score = 98.8 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 31/222 (13%), Positives = 68/222 (30%), Gaps = 45/222 (20%)

Query: 169 DARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
                MM+ +D+S SM           + ++  A   ++  L       D  +  + GL+
Sbjct: 209 REARQMMLAVDLSGSMSEPDMVLGGKVVDRLTAAKAVLSDFL-------DRRDGDRVGLL 261

Query: 225 TFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            F  +      L   ++ ++ +++   +   G  T                  +      
Sbjct: 262 VFGQRAYALTPLTADLTSVRDQLRDSVVGLAGRETAIGDA-----------IALSVKRLR 310

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF------- 335
           E    ++++V +TDG N +       L     AK  G  V+ I       +         
Sbjct: 311 EQKQGQRVVVLLTDGVNTAG--VLNPLKAAELAKAEGVRVHTIAFGGSGGYSLFGVPIPA 368

Query: 336 ----------LRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                     LR  A  +   F+   +   +   ++ + +  
Sbjct: 369 GGDDDIDEDGLRKIAQQTGGRFFRARDTEELAGIYAELDRLE 410


>gi|325273881|ref|ZP_08140055.1| von Willebrand factor type A [Pseudomonas sp. TJI-51]
 gi|324100983|gb|EGB98655.1| von Willebrand factor type A [Pseudomonas sp. TJI-51]
          Length = 311

 Score = 98.8 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 30/220 (13%), Positives = 69/220 (31%), Gaps = 45/220 (20%)

Query: 171 RLDMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+++ +DVS SM+          I+++D+    +   L++           + GL+ F
Sbjct: 42  GRDLLVAVDVSGSMDFPDMQWKNEDISRLDLVKALLGDFLQD-------REGDRVGLILF 94

Query: 227 SNKIEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
            ++      L +    ++  +    +   G +T     +  A                + 
Sbjct: 95  GSQAYLQAPLTFDRRTVRTFLDEAQIGIAGKNTAIGDAIGLAVK-----------RLRQR 143

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV--------------- 329
               +++V +TDG N   +     L     A + G  +Y IGI                 
Sbjct: 144 PAQSRVLVLITDGANNGGQIH--PLTAARLAAQEGVRIYTIGIGANPEASGTPGLLGLNP 201

Query: 330 --IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                   LR     +  +++   +   +      + +  
Sbjct: 202 SLDLDEAALREIGEITHGAYFRAHDGAELDAIGDTLDQLE 241


>gi|320323259|gb|EFW79347.1| von Willebrand factor type A domain-containing protein [Pseudomonas
           syringae pv. glycinea str. B076]
          Length = 352

 Score = 98.8 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/220 (13%), Positives = 68/220 (30%), Gaps = 45/220 (20%)

Query: 171 RLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+++ +DVS SM+          ++++ +  + +   LE            + GL+ F
Sbjct: 89  GRDLLVAVDVSGSMDYPDMQWKSDEVSRLVLVQQLLGDFLEG-------RKGDRVGLILF 141

Query: 227 SNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
             +      L +    ++  +    +   G +T     +                     
Sbjct: 142 GTQAFVQAPLTYDRRTVRFWLDEAKIGIAGKNTALGDAIGLGLK-----------RLRLR 190

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHE---------- 334
               +++V +TDG N + + D   +     A + G  +Y IGI      +          
Sbjct: 191 PATSRVLVLVTDGANNAGQID--PITAARLAAEEGVKIYPIGIGADPDKDALQSVLGLNP 248

Query: 335 -------FLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                   L+  A  S   ++   +   +    + +    
Sbjct: 249 SLDLDEPTLKEIASLSGGQYFRARDGDQLEKIRATLDSLE 288


>gi|32472883|ref|NP_865877.1| signal peptide [Rhodopirellula baltica SH 1]
 gi|32444120|emb|CAD73562.1| hypothetical protein-signal peptide and transmembrane prediction
           [Rhodopirellula baltica SH 1]
          Length = 434

 Score = 98.8 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 52/421 (12%), Positives = 108/421 (25%), Gaps = 65/421 (15%)

Query: 14  NYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNN 73
           + +GG+T+L A  LP++ L+    I ++ +  +KT L    D +          E     
Sbjct: 18  SRRGGITVLMAFVLPMLALLAAFCINLAQMQLVKTELAIATDAAARAGGRAFSEEQTVEA 77

Query: 74  RKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDI---VVVPQNEGYSIS 130
            K                     +   N F   +       +       V   +   ++ 
Sbjct: 78  AKAAARLTAAMNEVAGEPYQLNTDDSANEFEFGVSAQTDGNTGRFYFTKVPTSDVAANLV 137

Query: 131 AISRYKIPLKFCTFIPW----YTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMES 186
           A+S  +I  K           +       +   S V   +      D+ +VLD S SM+ 
Sbjct: 138 AVSSVRINGKRTDDSLLGPVPFIFPNTFSIGDFSPVASATAMQVDRDISLVLDRSGSMDW 197

Query: 187 FFDSSITK--------IDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEW 238
                           +  A  +    LE          + +       ++ + +     
Sbjct: 198 KTYDWPDDADPWGEDSLISAEDAGIVDLEWKYRNGQPQYIRRVSYNRGYDEYDLYDHAWE 257

Query: 239 ---------------------------GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIF 271
                                        +    ++   S     T     L    +   
Sbjct: 258 EVFGLGPAPNTPWEDLVLAVDAFLRVLDQTPQNEQVSIASYNSHGTLDCWLLDDFDSVRA 317

Query: 272 DMQGMRQHCNTE-----------------DANYKKIIVFMTDGENLSTKEDQQSLYYCNE 314
            +  +  + +T                       K +V MTDG +    +          
Sbjct: 318 AVAQLAPNGSTGIGNGMNSGKTAFTHENARPYASKTMVVMTDGNHNYGTQPNTVAQ--QL 375

Query: 315 AKKRGAIVYAIGIRVIRSHEFLRACA-SP-NSFYLVENPHSMYDAFSHIGKDIVTKRIWY 372
                  +  +        E ++  A +     Y  ++   +  AF  I  ++ T  I  
Sbjct: 376 MSSSNLNIQTVTFGGGADQETMQEVAVTGLGRHYHADSGDELVSAFEEIANNLPT--ILT 433

Query: 373 D 373
           +
Sbjct: 434 N 434


>gi|59713412|ref|YP_206187.1| TadG-like protein [Vibrio fischeri ES114]
 gi|59481660|gb|AAW87299.1| TadG-like protein [Vibrio fischeri ES114]
          Length = 423

 Score = 98.8 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 48/423 (11%), Positives = 106/423 (25%), Gaps = 68/423 (16%)

Query: 8   IRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAAT--QI 65
           +RN   + +G   IL A+ +P +F +  +  + +     K  +    + + +  +     
Sbjct: 1   MRNLRKHQQGHAAILFAMMIPALFGIFALASDGARAIQTKARIEDASEVAALAISAHNDP 60

Query: 66  MNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNE 125
               NG+     +   I+    N +                 + I    +       +  
Sbjct: 61  DQPDNGSYTPSTRNRQIVVDYVNAYISDIDAVTDIKVAKRRCELISGCVAGLYKGDARYL 120

Query: 126 GYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSME 185
            + I   +R          I                          +D+M   D S SM 
Sbjct: 121 EHEIDVTTRQNSWFPGNEAIEGMGE----TFSTRGKSLARKYQSEAVDVMFAADFSGSML 176

Query: 186 SFFDSS-ITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQ 244
             +  S   K    I+ I  +  E++   D+        +  S                 
Sbjct: 177 DTWSGSSNPKYIDLIEIIRNISVELQKFNDLPENRDKSTMGISAFSTFTNSFTSDTGIQC 236

Query: 245 RKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED-------------------- 284
              + ++      N    +K A           +                          
Sbjct: 237 SLSQGVNSKNKPGNWFRPVKPANTVANIWNEKTEDYCKSGAYAGFHDVNLTSNFNSLNGQ 296

Query: 285 --------------------------ANYKKIIVFMTDGENLSTKEDQQSLY--YCNEAK 316
                                      N +++++ ++DG +         +    C E +
Sbjct: 297 VGSFYAGGGTASYQALIRGAQLLDRGRNSRRLLIVLSDGMDNDRNLANGLVSNGMCREIQ 356

Query: 317 K--------RG----AIVYAIGIR-VIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGK 363
                     G    A +  IG      +++ L+ C    + Y  E+   + D    +  
Sbjct: 357 AGLESDRTPDGRPIAAKMAVIGFDYDPFANKALKDCVGEKNVYKAEDADEVEDIILELIN 416

Query: 364 DIV 366
           + V
Sbjct: 417 EEV 419


>gi|218461471|ref|ZP_03501562.1| von Willebrand factor type A [Rhizobium etli Kim 5]
          Length = 459

 Score = 98.8 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 54/452 (11%), Positives = 120/452 (26%), Gaps = 94/452 (20%)

Query: 8   IRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDR----------- 56
           +     +  G + I+  +    + L +G  I+    +  +T L +  D            
Sbjct: 1   LSRLIDDRDGAVAIIVILVAVPMLLAVGASIDYIRAYNGRTELQAAADSAVLAAAAKYKS 60

Query: 57  ------------SLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRN-------- 96
                       + + A  +      G  +      ++   + +    +F          
Sbjct: 61  GMPEATIAKTINAFLSANGEFETAVAGKPQVASDESELCLDVADAVPTTFMKLANIQSVP 120

Query: 97  -----------------------------ELRDNGFVNDIDDIVRSTSLDIVVVPQNEGY 127
                                        E R       +   +++ S +  +V + +  
Sbjct: 121 ISIRSCAALPGVKQLEIALVLDVSSSMIEENRFTPMQTAVAGFLQAFSSNTSLVDKTKIS 180

Query: 128 SISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLD-----MMIVLDVSR 182
            +   SR    L    ++  Y  +  +    T    V + +  +L      +  V+  S+
Sbjct: 181 IVPFSSRVNFGLANTAWLKSYNGTAAVPKRWTDPESVYTSSGYKLSYWIDGVTPVMSTSK 240

Query: 183 SMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE---EFFLLEWG 239
           +                 +           P  +  V       S           L   
Sbjct: 241 NYYWMGCIEPRADVEVRDTGAIGDGMGDAPPSTSAFVAMDANPKSGTSFCPPPVTPLTGD 300

Query: 240 VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE----DANYKKIIVFMT 295
            ++L+  +K L+  G ST    G+   +  +           +       +  K++VFMT
Sbjct: 301 FAYLKSVVKNLTSEG-STRLDAGVVAGWYTLSPKWQGVWGDQSSPAPVSDSVHKVMVFMT 359

Query: 296 DGENLSTKEDQQS---------------------LYYCNEAKKRGAIVYAIGIRVIRSHE 334
           DGE  +  +                            C   KK G  +Y +         
Sbjct: 360 DGEMNTKYDPNDKFDWICSQTQSSACNAFATAARQTACTAMKKSGIEIYTLSYSADADVV 419

Query: 335 FLRACASPNSFYLVENPHSMYDAFSHIGKDIV 366
            +R CA+  + +   +P ++   +  I   I 
Sbjct: 420 NIRNCATNTAHFFTASPATIKTVYETIAAAIR 451


>gi|218676637|ref|YP_002395456.1| hypothetical protein VS_II0874 [Vibrio splendidus LGP32]
 gi|218324905|emb|CAV26683.1| Conserved hypothetical protein [Vibrio splendidus LGP32]
          Length = 355

 Score = 98.8 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 33/224 (14%), Positives = 78/224 (34%), Gaps = 26/224 (11%)

Query: 162 VKVNSQTDARLDMMIVLDVSRSMESFFD-----SSITKIDMAIKSINAMLEEVKLIPDVN 216
            +   +     D+M+V+D+S SM            I+++D   + +    +         
Sbjct: 91  GEPQVREQLGRDVMVVVDLSGSMAEQDFTSKQGDKISRLDATKEVLADFAKT-------R 143

Query: 217 NVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQ 274
              + GL+ F +                  +    ++  G ST+    +  A  ++F+  
Sbjct: 144 KGDRLGLILFGDAAFVQTPFTADQDVWLELLNQTDVAMAGQSTHLGDAIGLAI-KVFEQS 202

Query: 275 GMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR--- 331
              Q  + +    +K+++ +TDG +       + +     AK +G  ++ I +   +   
Sbjct: 203 AAVQDSSVDANVKEKVVIVLTDGNDTG--SFVEPIDAAKVAKAKGVRIHVIAMGDPQTVG 260

Query: 332 ----SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKR 369
                 E ++  A  S    +   N   +  A++ IG+      
Sbjct: 261 EVALDMETIKRVAQESGGEAFEALNRDELTKAYAQIGELEPQLY 304


>gi|294141682|ref|YP_003557660.1| von Willebrand factor type A domain-containing protein [Shewanella
           violacea DSS12]
 gi|194578720|dbj|BAG66046.1| von Willebrand factor typeA domain protein [Shewanella violacea]
 gi|293328151|dbj|BAJ02882.1| von Willebrand factor type A domain protein [Shewanella violacea
           DSS12]
          Length = 334

 Score = 98.8 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 35/218 (16%), Positives = 67/218 (30%), Gaps = 38/218 (17%)

Query: 170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229
              D+MI +D+S SM+            A+     + + V    +     + GL+ F++ 
Sbjct: 81  KGRDLMIAVDLSGSMQIEDMVLNG---QAVDRFTMIQDVVSDFIERRKGDKLGLILFADH 137

Query: 230 IEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287
                 L      + + +K   +   G  T     +     +   +              
Sbjct: 138 AYLQAPLTQDRRSVAQFLKEAQIGLVGKQTAIGEAIALGVKRFDMV-----------DKS 186

Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR---------------- 331
            +I+V +TDG N S     +       A KRG  +YAIG+                    
Sbjct: 187 NRILVLLTDGSNNSGSISPE--QAAAIAAKRGVKIYAIGVGADVMERRSIFGTERVNPSM 244

Query: 332 --SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                 L + A  +   ++   +   +   +  I K  
Sbjct: 245 DLDEAQLSSLAKITGGLYFRARSSQDLQQIYQEIDKLE 282


>gi|110639040|ref|YP_679249.1| BatA-like protein [Cytophaga hutchinsonii ATCC 33406]
 gi|110281721|gb|ABG59907.1| BatA-like protein, aerotolerance-related protein [Cytophaga
           hutchinsonii ATCC 33406]
          Length = 351

 Score = 98.8 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 40/233 (17%), Positives = 79/233 (33%), Gaps = 44/233 (18%)

Query: 161 SVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQ 220
           S + N+Q    ++M+  +DVS SM+       ++ D A +    ++       +  +  +
Sbjct: 101 SNETNTQYTEGINMIFAIDVSESMKITDI-HPSRFDAAKQICTDII-------NKRSNDR 152

Query: 221 SGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGV---STNSTPGLKYAYNQIFDMQGMR 277
            G+V FS +      L      L+ ++  L +       T     L  A N         
Sbjct: 153 IGIVIFSGEAVTLSPLTNDYVLLKNQLNDLKQNKDLQSGTAIGTALGTAIN--------- 203

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR------ 331
                     ++IIV ++DGEN S       +   +   +    +Y IG+          
Sbjct: 204 --RLKNAETKERIIVLISDGENTSG--LMDPITAADLCLEYNIKIYCIGLGKDGTHQFKD 259

Query: 332 ------------SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
                           L+  +  +   FY   +  S+ D  ++I +    K +
Sbjct: 260 DNGTIQYVESKLDENTLKNISATTKGKFYRAYDKKSLDDVIANIDQLEKGKIV 312


>gi|148256121|ref|YP_001240706.1| hypothetical protein BBta_4775 [Bradyrhizobium sp. BTAi1]
 gi|146408294|gb|ABQ36800.1| hypothetical protein BBta_4775 [Bradyrhizobium sp. BTAi1]
          Length = 602

 Score = 98.8 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 26/224 (11%), Positives = 66/224 (29%), Gaps = 26/224 (11%)

Query: 9   RNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNE 68
           R F  +  G +  L AI L  I   +G  I+ S     ++ +   +D + +  +  +   
Sbjct: 26  RRFSGDISGNIATLFAIALLPILAFIGAAIDYSRANAARSAMQGALDSTALMLSRDLSQG 85

Query: 69  GNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYS 128
                    K                             D    + +        +   +
Sbjct: 86  TITAADVAAKASTYFKA-----------------LYTSTDAQSVAVTASYTASTSSSASN 128

Query: 129 ISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFF 188
           I   +  +I  +F            +     ++    +  D ++ + + LD + SM    
Sbjct: 129 IQLNASGQIVTQFM----KLVGFPTMTFNTKAT---TTWGDVKMRVALALDNTGSMAYSG 181

Query: 189 DSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
             +   +  A+     +++++  +      V   L+ F+  +  
Sbjct: 182 KMTA--LQNAVAGSGGLIDQLSALAKSPGDVYISLIPFAKVVNV 223



 Score = 56.8 bits (135), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 32/211 (15%), Positives = 71/211 (33%), Gaps = 28/211 (13%)

Query: 187 FFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRK 246
              +     +    + + +         + N VQ    + S K+ +   L +  + L+  
Sbjct: 391 ADRTQPNDANAVSPASSDVATLFPANQHMENNVQYCSSSASTKLGQIVPLSYNWTSLKSA 450

Query: 247 IKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQ 306
           +  +   G  TN   G+ +A   +     +       +  Y ++I+ ++DG N   +   
Sbjct: 451 VNAMEPTG-GTNQAIGMAWAVQSLIPNGVLGAPAEDANTTYNRVIILLSDGLNTEDRWPD 509

Query: 307 ----------QSLYY-----CNEAKKRG-------AIVYAIGIRV----IRSHEFLRACA 340
                       +       C+  K            +Y I +        +   L+ CA
Sbjct: 510 YGNGSTQASGNPIDARQALLCSNLKNTKDSKGNAMYTIYTIQVNTSSPADPTSTVLQNCA 569

Query: 341 -SPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
            SP+ FY++ +   +   F+ IG  +   R+
Sbjct: 570 SSPDKFYMLTSSSQIVTTFNSIGTALSKLRV 600


>gi|315498202|ref|YP_004087006.1| von willebrand factor type a [Asticcacaulis excentricus CB 48]
 gi|315416214|gb|ADU12855.1| von Willebrand factor type A [Asticcacaulis excentricus CB 48]
          Length = 489

 Score = 98.4 bits (243), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 34/227 (14%), Positives = 84/227 (37%), Gaps = 31/227 (13%)

Query: 6   LNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQI 65
           + + +FF + +G   ++  +F  I+ + +   ++ S++   ++     +D + +  A   
Sbjct: 1   MGLPDFFRDRRGNTAVMFGLFFSILIVSMAGAVDYSNVISRRSKAQDALDAATLAVAVLR 60

Query: 66  MNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNE 125
                            + + +    +    EL DN     I      T        +  
Sbjct: 61  PAT--------------VEQAQAAVKLRLDKELGDNPDKVVIGQFNYDT--------KTR 98

Query: 126 GYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSME 185
            Y ++A   YK       F+    N + I   + S        +  L++ +VLD + SM 
Sbjct: 99  TYYVTAKGTYKP------FLLGVVNIKEIPYEVISETIQA--ANGTLELALVLDNTDSMG 150

Query: 186 SFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
              + S T++D+   +   ++  V    +  + V+  +V +++ +  
Sbjct: 151 QILNGSSTRLDVLKTAATNLVNTVMTSAN-KDYVKVAVVPYADYVNV 196



 Score = 64.5 bits (155), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 30/161 (18%), Positives = 56/161 (34%), Gaps = 29/161 (18%)

Query: 240 VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN--YKKIIVFMTDG 297
            + ++  +  +  +   T    GL +  N +      ++    +  N   KK+IV MTDG
Sbjct: 328 TNSIKGLVNSIGSYKPDTFIPGGLHWGVNTLSPPAPFKEGMAYDSKNKEPKKVIVLMTDG 387

Query: 298 ENLSTK------------------------EDQQSLYYCNEAKKRGAIVYAIGIRVIRSH 333
            N                                    C  AK +   V+ IG+ V    
Sbjct: 388 ANTLYTNSSGQIVSAATGSPPTISSSLVAPTYTAQDNACKYAKGKNIEVFVIGLGVTDPT 447

Query: 334 EF--LRACASPN-SFYLVENPHSMYDAFSHIGKDIVTKRIW 371
               L++CA+    ++  +N + + +AF  IG  +   R+ 
Sbjct: 448 ALSALKSCATDAQHYFDAQNANDLIEAFEIIGGKLSVVRLM 488


>gi|188580137|ref|YP_001923582.1| hypothetical protein Mpop_0869 [Methylobacterium populi BJ001]
 gi|179343635|gb|ACB79047.1| conserved hypothetical protein [Methylobacterium populi BJ001]
          Length = 477

 Score = 98.4 bits (243), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 41/453 (9%), Positives = 104/453 (22%), Gaps = 101/453 (22%)

Query: 11  FFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGN 70
              +  G + I+ A+ L     ++G+ I+       KT L +  D +++           
Sbjct: 18  LASDRGGSINIMFALALLPTLGLVGLGIDYGMAITSKTRLDNAADAAVLAGVVTAKEYIA 77

Query: 71  GNNRKKLKGGDILC----RIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQ--- 123
            N ++       L     +    + ++          V+ +D      +L   V+     
Sbjct: 78  SNAKQGDATAAGLTAGRNQATKAFAINTGKVPFATVSVSRLDVTRSGQTLTATVIYTATI 137

Query: 124 ---------------NEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQT 168
                              + SA     +       +                  +  + 
Sbjct: 138 QNTFGKILGLSSTTFTNTITASADLASYLDFYLMVDVSGSMGLPTAAADAEKLASITKED 197

Query: 169 DARLDMMIVLDVSRSMESFFDSSITK--------IDMAIKSINAMLEEVKLIPDVNNVVQ 220
                        +   +       +         ++  ++   ++     I     + +
Sbjct: 198 QGNCQFACHFPGRKGWNNAAGKIQLRSDAVNNAVCELLKRAATPVVPNQYRIGFYPFINR 257

Query: 221 SGLVTFSNKIEEFFL-----LEWGVSHLQRKIK--------------------------- 248
              ++  +             +   +                                  
Sbjct: 258 LATLSPLSDTTTSMTALRTAAQCDKTWPLAFTNLLDTGSTQLFTGNNPTTGTGSGGTHFE 317

Query: 249 --------YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENL 300
                    +  +G  +++T    + +     MQ  + +    DA        +  G   
Sbjct: 318 KALPQMKATIQPYGDGSSTTNSKPFVFLITDGMQNSQSYSTNNDARTFPGSPSLFKGYGN 377

Query: 301 STKEDQQSLYY----CNEAKKRGAIVYAIGIRVIRSH----------------------- 333
           +  +  Q        C E K  GAI+  + I    +                        
Sbjct: 378 AGWDGSQPAQIDPSKCKELKDAGAIISILYI--PYNQVKNYTNDSYIVWENNRVNGFSPT 435

Query: 334 --EFLRACASPNSFYLVENPHSMYDAFSHIGKD 364
             + LR CAS   FY   +   +  +   +   
Sbjct: 436 LADPLRKCASQGFFYTANSADDITASLGAMFDQ 468


>gi|189501234|ref|YP_001960704.1| von Willebrand factor type A [Chlorobium phaeobacteroides BS1]
 gi|189496675|gb|ACE05223.1| von Willebrand factor type A [Chlorobium phaeobacteroides BS1]
          Length = 331

 Score = 98.4 bits (243), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 41/249 (16%), Positives = 81/249 (32%), Gaps = 47/249 (18%)

Query: 140 KFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAI 199
                    T    I   +T +      ++  +D++  LD+S SM        +++D A 
Sbjct: 70  SAIVLAVVATGRPQITRAVTEA------SEKGIDIVFALDISESMLEEDF-EGSRLDAAK 122

Query: 200 KSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGV---S 256
           K     + E           + GLV F  K      L      L   ++ +S   +    
Sbjct: 123 KIALRFIRE-------RPQDRFGLVLFRGKSFTLCPLTLDHRLLGMLVRQVSVDAISDKG 175

Query: 257 TNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAK 316
           T     +    N                 + +++++ +TDGE+ S +     +     A+
Sbjct: 176 TAIGSAILVGTN-----------RLRASVSKERVLLLLTDGEHNSGE--VGPVTASEIAQ 222

Query: 317 KRGAIVYAIGIRVI---------------RSHEFLRACA--SPNSFYLVENPHSMYDAFS 359
             G  +Y IG+R                    + L   A  +   ++   + +S+ DAF 
Sbjct: 223 SEGIRIYVIGVRNEEEAGSPESMDAEREGVDEQVLGTVAGMTGGRYFRASDENSLKDAFG 282

Query: 360 HIGKDIVTK 368
            I     ++
Sbjct: 283 EIDALERSR 291


>gi|150375951|ref|YP_001312547.1| von Willebrand factor type A [Sinorhizobium medicae WSM419]
 gi|150030498|gb|ABR62614.1| von Willebrand factor type A [Sinorhizobium medicae WSM419]
          Length = 334

 Score = 98.4 bits (243), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 36/257 (14%), Positives = 82/257 (31%), Gaps = 33/257 (12%)

Query: 117 DIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMI 176
           DI           S + R  +  K    I W      +  P      +  +T+ + D+M+
Sbjct: 40  DITRAAGIGPTEGSVVPRANLLQKIIAPICWLLVLTALARPQFVEPPIE-KTEPQRDLML 98

Query: 177 VLDVSRSMESFFDSSIT-----KIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
            LD+S+SM++   S        ++D     +   +       D     + GLV F +   
Sbjct: 99  ALDLSQSMDTRDFSDPQGNLQARVDAVKTVVADFV-------DRRPYDRLGLVAFGDAPY 151

Query: 232 EFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKII 291
                    + ++  +           +  G                    +     K++
Sbjct: 152 PLVPFTMDHATVRSMLTGALPGMAGPKTALGDALGL---------SIKLFQQSQAPDKVL 202

Query: 292 VFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR-------SHEFLRAC--ASP 342
           V +TDG + ++K           A +    ++ +GI             E L+    A+ 
Sbjct: 203 VVLTDGNDTASKMPPD--KAAEIASQNHIRIHTVGIGNPDAQGEEKLDTETLQKIATATG 260

Query: 343 NSFYLVENPHSMYDAFS 359
             ++  ++  ++ + ++
Sbjct: 261 GRYFFGQDQQALAEIYT 277


>gi|307721534|ref|YP_003892674.1| von Willebrand factor A [Sulfurimonas autotrophica DSM 16294]
 gi|306979627|gb|ADN09662.1| von Willebrand factor type A [Sulfurimonas autotrophica DSM 16294]
          Length = 303

 Score = 98.4 bits (243), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 37/214 (17%), Positives = 66/214 (30%), Gaps = 30/214 (14%)

Query: 162 VKVNSQTDARLDMMIVLDVSRSMESFFDSSIT----KIDMAIKSINAMLEEVKLIPDVNN 217
            +  S      D++  LD S SM     +       K D   + + + + +         
Sbjct: 71  DQKTSSKRKGRDLVFALDTSGSMAESGFNPENVQNRKFDALKELLRSFITK-------RY 123

Query: 218 VVQSGLVTFSNKIEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQG 275
               G+  F         L + +  +   +    +   G ST    GL  A         
Sbjct: 124 NDNVGVSIFGTYAYPAIPLSYDMGSVAFLLDFFDVGIAGDSTAIGEGLAMALKI------ 177

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV--IRSH 333
                  +    +K+I+ +TDG   S            +AKK+   +Y IGI        
Sbjct: 178 -----LKKGEAKEKVIILITDGYQNSG--AVSVKEAVQKAKKQHVKIYTIGIGDRSAFDA 230

Query: 334 EFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
             L+  A  +    +  +N   + D +  I K  
Sbjct: 231 NLLQLIAKNTDAKMFEAKNVKMLQDIYKEIDKLE 264


>gi|182414212|ref|YP_001819278.1| von Willebrand factor type A [Opitutus terrae PB90-1]
 gi|177841426|gb|ACB75678.1| von Willebrand factor type A [Opitutus terrae PB90-1]
          Length = 377

 Score = 98.4 bits (243), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 38/221 (17%), Positives = 68/221 (30%), Gaps = 39/221 (17%)

Query: 171 RLDMMIVLDVSRSMESFFDSSI-TKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229
             D+M+ +D+S SM S        +I+        +   ++   +     + G+V FS +
Sbjct: 110 GYDLMLCIDLSGSMLSEDYERGGDRINRLQA----IKPVIQAFIERRPSDRIGIVLFSGR 165

Query: 230 IEEFFLLEWGVSHLQRKIKYLSK--FGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287
                 L +    L  +++ +        T    GL     ++      +    +     
Sbjct: 166 AYTMAPLTFDHRWLGSQLERIKVGLIEDGTAIGDGLGVGLTRL-----EQAQRESGGKRQ 220

Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIG--------------------- 326
              +V +TDG N               AK RG  VY IG                     
Sbjct: 221 GAFVVLLTDGANNRGS--LTPQQAAELAKARGIPVYTIGAGQDGIVPFPVFDDKGRKLGY 278

Query: 327 --IRVIRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGK 363
             I        LR  A  +   F+   +  ++  AF  I +
Sbjct: 279 RRIMSDLDEGALRDIAEMTGGHFFRAADVGTVESAFRAIDR 319


>gi|85712923|ref|ZP_01043963.1| Uncharacterized protein containing a von Willebrand factor type
           A(vWA) domain [Idiomarina baltica OS145]
 gi|85693229|gb|EAQ31187.1| Uncharacterized protein containing a von Willebrand factor type
           A(vWA) domain [Idiomarina baltica OS145]
          Length = 328

 Score = 98.4 bits (243), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 26/223 (11%), Positives = 69/223 (30%), Gaps = 46/223 (20%)

Query: 169 DARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
           +   ++M+ +D+S SME         ++ +++M    +   +E            + GL+
Sbjct: 83  NEGREIMLAVDLSGSMEIADMTLDGRNVDRLEMVKAVLGDFIER-------RKGDRLGLI 135

Query: 225 TFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            F++       + +  + +Q+ +    L   G  T     +  A                
Sbjct: 136 LFADTAFLQTPITYDRNTVQQMLDESVLGLVGERTAIGDAIALAVK-----------RFK 184

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR----------- 331
                 +++V +TDG+N +     +       AK     +Y I +               
Sbjct: 185 GKQQTNRVLVLLTDGQNTAGNLSPE--QALELAKAYDVRIYPIAVGAEEVVVDSVFGRRK 242

Query: 332 -------SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                      ++  A  +   ++   +   +   +  + +  
Sbjct: 243 VNPSRDLDVPLMQNLADETGGEYFRARSTEELERIYQLLDELE 285


>gi|225621320|ref|YP_002722578.1| von Willebrand factor type A (vWA) domain-containing protein
           [Brachyspira hyodysenteriae WA1]
 gi|225216140|gb|ACN84874.1| von Willebrand factor type A (vWA) domain containing protein
           [Brachyspira hyodysenteriae WA1]
          Length = 289

 Score = 98.4 bits (243), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 39/227 (17%), Positives = 84/227 (37%), Gaps = 47/227 (20%)

Query: 168 TDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFS 227
               + + +V+DVS SM +      T+++ + K++   +++        N  +  LV+F+
Sbjct: 43  NGEGVYISLVVDVSPSMMAEDM-IPTRLEASKKTMIDFIKK-------RNFDKISLVSFA 94

Query: 228 NKIEEFFLLEWGVSHLQRKIKYLSKFG-VSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
            +        +  + L+ +IK +      ST+   G+  A + +  ++   +        
Sbjct: 95  LRASVLSPATFDYTSLEEEIKKIEIDEEGSTSIGLGIATAVDMLRSVKEDNE-------- 146

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR--------------- 331
             KII+ +TDGEN S + D         A      +Y IGI                   
Sbjct: 147 --KIIILLTDGENNSGEID--PKLASEIASNFNIKIYTIGIGDANGSHAWVTYDDPNYGK 202

Query: 332 ---------SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVT 367
                    + E L   A  +   ++  +N  ++ + ++ I +    
Sbjct: 203 RRIRADFTLNEESLIDIAATTGGKYFNAKNASALDNVYNTIDRLEKK 249


>gi|298488105|ref|ZP_07006142.1| von Willebrand factor type A domain protein [Pseudomonas savastanoi
           pv. savastanoi NCPPB 3335]
 gi|298157384|gb|EFH98467.1| von Willebrand factor type A domain protein [Pseudomonas savastanoi
           pv. savastanoi NCPPB 3335]
          Length = 352

 Score = 98.0 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/220 (13%), Positives = 68/220 (30%), Gaps = 45/220 (20%)

Query: 171 RLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+++ +DVS SM+          ++++ +  + +   LE            + GL+ F
Sbjct: 89  GRDLLVAVDVSGSMDYPDMQWKSDEVSRLVLVQQLLGDFLEG-------RKGDRVGLILF 141

Query: 227 SNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
             +      L +    ++  +    +   G +T     +                     
Sbjct: 142 GTQAFVQAPLTYDRRTVRVWLDEAKIGIAGKNTALGDAIGLGLK-----------RLRLR 190

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHE---------- 334
               +++V +TDG N + + D   +     A + G  +Y IGI      +          
Sbjct: 191 PATSRVLVLVTDGANNAGQID--PITAARLAAEEGVKIYPIGIGSDPDKDALQSVLGLNP 248

Query: 335 -------FLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                   L+  A  S   ++   +   +    + +    
Sbjct: 249 SLDLDEPTLKEIASLSGGQYFRARDGDQLEKIRATLDSLE 288


>gi|289624057|ref|ZP_06457011.1| von Willebrand factor type A domain-containing protein [Pseudomonas
           syringae pv. aesculi str. NCPPB3681]
 gi|289650363|ref|ZP_06481706.1| von Willebrand factor type A domain-containing protein [Pseudomonas
           syringae pv. aesculi str. 2250]
 gi|330866187|gb|EGH00896.1| von Willebrand factor type A domain-containing protein [Pseudomonas
           syringae pv. aesculi str. 0893_23]
          Length = 352

 Score = 98.0 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/220 (13%), Positives = 68/220 (30%), Gaps = 45/220 (20%)

Query: 171 RLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+++ +DVS SM+          ++++ +  + +   LE            + GL+ F
Sbjct: 89  GRDLLVAVDVSGSMDYPDMQWKSDEVSRLVLVQQLLGDFLEG-------RKGDRVGLILF 141

Query: 227 SNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
             +      L +    ++  +    +   G +T     +                     
Sbjct: 142 GTQAFVQAPLTYDRRTVRVWLDEAKIGIAGKNTALGDAIGLGLK-----------RLRLR 190

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHE---------- 334
               +++V +TDG N + + D   +     A + G  +Y IGI      +          
Sbjct: 191 PATSRVLVLVTDGANNAGQID--PITAARLAAEEGVKIYPIGIGSDPDKDALQSVLGLNP 248

Query: 335 -------FLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                   L+  A  S   ++   +   +    + +    
Sbjct: 249 SLDLDEPTLKEIASLSGGQYFRARDGDQLEKIRATLDSLE 288


>gi|224370037|ref|YP_002604201.1| hypothetical protein HRM2_29500 [Desulfobacterium autotrophicum
           HRM2]
 gi|223692754|gb|ACN16037.1| conserved hypothetical protein [Desulfobacterium autotrophicum
           HRM2]
          Length = 332

 Score = 98.0 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 35/229 (15%), Positives = 81/229 (35%), Gaps = 50/229 (21%)

Query: 170 ARLDMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVT 225
             +++++ LD+S+SM +         + ++D     +   + +        +  + G+V 
Sbjct: 85  EGINIILALDLSKSMAALDFKLDGAIVNRLDAVKNVVKDFIMK-------RSGDRIGMVV 137

Query: 226 FSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           F ++      L      +   +    +   G ST     +  +  ++ D++         
Sbjct: 138 FGSEAFTQMPLTRDYDTIAFVLSRLKIGAAGPSTAIGDAMGISLKRLEDVKSKS------ 191

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR--------------- 328
                 I++ +TDG++ S +         + A++RG  VY IG+                
Sbjct: 192 -----NIVILLTDGKSNSGEITPG--AAADIARERGVKVYTIGVGQRGKAPFLVNDPLFG 244

Query: 329 -------VIRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                  V   HE L+  A  +  +F+   +  S+   +  I     T+
Sbjct: 245 QRYVYQMVDMDHEALKEIADKTGGAFFAAADTDSLKKIYDMIDSLEKTE 293


>gi|149188658|ref|ZP_01866950.1| hypothetical protein VSAK1_16267 [Vibrio shilonii AK1]
 gi|148837568|gb|EDL54513.1| hypothetical protein VSAK1_16267 [Vibrio shilonii AK1]
          Length = 346

 Score = 98.0 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 30/227 (13%), Positives = 71/227 (31%), Gaps = 33/227 (14%)

Query: 159 TSSVKVNSQTDARLDMMIVLDVSRSMESFFDSS-----ITKIDMAIKSINAMLEEVKLIP 213
           T   +  ++     D+M+ +D+S SM     SS     ++++D     ++  +       
Sbjct: 85  TVLGEPQTREKLGRDVMVAVDLSGSMSEMDFSSSDGQAVSRLDAVKSVLHEFVAT----- 139

Query: 214 DVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIF 271
                 + GL+ F +                  +    ++  G ST+    +  A     
Sbjct: 140 --REGDRLGLILFGDAAYLQTPFTADHDVWLALLDQTEVAMAGQSTHLGDAIGLAIKVFE 197

Query: 272 DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR 331
                    +    + +K++V +TDG +       +       A  +G  ++ I +    
Sbjct: 198 Q--------SESSKDKEKVVVVLTDGNDTG--SFVEPKDAAIVAAAKGVRIHVIAMGDPA 247

Query: 332 -------SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKR 369
                      +   A  S    +   +  ++  A+  IG+      
Sbjct: 248 TIGEQALDMATIDNIASQSGGQAFQALDQEALQQAYRTIGELEPKLY 294


>gi|331012285|gb|EGH92341.1| von Willebrand factor type A domain-containing protein [Pseudomonas
           syringae pv. tabaci ATCC 11528]
          Length = 352

 Score = 98.0 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/220 (13%), Positives = 68/220 (30%), Gaps = 45/220 (20%)

Query: 171 RLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+++ +DVS SM+          ++++ +  + +   LE            + GL+ F
Sbjct: 89  GRDLLVAVDVSGSMDYPDMQWKSDEVSRLVLVQQLLGDFLEG-------RKGDRVGLILF 141

Query: 227 SNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
             +      L +    ++  +    +   G +T     +                     
Sbjct: 142 GTQAFVQAPLTYDRRTVRVWLDEAKIGIAGKNTALGDAIGLGLK-----------RLRLR 190

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHE---------- 334
               +++V +TDG N + + D   +     A + G  +Y IGI      +          
Sbjct: 191 PATSRVLVLVTDGANNAGQID--PITAARLAAEEGVKIYPIGIGADPDKDALQSVLGLNP 248

Query: 335 -------FLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                   L+  A  S   ++   +   +    + +    
Sbjct: 249 SLDLDEPTLKEIASLSGGQYFRARDGDQLEKIRATLDSLE 288


>gi|330989218|gb|EGH87321.1| von Willebrand factor type A domain-containing protein [Pseudomonas
           syringae pv. lachrymans str. M301315]
          Length = 352

 Score = 98.0 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/220 (13%), Positives = 68/220 (30%), Gaps = 45/220 (20%)

Query: 171 RLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+++ +DVS SM+          ++++ +  + +   LE            + GL+ F
Sbjct: 89  GRDLLVAVDVSGSMDYPDMQWKSDEVSRLVLVQQLLGDFLEG-------RKGDRVGLILF 141

Query: 227 SNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
             +      L +    ++  +    +   G +T     +                     
Sbjct: 142 GTQAFVQAPLTYDRRTVRVWLDEAKIGIAGKNTALGDAIGLGLK-----------RLRLR 190

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHE---------- 334
               +++V +TDG N + + D   +     A + G  +Y IGI      +          
Sbjct: 191 PATSRVLVLVTDGANNAGQID--PITAARLAAEEGVKIYPIGIGADPDKDALQSVLGLNP 248

Query: 335 -------FLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                   L+  A  S   ++   +   +    + +    
Sbjct: 249 SLDLDEPTLKEIASLSGGQYFRARDGDQLEKIRATLDSLE 288


>gi|312196190|ref|YP_004016251.1| von Willebrand factor type A [Frankia sp. EuI1c]
 gi|311227526|gb|ADP80381.1| von Willebrand factor type A [Frankia sp. EuI1c]
          Length = 319

 Score = 98.0 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 38/232 (16%), Positives = 77/232 (33%), Gaps = 29/232 (12%)

Query: 154 IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213
           +V+ +    +       R  +++ +DVS SM +   S  +++  A +   A ++++    
Sbjct: 69  MVLALARPARTELVPRERATIVLAIDVSNSMAATDIS-PSRLAAAKQGAQAFVDQLPPKI 127

Query: 214 DVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM 273
           +       GLV+FS               ++  I  L   G +T    G+    + I  +
Sbjct: 128 N------LGLVSFSGTAAVLVPPTTDRDAVKAGINGLQ-LGPATAIGEGIYAGLSAINTV 180

Query: 274 QGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR-- 331
               Q  N+  A     IV ++DGE    + +         AK     V  I        
Sbjct: 181 S--SQFVNSGQAVPPAAIVLLSDGETTRGRPNN---QAAQAAKDAHIPVSTIAYGTPNGT 235

Query: 332 ------------SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKR 369
                       +   L   A  +  S +   +   +   +  +G  I  ++
Sbjct: 236 LDVGGQLIPVPVNEPALSQIAEQTGGSHHRATSGDELTSIYKGLGSSIGYRK 287


>gi|257482758|ref|ZP_05636799.1| von Willebrand factor type A domain-containing protein [Pseudomonas
           syringae pv. tabaci ATCC 11528]
          Length = 265

 Score = 98.0 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/220 (13%), Positives = 68/220 (30%), Gaps = 45/220 (20%)

Query: 171 RLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+++ +DVS SM+          ++++ +  + +   LE            + GL+ F
Sbjct: 2   GRDLLVAVDVSGSMDYPDMQWKSDEVSRLVLVQQLLGDFLEG-------RKGDRVGLILF 54

Query: 227 SNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
             +      L +    ++  +    +   G +T     +                     
Sbjct: 55  GTQAFVQAPLTYDRRTVRVWLDEAKIGIAGKNTALGDAIGLGLK-----------RLRLR 103

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHE---------- 334
               +++V +TDG N + + D   +     A + G  +Y IGI      +          
Sbjct: 104 PATSRVLVLVTDGANNAGQID--PITAARLAAEEGVKIYPIGIGADPDKDALQSVLGLNP 161

Query: 335 -------FLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                   L+  A  S   ++   +   +    + +    
Sbjct: 162 SLDLDEPTLKEIASLSGGQYFRARDGDQLEKIRATLDSLE 201


>gi|71737462|ref|YP_275714.1| von Willebrand factor type A domain-containing protein [Pseudomonas
           syringae pv. phaseolicola 1448A]
 gi|71558015|gb|AAZ37226.1| von Willebrand factor type A domain protein [Pseudomonas syringae
           pv. phaseolicola 1448A]
 gi|320329710|gb|EFW85699.1| von Willebrand factor type A domain-containing protein [Pseudomonas
           syringae pv. glycinea str. race 4]
 gi|330882170|gb|EGH16319.1| von Willebrand factor type A domain-containing protein [Pseudomonas
           syringae pv. glycinea str. race 4]
          Length = 352

 Score = 98.0 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/220 (13%), Positives = 68/220 (30%), Gaps = 45/220 (20%)

Query: 171 RLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+++ +DVS SM+          ++++ +  + +   LE            + GL+ F
Sbjct: 89  GRDLLVAVDVSGSMDYPDMQWKSDEVSRLVLVQQLLGDFLEG-------RKGDRVGLILF 141

Query: 227 SNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
             +      L +    ++  +    +   G +T     +                     
Sbjct: 142 GTQAFVQAPLTYDRRTVRVWLDEAKIGIAGKNTALGDAIGLGLK-----------RLRLR 190

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHE---------- 334
               +++V +TDG N + + D   +     A + G  +Y IGI      +          
Sbjct: 191 PATSRVLVLVTDGANNAGQID--PITAARLAAEEGVKIYPIGIGADPDKDALQSVLGLNP 248

Query: 335 -------FLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                   L+  A  S   ++   +   +    + +    
Sbjct: 249 SLDLDEPTLKEIASLSGGQYFRARDGDQLEKIRATLDSLE 288


>gi|313681552|ref|YP_004059290.1| von willebrand factor type a [Sulfuricurvum kujiense DSM 16994]
 gi|313154412|gb|ADR33090.1| von Willebrand factor type A [Sulfuricurvum kujiense DSM 16994]
          Length = 311

 Score = 98.0 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 35/209 (16%), Positives = 66/209 (31%), Gaps = 26/209 (12%)

Query: 168 TDARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGL 223
               +D+++ LD S SM +         +++ ++  K  +  + +             G+
Sbjct: 86  NRNGIDIVLSLDGSGSMNASGFSKEEPRLSRFEVVQKIASDFVMK-------RIEDNVGV 138

Query: 224 VTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           V F +       + +    +   I YLS      N+  G   A                +
Sbjct: 139 VLFGDFAFIATPVTYEKEIVSEMIGYLSHGMAGQNTAIGEGIAMGV---------RALRD 189

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR--VIRSHEFLRACAS 341
                K+I+ +TDGE+ S               K    +Y IGI       +  L+  A 
Sbjct: 190 SKAKSKVIILLTDGEHNSGSIS--PKEAVAMVGKEHIRLYTIGIGQKGEFDNALLKQLAH 247

Query: 342 PNS--FYLVENPHSMYDAFSHIGKDIVTK 368
                F+   N   +   +  I     +K
Sbjct: 248 DGHGKFFAAANEKELQSVYDEIDMLERSK 276


>gi|285019106|ref|YP_003376817.1| von willebrand factor, type a protein [Xanthomonas albilineans GPE
           PC73]
 gi|283474324|emb|CBA16825.1| putative von willebrand factor, type a protein [Xanthomonas
           albilineans]
          Length = 343

 Score = 98.0 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 30/224 (13%), Positives = 69/224 (30%), Gaps = 47/224 (20%)

Query: 173 DMMIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
            +M+ +D+S SM           + ++  A   +   L       D  +  + GL+ F  
Sbjct: 106 QLMLAVDLSGSMSDPDMRLGGRVVDRLTAAKAVLADFL-------DRRDGDRIGLLVFGQ 158

Query: 229 KIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
           +      L   ++ ++ +++   +   G  T     +  A                E   
Sbjct: 159 QAYALTPLTADLATVRDQLRDSVVGLAGRETALGDAIALAVK-----------RLREQPQ 207

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI---------------- 330
            +++++ +TDG N +       L     AK     VY I +                   
Sbjct: 208 GERVLILLTDGVNTAG--VLDPLKAAELAKAEHVRVYTIALGGDGGGMSLFGMPIPGSGG 265

Query: 331 ---RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKR 369
                 + LR  A  +   F+   +   +   ++ + +    + 
Sbjct: 266 DDEVDEDTLRKIAQDTGGRFFRARDTAQLASIYAELDRLEPVRS 309


>gi|33152377|ref|NP_873730.1| tight adherence protein G [Haemophilus ducreyi 35000HP]
 gi|21326716|gb|AAL92476.1| TadG [Haemophilus ducreyi]
 gi|33148600|gb|AAP96119.1| tight adherence protein G [Haemophilus ducreyi 35000HP]
          Length = 562

 Score = 98.0 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 35/248 (14%), Positives = 86/248 (34%), Gaps = 25/248 (10%)

Query: 9   RNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNE 68
           + F  N  G   I  A+    I  +L + +EV+ I   K  L+  ++++++    +  + 
Sbjct: 12  KRFIQNQSGVYIIFGALLTLPIVALLFVSLEVAGIIQDKARLNDALEQAVLSLTAENNSG 71

Query: 69  -------------GNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTS 115
                         NG      + G    +I  T+   +  ++ +N    +     ++ +
Sbjct: 72  RKSYDYALTNAEKANGKYLADSEAGKRDSQIVKTFVKLYLPQIDENTMKFEPICTTQNNA 131

Query: 116 LDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDA----- 170
           +      Q    S          +   +  P       I+    S    +          
Sbjct: 132 ITPKNGKQYAYSSSHVTCTVTGSINHRSLFPMTVGKSKIIPEQVSLSSGSMAQKINNVNL 191

Query: 171 RLDMMIVLDVSRSMESFFDSSI-------TKIDMAIKSINAMLEEVKLIPDVNNVVQSGL 223
            LD+M+V D+S SM+   ++         +K+ +  + +  + ++  L  + N   +  +
Sbjct: 192 PLDLMVVADLSGSMDYNINNHKVYSNTEASKLTLLKQVLEELTDKYLLSEEANPNNRISM 251

Query: 224 VTFSNKIE 231
           + F+   +
Sbjct: 252 IPFAMGAQ 259



 Score = 37.9 bits (86), Expect = 2.7,   Method: Composition-based stats.
 Identities = 19/127 (14%), Positives = 43/127 (33%), Gaps = 3/127 (2%)

Query: 241 SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENL 300
           +  Q++I +++   ++ N   G +  +N+    + +  H      NY   +   T+    
Sbjct: 421 NWYQKEIPFMNFSRITENLILGKQELFNKSPQSKNLENHIYGYRYNYPIYLTNNTEKIQT 480

Query: 301 STKEDQQSLYYCNEAKKRGAIVYAI--GIRVIRSHEFLRACASPNSFYLVENPHSMYDAF 358
               D        + K     +  +  G        +L       ++Y   +  S+ +AF
Sbjct: 481 KGLCDVIRDKLNTKNKDNNTKIIFVELGYNSSSKDTWLHCVGGTQNYYSATSKESLLEAF 540

Query: 359 SH-IGKD 364
              I K 
Sbjct: 541 KQAISKS 547


>gi|330963348|gb|EGH63608.1| von Willebrand factor type A domain-containing protein [Pseudomonas
           syringae pv. actinidiae str. M302091]
          Length = 352

 Score = 98.0 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 30/220 (13%), Positives = 69/220 (31%), Gaps = 45/220 (20%)

Query: 171 RLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+++ +DVS SM+          ++++ +  + +   LE            + GL+ F
Sbjct: 89  GRDLLVAVDVSGSMDYPDMQWKSDEVSRLVLVQQLLGDFLEG-------RKGDRVGLILF 141

Query: 227 SNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
             +      L +    ++  +    +   G +T     +  A                  
Sbjct: 142 GTQAFVQAPLTYDRRTVRVWLDEAKIGIAGKNTAVGDAIGLALK-----------RLRLR 190

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHE---------- 334
               +++V +TDG N + + D   +     A + G  +Y IGI      +          
Sbjct: 191 PANSRVLVLVTDGANNAGQID--PITAARLAAEEGVKIYPIGIGSDPDKDALQSVLGLNP 248

Query: 335 -------FLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                   L+  A  S   ++   +   +    + +    
Sbjct: 249 SLDLDEPTLKEIASISGGQYFRARDGDQLEKIRATLDALE 288


>gi|310823567|ref|YP_003955925.1| Bata protein [Stigmatella aurantiaca DW4/3-1]
 gi|309396639|gb|ADO74098.1| BatA protein [Stigmatella aurantiaca DW4/3-1]
          Length = 302

 Score = 98.0 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 30/229 (13%), Positives = 70/229 (30%), Gaps = 47/229 (20%)

Query: 170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229
             +D+++ LD+S SME+       ++ +A + +   +             + GLV F+  
Sbjct: 56  EGIDIVVALDLSTSMEAGDFRPQNRLHVAKEVLAEFISN-------RVNDRIGLVVFAGA 108

Query: 230 IEEFFLLEWGVSHLQRKIKYLSKF--GVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287
                 L      ++  +K +        T                     +   +    
Sbjct: 109 AYTQAPLTLDYGVVREVLKQIRTRVLEDGTAIGDA-----------LATSLNRLRDSEAK 157

Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV------------------ 329
            +++V +TDG+N + K     L   + A+     +Y I +                    
Sbjct: 158 SRVVVLITDGDNNAGKIS--PLDAASMAESLKIPIYTILVGKGGKVPFPQGQDLFGNTVW 215

Query: 330 -----IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKRIW 371
                  + E L+  A  +   +Y   +P  +      +   +   ++ 
Sbjct: 216 RDTEIPINPELLQDIASRTGGEYYRATDPEGLKQGLQKVLDSLERSKLM 264


>gi|213968792|ref|ZP_03396933.1| von Willebrand factor type A domain protein [Pseudomonas syringae
           pv. tomato T1]
 gi|213926395|gb|EEB59949.1| von Willebrand factor type A domain protein [Pseudomonas syringae
           pv. tomato T1]
          Length = 328

 Score = 98.0 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 30/220 (13%), Positives = 69/220 (31%), Gaps = 45/220 (20%)

Query: 171 RLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+++ +DVS SM+          ++++ +  + +   LE            + GL+ F
Sbjct: 65  GRDLLVAVDVSGSMDYPDMQWKSDEVSRLVLVQQLLGDFLEG-------RKGDRVGLILF 117

Query: 227 SNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
             +      L +    ++  +    +   G +T     +  A                  
Sbjct: 118 GTQAFVQAPLTYDRRTVRVWLDEAKIGIAGKNTAVGDAIGLALK-----------RLRLR 166

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHE---------- 334
               +++V +TDG N + + D   +     A + G  +Y IGI      +          
Sbjct: 167 PANSRVLVLVTDGANNAGQID--PITAARLAAEEGVKIYPIGIGSDPDKDALQSALGLSP 224

Query: 335 -------FLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                   L+  A  S   ++   +   +    + +    
Sbjct: 225 SLDLDEPTLKEIASISGGQYFRARDGDQLEKIRATLDALE 264


>gi|28870917|ref|NP_793536.1| von Willebrand factor type A domain-containing protein [Pseudomonas
           syringae pv. tomato str. DC3000]
 gi|301385766|ref|ZP_07234184.1| von Willebrand factor type A domain protein [Pseudomonas syringae
           pv. tomato Max13]
 gi|302061830|ref|ZP_07253371.1| von Willebrand factor type A domain protein [Pseudomonas syringae
           pv. tomato K40]
 gi|302134226|ref|ZP_07260216.1| von Willebrand factor type A domain protein [Pseudomonas syringae
           pv. tomato NCPPB 1108]
 gi|28854166|gb|AAO57231.1| von Willebrand factor type A domain protein [Pseudomonas syringae
           pv. tomato str. DC3000]
 gi|331018299|gb|EGH98355.1| von Willebrand factor type A domain protein [Pseudomonas syringae
           pv. lachrymans str. M302278PT]
          Length = 352

 Score = 98.0 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 30/220 (13%), Positives = 69/220 (31%), Gaps = 45/220 (20%)

Query: 171 RLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+++ +DVS SM+          ++++ +  + +   LE            + GL+ F
Sbjct: 89  GRDLLVAVDVSGSMDYPDMQWKSDEVSRLVLVQQLLGDFLEG-------RKGDRVGLILF 141

Query: 227 SNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
             +      L +    ++  +    +   G +T     +  A                  
Sbjct: 142 GTQAFVQAPLTYDRRTVRVWLDEAKIGIAGKNTAVGDAIGLALK-----------RLRLR 190

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHE---------- 334
               +++V +TDG N + + D   +     A + G  +Y IGI      +          
Sbjct: 191 PANSRVLVLVTDGANNAGQID--PITAARLAAEEGVKIYPIGIGSDPDKDALQSALGLSP 248

Query: 335 -------FLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                   L+  A  S   ++   +   +    + +    
Sbjct: 249 SLDLDEPTLKEIASISGGQYFRARDGDQLEKIRATLDALE 288


>gi|240172225|ref|ZP_04750884.1| hypothetical protein MkanA1_23119 [Mycobacterium kansasii ATCC
           12478]
          Length = 335

 Score = 98.0 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 32/216 (14%), Positives = 64/216 (29%), Gaps = 30/216 (13%)

Query: 174 MMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEF 233
           +M+V+DVS+SM +       ++  A ++     +E+    +       GL+ ++      
Sbjct: 99  VMLVIDVSQSMRATD-VEPNRMVAAQEAAKQFADELTPGIN------LGLIAYAGTATVL 151

Query: 234 FLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVF 293
                     +  +  L  F   T +   +  A   I  +          D      IV 
Sbjct: 152 VSPTTNRDATKNALDKLQ-FADRTATGEAIFTALQAIATV---GAVIGGGDTPPPARIVL 207

Query: 294 MTDGENLSTKEDQQSL---YYCNEAKKRGAIVYAIGIRVIR--------------SHEFL 336
            +DG+                   AK +G  +  I                      E L
Sbjct: 208 FSDGKETMPTNPDNPKGAFTAARTAKDQGVPISTISFGTPYGFVEINGQRQPVPVDDETL 267

Query: 337 RACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           +  A  S  + Y       +   ++ + + I  + I
Sbjct: 268 KKVAQLSGGNAYNAATLAELKSVYASLQQQIGYETI 303


>gi|32475925|ref|NP_868919.1| hypothetical protein RB9502 [Rhodopirellula baltica SH 1]
 gi|32446468|emb|CAD76304.1| conserved hypothetical protein [Rhodopirellula baltica SH 1]
          Length = 368

 Score = 98.0 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 31/219 (14%), Positives = 70/219 (31%), Gaps = 33/219 (15%)

Query: 166 SQTDARLDMMIVLDVSRSMESFFDSS-----ITKIDMAIKSINAMLEEVKLIPDVNNVVQ 220
           ++     D+++++D+S SM      +     ++++D   + ++  L +           +
Sbjct: 109 TKEIPTRDLLLLVDLSGSMAQEDFKNDAGKKVSRLDAVKEVLDGFLAK-------RKGDR 161

Query: 221 SGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHC 280
            GLV F +           +   Q  +           +  G                  
Sbjct: 162 VGLVVFGDAAYLQAPFTTDLQLSQELLGECEVGMAGPRTAFGDAIGLGVNL--------- 212

Query: 281 NTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR-------SH 333
             ED    K I+ +TDG +   K     +     A +R   +Y + I             
Sbjct: 213 FDEDTERAKTIIALTDGNDT--KSKVPPVEAARVATQRDIKIYTVAIGDPTTVGEDKLDE 270

Query: 334 EFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           + L+  A  +   ++   +   +   +  + K I T+ I
Sbjct: 271 QSLKDVASETGGKYFFAADREHLAGIYDELDK-IETQTI 308


>gi|256376278|ref|YP_003099938.1| hypothetical protein Amir_2147 [Actinosynnema mirum DSM 43827]
 gi|255920581|gb|ACU36092.1| von Willebrand factor type A [Actinosynnema mirum DSM 43827]
          Length = 321

 Score = 98.0 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 37/233 (15%), Positives = 79/233 (33%), Gaps = 29/233 (12%)

Query: 153 HIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLI 212
            + + +            R  +M+V+DVS SM++      T+++ A  +  +  E +   
Sbjct: 70  LLTVALAGPTAEQKVPRNRATVMLVIDVSLSMKATD-VQPTRLEAAQVAAKSFAEGLTPG 128

Query: 213 PDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFD 272
            +       GL++F+             S + + I  L     ST +   +  A + I  
Sbjct: 129 IN------LGLISFAGSATVLVAPTTDRSAVSQGIDGLK-LAQSTATGDAIVAALSAIDS 181

Query: 273 MQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV--- 329
                +     D      +V MTDG+       +++     +AK+ G  +  I       
Sbjct: 182 F---GKVVGGADGPPPARVVLMTDGKETVGT--RKATDAAGDAKEAGIPISTISFGTERG 236

Query: 330 -----------IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKR 369
                          E ++  A  S   F+   +   +   +  +G+ I  ++
Sbjct: 237 SVDINGKAQEVPVDDESMKEIAKISGGEFFKAASAEELRRVYDTLGEQIGYEK 289


>gi|229493542|ref|ZP_04387327.1| von Willebrand factor type A domain protein [Rhodococcus
           erythropolis SK121]
 gi|229319503|gb|EEN85339.1| von Willebrand factor type A domain protein [Rhodococcus
           erythropolis SK121]
          Length = 326

 Score = 97.6 bits (241), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 33/255 (12%), Positives = 70/255 (27%), Gaps = 30/255 (11%)

Query: 130 SAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFD 189
                     +    I          + +            R  +++V+DVS SM++   
Sbjct: 47  KVAPSRPGRWRHIPAILMVIALVFFTVALAGPTADKKVPRNRATVILVIDVSLSMQATD- 105

Query: 190 SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKY 249
              T++  A ++  +  + +    +       GLV F+                +  I  
Sbjct: 106 VEPTRLAAAQEAAKSFADGLTPGIN------LGLVAFAGTASVLVSPTTNRDATKVAIDN 159

Query: 250 LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSL 309
           L      T +   +  +   I     +       D      IV ++DG+    +      
Sbjct: 160 LKLSER-TATGEAIFTSLQSIDT---LSAVLGGSDQAPPARIVLLSDGKQTVPENSDDPR 215

Query: 310 ---YYCNEAKKRGAIVYAIGIRV--------------IRSHEFLRACA--SPNSFYLVEN 350
                  +AK +G  +  I                        L+  A  S  SF+   +
Sbjct: 216 GGFTAARQAKDKGVPISTISFGTTYGRVEIEGDRIPVPVDDASLKEIANLSGGSFFTASS 275

Query: 351 PHSMYDAFSHIGKDI 365
              +   +  + + I
Sbjct: 276 LEELRQVYDTLEEQI 290


>gi|119476361|ref|ZP_01616712.1| batB protein, putative [marine gamma proteobacterium HTCC2143]
 gi|119450225|gb|EAW31460.1| batB protein, putative [marine gamma proteobacterium HTCC2143]
          Length = 354

 Score = 97.6 bits (241), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 31/226 (13%), Positives = 73/226 (32%), Gaps = 51/226 (22%)

Query: 171 RLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+++ +D+S SM+          + +I      +N  ++            + GL+ F
Sbjct: 89  GRDLLLAVDLSGSMKIEDMEVNGDRVPRIVAVKTVLNEFIQR-------RKGDRLGLILF 141

Query: 227 SNKIEEFFLLEWGVSHLQRKIK--YLSKFGV-STNSTPGLKYAYNQIFDMQGMRQHCNTE 283
            ++      L +  + +QR ++   +   G  +T                 G+      +
Sbjct: 142 GSQAYVQAPLTFDQTTVQRFMREAQIGFAGEENTAIGDA-----------IGLSVKRLRD 190

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR------------ 331
               + +++ +TDG+N   K +         A   G I+Y IG+                
Sbjct: 191 RPGDRHVMILLTDGQNNGGKINPIP--ASKIAANNGIIIYTIGVGADEMVMPGVLGSSFG 248

Query: 332 ----------SHEFLRACAS--PNSFYLVENPHSMYDAFSHIGKDI 365
                       + L+  A+     ++   NP  +   +  + +  
Sbjct: 249 SRRVNPSADLDEKTLQQVATATGGQYFRARNPQELEKIYRLLDQLE 294


>gi|312794604|ref|YP_004027527.1| von willebrand factor type a [Caldicellulosiruptor kristjanssonii
           177R1B]
 gi|312181744|gb|ADQ41914.1| von Willebrand factor type A [Caldicellulosiruptor kristjanssonii
           177R1B]
          Length = 900

 Score = 97.6 bits (241), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 46/210 (21%), Positives = 75/210 (35%), Gaps = 22/210 (10%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
           + +  +D+M+VLD S SM    D+ I K+++A  +   M+E ++    V  +       +
Sbjct: 401 EKEKNIDVMLVLDHSGSMADTEDAGIPKLEIAKSASAKMVEHLESSDGVGVIAFDHNYYW 460

Query: 227 SNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
           + K    F        +   I  +   G  T                         +   
Sbjct: 461 AYK----FGKLVRKEDVIESISSIE-VGGGTAI-----------IPPLSEAVKTLKKSKA 504

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA--SPNS 344
             K++V +TDG      E        +EAK+    +  IG+    +   L   A  +   
Sbjct: 505 KNKLVVLLTDGM----GEQSGYEIPADEAKRNNIKITTIGVGKFVNASVLSWIAAYTSGR 560

Query: 345 FYLVENPHSMYDAFSHIGKDIVTKRIWYDK 374
           FYLV NP  + D F    K I  K I   K
Sbjct: 561 FYLVSNPSELVDVFLKETKIIKGKYIKEKK 590


>gi|237808477|ref|YP_002892917.1| von Willebrand factor type A [Tolumonas auensis DSM 9187]
 gi|237500738|gb|ACQ93331.1| von Willebrand factor type A [Tolumonas auensis DSM 9187]
          Length = 316

 Score = 97.6 bits (241), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 26/210 (12%), Positives = 66/210 (31%), Gaps = 27/210 (12%)

Query: 166 SQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVT 225
            Q+    D+++ +D+S+SM+    +   +   A+  ++ +   ++         + G++ 
Sbjct: 81  VQSFPSRDLLLAVDISQSMQIKDMTINGE---AVDRLSMVKSYLQSFIKQRQGDRIGIIL 137

Query: 226 FSNKIEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           F++                  +    +   G  T     +  A  +              
Sbjct: 138 FADHAYLMVPFTQDWQAAGLLLDEVNIGLAGKFTAIGEAITLAVKKTLH---------EP 188

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR---------SHE 334
                K ++ ++DG++  +    Q       AK  G  +Y IGI                
Sbjct: 189 KPIQNKTLILLSDGKD--SINTIQPTDAAALAKASGLKIYTIGIGSDSTDAEAESDLDET 246

Query: 335 FLRACA--SPNSFYLVENPHSMYDAFSHIG 362
            L   A  +   ++   +   + + +  I 
Sbjct: 247 TLEEIANMTGGQYFRARSEQDLSEIYQQIN 276


>gi|126664966|ref|ZP_01735949.1| hypothetical protein MELB17_17899 [Marinobacter sp. ELB17]
 gi|126630336|gb|EBA00951.1| hypothetical protein MELB17_17899 [Marinobacter sp. ELB17]
          Length = 341

 Score = 97.6 bits (241), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 30/220 (13%), Positives = 69/220 (31%), Gaps = 44/220 (20%)

Query: 170 ARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVT 225
              D+M+V+D+S SM+          I ++    + +   +++           + GL+ 
Sbjct: 86  TGRDLMLVVDISPSMDEPDMVRQGRRINRLQAVKQVLAEFIDQ-------RQGDRLGLIL 138

Query: 226 FSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           F ++      L +  + +   ++   L   G +T     +  A                E
Sbjct: 139 FGSQAYVQAPLTFDRTTVNILLQEAGLGMAGNATAIGDAVGLAVK-----------RLRE 187

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRS----------- 332
               +++ + +TDG N + +           A+     +Y IGI                
Sbjct: 188 RPLEQRVAIVLTDGANTAGEITPD--KASELAQASAVRLYTIGIGAGADSAITGLLQRNP 245

Query: 333 -----HEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                   L   A  +   ++   N   +   ++ I +  
Sbjct: 246 SRDLDEALLTRMAQQTGGQYFRARNLAELGGIYTSINQLE 285


>gi|325678004|ref|ZP_08157643.1| von Willebrand factor type A domain protein [Ruminococcus albus 8]
 gi|324110284|gb|EGC04461.1| von Willebrand factor type A domain protein [Ruminococcus albus 8]
          Length = 812

 Score = 97.6 bits (241), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 30/198 (15%), Positives = 64/198 (32%), Gaps = 27/198 (13%)

Query: 170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229
             L   I  D S SM         K+ +              I  +    ++ L++F ++
Sbjct: 241 EPLAAAICYDCSGSMSGNDPKGYRKLAI-----------DNFIDSMTLTDKTALISFEDE 289

Query: 230 IEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
            +           L+  +     FG  TN    ++ A           +  NT    Y +
Sbjct: 290 AKLVSEFSDNKEELKGLVN--PYFGGGTNVRASVEMAI----------EQLNTVQHWYTR 337

Query: 290 IIVFMTDGENLSTKE--DQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA--SPNSF 345
            I+ ++DG+        +        +A      ++ IG+     ++ L+ CA  +   +
Sbjct: 338 HIILLSDGDVNININLANNTVDDLIKKAVDNNIKIHTIGLGSGADNQKLKDCAEYTGGQY 397

Query: 346 YLVENPHSMYDAFSHIGK 363
           +  E    +   +  + K
Sbjct: 398 FTAETAEKLDAIYKDLSK 415


>gi|261212659|ref|ZP_05926943.1| protein BatA [Vibrio sp. RC341]
 gi|260837724|gb|EEX64401.1| protein BatA [Vibrio sp. RC341]
          Length = 232

 Score = 97.6 bits (241), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 29/217 (13%), Positives = 71/217 (32%), Gaps = 46/217 (21%)

Query: 175 MIVLDVSRSMESFFDS----SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
           M+V+D+S SM           + ++    + ++  + +           + GL+ F++  
Sbjct: 1   MLVVDLSYSMSQEDMQSGQQMVDRLTAVKQVLSDFIAK-------REGDRIGLILFADHA 53

Query: 231 EEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
                L      + +++    L   G  T    G+  A                +    +
Sbjct: 54  YLQTPLTLDRETVTQQLNQAVLKLIGTQTAIGEGIGLATKIFI-----------DSDAPQ 102

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV------------------I 330
           ++I+ ++DG N +       L   N AK+  + +Y +G+                     
Sbjct: 103 RVIILLSDGSNTAG--VLDPLEAANIAKQYHSTIYTVGVGAGEMVVKDFLFSRKVNTAQD 160

Query: 331 RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
              + L+  A  +   ++   N   + + +  I +  
Sbjct: 161 LDEKTLQTIASTTGGQYFRARNQQDLQNIYDTINQLE 197


>gi|108762540|ref|YP_633801.1| BatA protein [Myxococcus xanthus DK 1622]
 gi|108466420|gb|ABF91605.1| batA protein [Myxococcus xanthus DK 1622]
          Length = 336

 Score = 97.6 bits (241), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 32/229 (13%), Positives = 72/229 (31%), Gaps = 47/229 (20%)

Query: 170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229
             +D+++ LD+S SME+       ++ +A + ++  +             + GLV F+  
Sbjct: 90  EGIDIVVALDLSTSMEAGDFRPQNRMHVAKEVLSEFIAN-------RVNDRIGLVVFAGA 142

Query: 230 IEEFFLLEWGVSHLQRKIKYLSKF--GVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287
                 L      L+  +K L        T                     +   +    
Sbjct: 143 AYTQAPLTLDYGVLKEVVKQLRTRVLEDGTAIGDA-----------LATSLNRLRDSEAK 191

Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV------------------ 329
            +++V +TDG+N S K     +   N A+     +Y I +                    
Sbjct: 192 SRVVVLITDGDNNSGKIS--PMDSANMAQALKVPIYTILVGKGGKVPFPQGTDLFGNTVW 249

Query: 330 -----IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKRIW 371
                  + E ++  A  +   +Y   +P  + +    +   +   ++ 
Sbjct: 250 RDTEIPINPELMQDIADRTGGEYYRATDPEQLREGLQKVLDSLERSKLM 298


>gi|226306560|ref|YP_002766520.1| hypothetical protein RER_30730 [Rhodococcus erythropolis PR4]
 gi|226185677|dbj|BAH33781.1| conserved hypothetical membrane protein [Rhodococcus erythropolis
           PR4]
          Length = 326

 Score = 97.6 bits (241), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 33/255 (12%), Positives = 70/255 (27%), Gaps = 30/255 (11%)

Query: 130 SAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFD 189
                     +    I          + +            R  +++V+DVS SM++   
Sbjct: 47  KVAPSRPGRWRHIPAILMVVALVFFTVALAGPTADKKVPRNRATVILVIDVSLSMQATD- 105

Query: 190 SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKY 249
              T++  A ++  +  + +    +       GLV F+                +  I  
Sbjct: 106 VEPTRLAAAQEAAKSFADGLTPGIN------LGLVAFAGTASVLVSPTTNRDATKVAIDN 159

Query: 250 LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSL 309
           L      T +   +  +   I     +       D      IV ++DG+    +      
Sbjct: 160 LKLSER-TATGEAIFTSLQSIDT---LSAVLGGSDQAPPARIVLLSDGKQTVPENSDDPR 215

Query: 310 ---YYCNEAKKRGAIVYAIGIRV--------------IRSHEFLRACA--SPNSFYLVEN 350
                  +AK +G  +  I                        L+  A  S  SF+   +
Sbjct: 216 GGFTAARQAKDKGVPISTISFGTTYGRVEIEGDRIPVPVDDASLKEIANLSGGSFFTASS 275

Query: 351 PHSMYDAFSHIGKDI 365
              +   +  + + I
Sbjct: 276 LEELRQVYDTLEEQI 290


>gi|115379116|ref|ZP_01466240.1| von Willebrand factor type A domain, putative [Stigmatella
           aurantiaca DW4/3-1]
 gi|115363899|gb|EAU63010.1| von Willebrand factor type A domain, putative [Stigmatella
           aurantiaca DW4/3-1]
          Length = 284

 Score = 97.2 bits (240), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 30/229 (13%), Positives = 70/229 (30%), Gaps = 47/229 (20%)

Query: 170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229
             +D+++ LD+S SME+       ++ +A + +   +             + GLV F+  
Sbjct: 38  EGIDIVVALDLSTSMEAGDFRPQNRLHVAKEVLAEFISN-------RVNDRIGLVVFAGA 90

Query: 230 IEEFFLLEWGVSHLQRKIKYLSKF--GVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287
                 L      ++  +K +        T                     +   +    
Sbjct: 91  AYTQAPLTLDYGVVREVLKQIRTRVLEDGTAIGDA-----------LATSLNRLRDSEAK 139

Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV------------------ 329
            +++V +TDG+N + K     L   + A+     +Y I +                    
Sbjct: 140 SRVVVLITDGDNNAGKIS--PLDAASMAESLKIPIYTILVGKGGKVPFPQGQDLFGNTVW 197

Query: 330 -----IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKRIW 371
                  + E L+  A  +   +Y   +P  +      +   +   ++ 
Sbjct: 198 RDTEIPINPELLQDIASRTGGEYYRATDPEGLKQGLQKVLDSLERSKLM 246


>gi|222528098|ref|YP_002571980.1| von Willebrand factor type A [Caldicellulosiruptor bescii DSM 6725]
 gi|222454945|gb|ACM59207.1| von Willebrand factor type A [Caldicellulosiruptor bescii DSM 6725]
          Length = 902

 Score = 97.2 bits (240), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 49/216 (22%), Positives = 78/216 (36%), Gaps = 22/216 (10%)

Query: 161 SVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQ 220
               N + +  +D+++VLD S SM    D+ I K+++A  +   M+E ++    V  +  
Sbjct: 395 MEIKNKEKEKNIDVVLVLDHSGSMADTEDAGIPKLEIAKSASAKMIEHLESSDGVGVIAF 454

Query: 221 SGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHC 280
                ++ K    F        +   I  +   G  T   P L  A   +   +   +  
Sbjct: 455 DHNYYWAYK----FGKISKKEDVIESISSIE-VGGGTAIIPPLSEAVKTLKKSKAKSKL- 508

Query: 281 NTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA 340
                     IV +TDG               NEAK+    +  IG+    +   L   A
Sbjct: 509 ----------IVLLTDGMGEQGG----YEIPANEAKRNNIKITTIGVGKYVNATVLSWIA 554

Query: 341 --SPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYDK 374
             +   FYLV NP  + D F    K I  K I   K
Sbjct: 555 SFTSGRFYLVSNPSELVDVFLKETKIIKGKYIKEKK 590


>gi|312877126|ref|ZP_07737097.1| von Willebrand factor type A [Caldicellulosiruptor lactoaceticus
           6A]
 gi|311796100|gb|EFR12458.1| von Willebrand factor type A [Caldicellulosiruptor lactoaceticus
           6A]
          Length = 900

 Score = 97.2 bits (240), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 45/210 (21%), Positives = 75/210 (35%), Gaps = 22/210 (10%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
           + +  +D+++VLD S SM    D+ I K+++A  +   M+E ++    V  +       +
Sbjct: 401 EKEKNIDVVLVLDHSGSMADTEDAGIPKLEIAKSASAKMVEHLESSDGVGVIAFDHNYYW 460

Query: 227 SNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
           + K    F        +   I  +   G  T                         +   
Sbjct: 461 AYK----FGKLVRKEDVIESISSIE-VGGGTAI-----------IPPLSEAVKTLKKSKA 504

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA--SPNS 344
             K++V +TDG      E        +EAK+    +  IG+    +   L   A  +   
Sbjct: 505 KNKLVVLLTDGM----GEQSGYEIPADEAKRNNIKITTIGVGKFVNASVLSWIADYTSGR 560

Query: 345 FYLVENPHSMYDAFSHIGKDIVTKRIWYDK 374
           FYLV NP  + D F    K I  K I   K
Sbjct: 561 FYLVSNPSELVDVFLKETKIIKGKYIKEKK 590


>gi|194335401|ref|YP_002017195.1| von Willebrand factor type A [Pelodictyon phaeoclathratiforme BU-1]
 gi|194307878|gb|ACF42578.1| von Willebrand factor type A [Pelodictyon phaeoclathratiforme BU-1]
          Length = 336

 Score = 97.2 bits (240), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 38/220 (17%), Positives = 74/220 (33%), Gaps = 42/220 (19%)

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
            +D+++ LD+S SM        +++D A +     +          +  + GLV F  K 
Sbjct: 98  GIDVILALDISESMLQKDVGGTSRLDAAREVSRNFVLR-------RSNDRIGLVVFRGKG 150

Query: 231 EEFFLLEWGVSHLQRKIKYLSK---FGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287
                L      L   +  LS        T     +  A            +      + 
Sbjct: 151 YTQCPLTLDHEVLAMLLDRLSPGVIQDDGTAIGTAILIAV-----------NRLKASESL 199

Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAI--GIRV---------------I 330
            K+++ +TDGEN + +    +    + A + G  +Y I  G +V                
Sbjct: 200 HKVLILVTDGENNAGEVGPGT--AASIAARSGVRIYVINAGFKVVEDRIDPPEESGRYIQ 257

Query: 331 RSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
           +  E L+  A  +   ++ VE+P +       I +    +
Sbjct: 258 KDEESLQGIARTTGGGYFRVEDPAAFDQTIRSIDRLEKKR 297


>gi|300871001|ref|YP_003785873.1| aerotolerance-like membrane protein [Brachyspira pilosicoli
           95/1000]
 gi|300688701|gb|ADK31372.1| aerotolerance-related membrane protein [Brachyspira pilosicoli
           95/1000]
          Length = 328

 Score = 97.2 bits (240), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 37/254 (14%), Positives = 90/254 (35%), Gaps = 47/254 (18%)

Query: 141 FCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIK 200
           F   +   T S   +    +     +     + + +V+D+S SM +      T+++ + K
Sbjct: 55  FILLMLGLTFSIIGLARPATVDSSANINGEGIYISMVVDISPSMMAEDM-LPTRLEASKK 113

Query: 201 SINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFG-VSTNS 259
           ++   +++        N  +  LV F+ +        +  + L+++I  +      ST+ 
Sbjct: 114 TMADFIKK-------RNFDKISLVAFALRASVLSPSTFDYTSLEKEIGNIKIDEEGSTSI 166

Query: 260 TPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRG 319
             G+  A + +  ++           + +K+I+ +TDGEN S + D         A    
Sbjct: 167 GLGIATAVDMLRSVK----------DDAEKVIILLTDGENNSGEID--PKLASEIASNFN 214

Query: 320 AIVYAIGIRVIR------------------------SHEFLRACA--SPNSFYLVENPHS 353
             +Y IGI                            + + L   A  +   ++  +   +
Sbjct: 215 IKIYTIGIGDAAGSHAWVTYTDPNYGKRRIRADFTLNEKALIEIASITGGKYFNAKTSSA 274

Query: 354 MYDAFSHIGKDIVT 367
           + + ++ I +    
Sbjct: 275 LDNVYNTIDRLEKK 288


>gi|300786826|ref|YP_003767117.1| hypothetical protein AMED_4949 [Amycolatopsis mediterranei U32]
 gi|299796340|gb|ADJ46715.1| conserved hypothetical protein [Amycolatopsis mediterranei U32]
          Length = 326

 Score = 97.2 bits (240), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 39/219 (17%), Positives = 75/219 (34%), Gaps = 30/219 (13%)

Query: 169 DARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
             R  +M+V+DVS SME+      T++  A ++  +    +    +       GL++F+ 
Sbjct: 86  RNRATVMLVIDVSLSMEATD-VLPTRLQAAQEAATSFARNMTPGIN------LGLISFAG 138

Query: 229 KIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
                       + + + I+ L     ST +  G+  A   +             D    
Sbjct: 139 TATVLVNPTTDRNGVIKAIENLK-LAQSTATGEGIFAALQSVESF---SSLVGGADGPPP 194

Query: 289 KIIVFMTDGENLSTKEDQQSL---YYCNEAKKRGAIVYAIGIRV--------------IR 331
             IV M+DG+    ++   +         AK+ G  + +I                    
Sbjct: 195 ARIVLMSDGKQTVPEDLYAARGGYTAAQAAKQAGVPISSISFGTTHGSVTIDDKPQPVSV 254

Query: 332 SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
             E LR  A  S   FY   +   +   ++ +G+ I  +
Sbjct: 255 DDESLREIARLSGGDFYKAASAEELKKVYADLGEQIGYE 293


>gi|296139788|ref|YP_003647031.1| von Willebrand factor type A [Tsukamurella paurometabola DSM 20162]
 gi|296027922|gb|ADG78692.1| von Willebrand factor type A [Tsukamurella paurometabola DSM 20162]
          Length = 327

 Score = 97.2 bits (240), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 37/255 (14%), Positives = 80/255 (31%), Gaps = 30/255 (11%)

Query: 130 SAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFD 189
           S         K             +++ ++    +      R  +++ +DVS SME+   
Sbjct: 48  SVAPPGTNRWKHVPIALLAIGLVLLMVALSGPQAMRKVPRNRATVVLAIDVSLSMEARD- 106

Query: 190 SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKY 249
               ++  A ++    + E+       N V  G+V+F+             +     +  
Sbjct: 107 VEPDRLTAAKEAAKKFVTEL------PNGVNLGIVSFAGTASLLVSPTPDRTLALNAVDK 160

Query: 250 LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSL 309
           L      T +  G+   Y  I  ++ +R     ED      I+  +DG+     +     
Sbjct: 161 LELAQR-TATGEGI---YTSIQSIKNIRDVLGGEDNAPPARIILESDGKQTVPTDLDDPR 216

Query: 310 ---YYCNEAKKRGAIVYAIGIRV--------------IRSHEFLRACA--SPNSFYLVEN 350
                  +AK+ G  +  I                        L+  A  S   F+   +
Sbjct: 217 GGFTAARKAKEEGIPISTISFGTTSGSVNIGGQNIPVPVDDASLKRIAELSGGQFFAASS 276

Query: 351 PHSMYDAFSHIGKDI 365
            + + +A+  +  +I
Sbjct: 277 LNDLNEAYGSLRDEI 291


>gi|170750695|ref|YP_001756955.1| von Willebrand factor type A [Methylobacterium radiotolerans JCM
           2831]
 gi|170657217|gb|ACB26272.1| von Willebrand factor type A [Methylobacterium radiotolerans JCM
           2831]
          Length = 345

 Score = 97.2 bits (240), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 37/251 (14%), Positives = 76/251 (30%), Gaps = 31/251 (12%)

Query: 141 FCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFD----SSITKID 196
             T+  W      +  P               ++MI +D+S SME         ++ ++ 
Sbjct: 73  LLTWTLWIALVAALSGPRLVMPAAALPAS-GREIMIAMDLSGSMERRDFALDGETVNRLT 131

Query: 197 MAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKY--LSKFG 254
              +     +             + GLV F+++        +  + + R +    +   G
Sbjct: 132 AVKRVGTDFIRR-------RAGDRIGLVIFADQAYVAAAPSFDTAAVARALDEATIGISG 184

Query: 255 VSTNSTPGLKYAYNQIFDMQG--MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYC 312
            ST    GL  A  ++            +       K ++ ++DG N + +         
Sbjct: 185 RSTGIGDGLGLALRRLDPRDAGGEAASGSKPGEKPAKAVILLSDGANNAGQT--APKDVA 242

Query: 313 NEAKKRGAIVYAIGIR-----------VIRSHEFLRAC--ASPNSFYLVENPHSMYDAFS 359
             A++ G  VY I +             +   E LR    AS    + V     +     
Sbjct: 243 ELARELGIKVYTIALGPRDMADADGEQDVVDTETLRDMARASGGEAFRVRTTEDLVRVAD 302

Query: 360 HIGKDIVTKRI 370
            I +    + +
Sbjct: 303 AIDRLEGGRAL 313


>gi|197337036|ref|YP_002157821.1| hypothetical protein VFMJ11_A0264 [Vibrio fischeri MJ11]
 gi|197314288|gb|ACH63737.1| conserved hypothetical protein [Vibrio fischeri MJ11]
          Length = 423

 Score = 97.2 bits (240), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 47/427 (11%), Positives = 104/427 (24%), Gaps = 69/427 (16%)

Query: 8   IRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAAT--QI 65
           +RN   + +G   IL A+ +P +F +  +  + +     K  +    + + +  +     
Sbjct: 1   MRNLRKHQQGHAAILFAMMIPALFGIFALASDGARAIQTKARIEDASEVAALAISAHNDP 60

Query: 66  MNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNE 125
               NG+     +   I+    N +                 + I    +       +  
Sbjct: 61  DQPDNGSYTPSTRNRQIVVDYVNAYISDVDAVTDIKVAKRRCELIPECVAGLYDGDMRYL 120

Query: 126 GYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSME 185
            + I   +R          I                          +D M   D S SM 
Sbjct: 121 EHEIDVTTRQNSWFPGNEAIEGMGE----TFSTRGKSLARKYQSEAVDAMFAADFSGSML 176

Query: 186 SFFDS-SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQ 244
             +   S  K    I+ I  +  E++   D+        +  S                 
Sbjct: 177 DTWSGSSNPKYVDLIEIIRNISAELQKFNDLPENRNKSTMGISAFSTFTNSFTSDTGIQC 236

Query: 245 RKIKYLS-KFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTK 303
              + ++ + G +T   P                 +C +        +   ++   L+ +
Sbjct: 237 SLSQGVNGRNGPATWFRPVKAANTVANIWNPKTEDYCKSGAYAGFHDVNLTSNFNYLNGQ 296

Query: 304 -----------EDQQSLYYCNEAKKRG--------------------------------- 319
                        Q  +      +K                                   
Sbjct: 297 VGSFYAGGGTASYQALIRGAQLLRKGNNSRRLLIVLSDGMDNDTQLADGLVSAGMCRDIQ 356

Query: 320 ---------------AIVYAIGIR-VIRSHEFLRACASPNSFYLVENPHSMYDAFSH-IG 362
                          A +  IG      +++ L+ C    + Y  E+   + D     I 
Sbjct: 357 NGLESDRTPDRRPIAAKMAVIGFDYNPFANKALKDCVGEKNVYKAEDADEVEDIILELIN 416

Query: 363 KDIVTKR 369
           ++I   +
Sbjct: 417 EEIGHLK 423


>gi|152993979|ref|YP_001359700.1| von Willebrand factor type A domain-containing protein [Sulfurovum
           sp. NBC37-1]
 gi|151425840|dbj|BAF73343.1| von Willebrand factor type A domain protein [Sulfurovum sp.
           NBC37-1]
          Length = 307

 Score = 97.2 bits (240), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 32/210 (15%), Positives = 63/210 (30%), Gaps = 22/210 (10%)

Query: 162 VKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQS 221
               +Q     D+++ +D S SM         +           L+              
Sbjct: 70  DAAGNQHKKGRDLVLAIDASGSMAQSGFDEKDRF---KTKYETTLDLSADFIKHRFDDNM 126

Query: 222 GLVTFSNKIEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQH 279
           G+V F         L + +  ++  +K   +   G ST     L  A   +   +     
Sbjct: 127 GVVIFGTFAYTASPLTYDLEAMESMLKMTTVGIAGESTAIGDALMQAMRTLSYGEAQS-- 184

Query: 280 CNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR--VIRSHEFLR 337
                    K I+ +TDG + + +   ++     +   +G  +Y IG+          L 
Sbjct: 185 ---------KAIILLTDGYHNAGRSSPKAAVAKAKE--KGIKIYTIGVGKSSDYDAALLD 233

Query: 338 ACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
             A  S    Y   +   + + +  I K  
Sbjct: 234 TIAKESGGKSYAAASAAQLKEVYKEIDKLE 263


>gi|84622723|ref|YP_450095.1| hypothetical protein XOO_1066 [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|84366663|dbj|BAE67821.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
          Length = 335

 Score = 97.2 bits (240), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 30/222 (13%), Positives = 68/222 (30%), Gaps = 45/222 (20%)

Query: 169 DARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
                MM+ +D+S SM           + ++  A   ++  L       D  +  + GL+
Sbjct: 96  REARQMMLAVDLSGSMNEPDMVLGGKVVDRLTAAKAVLSDFL-------DRRDGDRVGLL 148

Query: 225 TFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            F  +      L   ++ ++ +++   +   G  T                  +      
Sbjct: 149 VFGQRAYALTPLTADLTSVRDQLRDSVVGLAGRETAIGDA-----------IALSVKRLR 197

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGI--------------- 327
           E    ++++V +TDG N +       L     AK  G  ++ I                 
Sbjct: 198 EQKQGQRVVVLLTDGVNTAG--VLDPLKAAELAKAEGVRIHTIAFGGGGGSSLFGVPIPA 255

Query: 328 --RVIRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                   + LR  A  +   F+   +   +   ++ + +  
Sbjct: 256 GGNDDIDEDGLRKIAQQTGGRFFRARDTEELAGIYAELDRLE 297


>gi|125548980|gb|EAY94802.1| hypothetical protein OsI_16587 [Oryza sativa Indica Group]
          Length = 708

 Score = 97.2 bits (240), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 54/345 (15%), Positives = 104/345 (30%), Gaps = 56/345 (16%)

Query: 41  SHIFFMKTVL-HSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELR 99
             I   +  L     + +L+H      +          +  D            F N   
Sbjct: 156 GRIGVSRARLTQQDANMALLH--QVPNHHQRVRRPHTSEPADFNDDEPLQQPEVFDNLNV 213

Query: 100 DNGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPIT 159
            +    +I+     +++       +    I   +    P                     
Sbjct: 214 RSTKTAEINTYPEFSTIPQSSSKDDFAILIHLKA----PSANPDQGTGKL--------AN 261

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
            S   +S+  A +D++ VLDVS SM         K+ +  +++  +++       +    
Sbjct: 262 ESSAGSSRNRAPVDLVTVLDVSGSMAGT------KLALLKRAMGFVVQ------HLGPSD 309

Query: 220 QSGLVTFSNKIEEFFL----LEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQG 275
           +  ++ FS+     F        G     + I  L   G  TN    LK A   I     
Sbjct: 310 RLSVIAFSSSARRLFHLQRISHHGRQQALQAINSLGASG-GTNIADALKKAMKVIE---- 364

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLS-------TKEDQQ----SLYYCNEAKKRGAIVYA 324
                +    N    I+ ++DG++                        N+A+     ++A
Sbjct: 365 -----DRSYKNSVCSIILLSDGQDTYNISSSVQGASPDYKSLVPSSIINDAR-HTVPLHA 418

Query: 325 IGIRVIRSHEFLRAC--ASPNSFYLVENPHSMYDAFSH-IGKDIV 366
            G       + L +   AS  +F  +E+   M DAF+  IG  + 
Sbjct: 419 FGFGADHDSDSLHSIAQASGGTFSFIEDEGVMQDAFAQCIGGLLS 463


>gi|115459346|ref|NP_001053273.1| Os04g0508800 [Oryza sativa Japonica Group]
 gi|32489531|emb|CAE04734.1| OSJNBa0043L24.22 [Oryza sativa Japonica Group]
 gi|113564844|dbj|BAF15187.1| Os04g0508800 [Oryza sativa Japonica Group]
 gi|116310776|emb|CAH67569.1| OSIGBa0101P20.12 [Oryza sativa Indica Group]
 gi|125590953|gb|EAZ31303.1| hypothetical protein OsJ_15416 [Oryza sativa Japonica Group]
          Length = 708

 Score = 97.2 bits (240), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 54/345 (15%), Positives = 104/345 (30%), Gaps = 56/345 (16%)

Query: 41  SHIFFMKTVL-HSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELR 99
             I   +  L     + +L+H      +          +  D            F N   
Sbjct: 156 GRIGVSRARLTQQDANMALLH--QVPNHHQRVRRPHTSEPADFNDDEPLQQPEVFDNLNV 213

Query: 100 DNGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPIT 159
            +    +I+     +++       +    I   +    P                     
Sbjct: 214 RSTKTAEINTYPEFSTIPQSSSKDDFAILIHLKA----PSANPDQGTGKL--------AN 261

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
            S   +S+  A +D++ VLDVS SM         K+ +  +++  +++       +    
Sbjct: 262 ESSAGSSRNRAPVDLVTVLDVSGSMAGT------KLALLKRAMGFVVQ------HLGPSD 309

Query: 220 QSGLVTFSNKIEEFFL----LEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQG 275
           +  ++ FS+     F        G     + I  L   G  TN    LK A   I     
Sbjct: 310 RLSVIAFSSSARRLFHLQRISHHGRQQALQAINSLGASG-GTNIADALKKAMKVIE---- 364

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLS-------TKEDQQ----SLYYCNEAKKRGAIVYA 324
                +    N    I+ ++DG++                        N+A+     ++A
Sbjct: 365 -----DRSYKNSVCSIILLSDGQDTYNISSSVQGASPDYKSLVPSSIINDAR-HTVPLHA 418

Query: 325 IGIRVIRSHEFLRAC--ASPNSFYLVENPHSMYDAFSH-IGKDIV 366
            G       + L +   AS  +F  +E+   M DAF+  IG  + 
Sbjct: 419 FGFGADHDSDSLHSIAQASGGTFSFIEDEGVMQDAFAQCIGGLLS 463


>gi|183982301|ref|YP_001850592.1| membrane protein [Mycobacterium marinum M]
 gi|226701243|sp|B2HPD3|Y2288_MYCMM RecName: Full=UPF0353 protein MMAR_2288
 gi|183175627|gb|ACC40737.1| membrane protein [Mycobacterium marinum M]
          Length = 335

 Score = 97.2 bits (240), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 33/260 (12%), Positives = 72/260 (27%), Gaps = 30/260 (11%)

Query: 130 SAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFD 189
           S   +     +    +    +     + +            R  +M+V+DVS+SM +   
Sbjct: 55  SVAPQRPSRFRHIPAMLLALSLVLFTVAMAGPTHDVRIPRNRAVVMLVIDVSQSMRATD- 113

Query: 190 SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKY 249
               ++  A ++     +E+    +       GL+ ++                +  +  
Sbjct: 114 VEPNRMVAAQEAAKQFADELTPGIN------LGLIAYAGTATVLVSPTTNREATKAALDK 167

Query: 250 LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSL 309
           L  F   T +   +  A   I  +          D      IV  +DG+           
Sbjct: 168 LQ-FADRTATGEAIFTALQAIATV---GAVIGGGDTPPPARIVLFSDGKETMPTNPDNPK 223

Query: 310 ---YYCNEAKKRGAIVYAIGIRVIR--------------SHEFLRACA--SPNSFYLVEN 350
                   AK +G  +  I                      E ++  A  S  + Y    
Sbjct: 224 GAYTAARTAKDQGVPISTISFGTPYGFVEINDQRQPVPVDDETMKKVAQLSGGNSYNAAT 283

Query: 351 PHSMYDAFSHIGKDIVTKRI 370
              +   ++ + + I  + I
Sbjct: 284 LAELNSVYASLQQQIGYETI 303


>gi|330878848|gb|EGH12997.1| von Willebrand factor type A domain-containing protein [Pseudomonas
           syringae pv. morsprunorum str. M302280PT]
          Length = 352

 Score = 96.8 bits (239), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 30/212 (14%), Positives = 66/212 (31%), Gaps = 45/212 (21%)

Query: 171 RLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+++ +DVS SM+          ++++ +  + +   LE            + GL+ F
Sbjct: 89  GRDLLVAIDVSGSMDYPDMQWKSDEVSRLVLVQQLLGDFLEG-------RKGDRVGLILF 141

Query: 227 SNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
             +      L +    ++  +    +   G +T     +  A                  
Sbjct: 142 GTQAFVQAPLTYDRRTVRVWLDEAKIGIAGKNTAVGDAIGLALK-----------RLRLR 190

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHE---------- 334
               +++V +TDG N + + D   +     A   G  +Y IGI      +          
Sbjct: 191 PANSRVLVLVTDGANNAGQID--PITAARLAADEGVKIYPIGIGSDPDKDALQSALGLNP 248

Query: 335 -------FLRACA--SPNSFYLVENPHSMYDA 357
                   L+  A  S   ++   +   +   
Sbjct: 249 SLDLDEPTLKEIASISGGQYFRARDGDQLEKI 280


>gi|282854077|ref|ZP_06263414.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes J139]
 gi|282583530|gb|EFB88910.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes J139]
          Length = 318

 Score = 96.8 bits (239), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 37/238 (15%), Positives = 80/238 (33%), Gaps = 33/238 (13%)

Query: 153 HIVMPITSSVKVNSQTDARLD---MMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEV 209
            + + + +  +  +  +   D   +++ +DVSRSM +      +++  A  +        
Sbjct: 65  SMAIMVLAFAQPKAYHEVPRDRATVVVAIDVSRSMVATD-VEPSRLSAAKTAAKDF---- 119

Query: 210 KLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQ 269
             + D+       LV F+   +         + +   I  L     ST    G+  + N 
Sbjct: 120 --LGDLPPRFNVSLVKFAASAQVVVPPTTDRAAVSTAITNLQVL-PSTAIGEGIYSSLNA 176

Query: 270 IFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV 329
           +  +    +H           IV ++DG     +     L    EA ++   VY I    
Sbjct: 177 LKLVPDDPKH---PGQKPPAAIVLLSDGATNVGRPS---LEAAKEAGRQHVPVYTIAYGT 230

Query: 330 --------------IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKRIW 371
                           +H  L A A  S    +  E+   + D +  I + +  ++++
Sbjct: 231 AGGYVVEGGQRQPVPVNHYELAAIAKASGGEKFSAESLGQLSDVYKSIAQSVGYEKVF 288


>gi|187736265|ref|YP_001878377.1| von Willebrand factor type A [Akkermansia muciniphila ATCC BAA-835]
 gi|187426317|gb|ACD05596.1| von Willebrand factor type A [Akkermansia muciniphila ATCC BAA-835]
          Length = 328

 Score = 96.8 bits (239), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 42/218 (19%), Positives = 70/218 (32%), Gaps = 35/218 (16%)

Query: 170 ARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVT 225
             +D+MI  D+S SME+         I ++  A   I   +       D     + G+V 
Sbjct: 88  NGIDIMIAFDLSYSMETPDMVLNRMPINRLVAAKHVITQFV-------DSRPDDRIGIVG 140

Query: 226 FSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDA 285
           F+ K + F  L    + +   I+      +                 +       +    
Sbjct: 141 FAGKTKSFCPLTLDHALVNSIIRDFHPRMI-------QADGTAIGSAIAAAATRLDDRKE 193

Query: 286 NYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR-------------S 332
              KII+ +TDG + S +     L     A K G  +Y I +                  
Sbjct: 194 TKSKIIILVTDGASNSGQIS--PLVAAENAAKLGIKIYTIAVGTEEGTLANGMVVQSEFD 251

Query: 333 HEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
              LR  A  +    +   N  S   AF+ IGK   ++
Sbjct: 252 EPTLRKIAQLTGGEHFRATNMASFNKAFTSIGKLEKSE 289


>gi|170741048|ref|YP_001769703.1| hypothetical protein M446_2844 [Methylobacterium sp. 4-46]
 gi|168195322|gb|ACA17269.1| conserved hypothetical protein [Methylobacterium sp. 4-46]
          Length = 432

 Score = 96.8 bits (239), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 44/405 (10%), Positives = 123/405 (30%), Gaps = 52/405 (12%)

Query: 15  YKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNR 74
             G +  +  + L  + + +G+ ++ + +   ++ L +  D +++    +     +  + 
Sbjct: 24  RSGSVGFVFGLLLLPMMVAMGVSVDYARVSAARSDLAAAADAAVLSVTNKAAMSLDMLSA 83

Query: 75  KKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDI----VVVPQNEGYSIS 130
           +       L  I+   ++S  +       +  +     S +         +      S+S
Sbjct: 84  QARVRDAFLKNIQTMPDISGVSADAVVIDLLGVRAATLSYTASYRTAFSGILGMRTLSVS 143

Query: 131 AISRYKIPL-KFCTFIPWYTNSRHIVMPITSSVKVNSQTDAR--LDMMIVLDVSRSMESF 187
             +  K  +  +  F     NS  + +  TS+      +            D+S     +
Sbjct: 144 GNAASKSAVPIYMDFYLLLDNSPSMGVGATSADISTMVSRTPDKCAFACH-DLSAGNSDY 202

Query: 188 FD-----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI-----EEFFLLE 237
           +          +ID+  ++   +++       V    ++ L T               L 
Sbjct: 203 YHLAKSLGVTMRIDVVRQATQRLMDTAANTALVPGQFRTALYTMGADCASVGLTTVSPLS 262

Query: 238 WGVSHLQRKIKYLSKFG----VSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVF 293
             ++  +   + +           N          Q  + +       +     +K++  
Sbjct: 263 SDLAAAKTNAQAIDLMTIQKPGYNNDQCTDFDGVFQSLNGKIDVAGDGSTALTPQKVVFL 322

Query: 294 MTDGENLSTKEDQQ-------------SLYYCNEAKKRGAIV---YAIGIRVIRSHEF-- 335
           ++DG   +                   +L  C   K RG  +   Y   + +  +  +  
Sbjct: 323 VSDGVADAYYPSTCTRKTTGGRCQEPLTLANCTTLKNRGIKIAVLYTTYLPLPTNDWYNT 382

Query: 336 ------------LRACASPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                       ++ CASP  ++ V     + DA + + +  V++
Sbjct: 383 WIAPFQATLPSAMQGCASPGLYFEVSPTQGIADAMTTLFQRTVSQ 427


>gi|256426121|ref|YP_003126774.1| von Willebrand factor type A [Chitinophaga pinensis DSM 2588]
 gi|256041029|gb|ACU64573.1| von Willebrand factor type A [Chitinophaga pinensis DSM 2588]
          Length = 462

 Score = 96.8 bits (239), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 39/208 (18%), Positives = 75/208 (36%), Gaps = 24/208 (11%)

Query: 156 MPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDV 215
           + I       S+    L++ +VLD S SM         KI  A ++   +++++     +
Sbjct: 65  VNIKGGEGEASKPRVPLNISLVLDRSGSMSGD------KIKYARQAAKFLIDQLNSTDHL 118

Query: 216 NNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQG 275
           + V     V    ++            L+  I  +   G STN + G+   Y        
Sbjct: 119 SIVNYDDRV----EVTSPSQSVKNKEALKAAIDKIHDRG-STNLSGGMLEGY-------- 165

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLY--YCNEAKKRGAIVYAIGIRVIRSH 333
             Q  +T    Y   ++ +TDG       D   L     N+ K+ G  +   G+    + 
Sbjct: 166 -TQVKSTRKEGYVNRVLLLTDGLANQGITDPLELKRLAENKYKEDGIALSTFGVGADYNE 224

Query: 334 EFLRACASPNS--FYLVENPHSMYDAFS 359
           + L   A      +Y +++P  +   F+
Sbjct: 225 DLLTMLAENGRANYYFIDSPDKIPQIFA 252


>gi|319956579|ref|YP_004167842.1| von willebrand factor type a [Nitratifractor salsuginis DSM 16511]
 gi|319418983|gb|ADV46093.1| von Willebrand factor type A [Nitratifractor salsuginis DSM 16511]
          Length = 560

 Score = 96.8 bits (239), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 35/215 (16%), Positives = 68/215 (31%), Gaps = 24/215 (11%)

Query: 156 MPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDV 215
            P+T   +   Q      + ++LD S SM         + D+A K +   +       D 
Sbjct: 65  DPVTRKSETLHQAR-GHAVALLLDASYSMR-----EGGRFDIARKVLLDFI-------DR 111

Query: 216 NNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQG 275
               +  L  F++       + +    L+  +  L    V      G   A  +   +  
Sbjct: 112 RPKDRIALEVFADYAYLAAPMSYEKKGLKTILAALEPGVVG-----GRDTALYEALFLGA 166

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF 335
                    +N    ++ +TDG +       +      E K+    VY +G+        
Sbjct: 167 RLFKKEEGRSNRV--MILLTDGIDTVGNIPLE--AAIRELKRAHIRVYTVGVGDDFRRGV 222

Query: 336 LRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
           L   A  +   FY    P ++ + +  I     T+
Sbjct: 223 LEKIARSTGGRFYDARYPEALANIYRRIDTLERTR 257


>gi|188990358|ref|YP_001902368.1| hypothetical protein xccb100_0962 [Xanthomonas campestris pv.
           campestris str. B100]
 gi|167732118|emb|CAP50310.1| putative membrane protein [Xanthomonas campestris pv. campestris]
          Length = 335

 Score = 96.8 bits (239), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 32/222 (14%), Positives = 69/222 (31%), Gaps = 45/222 (20%)

Query: 169 DARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
                MM+ +D+S SM         + + ++  A   ++  L       D     + GL+
Sbjct: 96  REARQMMLAVDLSGSMSEPDMVLGGNVVDRLTAAKAVLSDFL-------DRREGDRVGLL 148

Query: 225 TFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            F  +      L   ++ ++ ++    +   G  T                  +      
Sbjct: 149 VFGQRAYALTPLTADLTSVRDQLADSVVGLAGRETAIGDA-----------IALSVKRLR 197

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF------- 335
           E  + ++++V +TDG N +       L     AK  G  V+ I      S+         
Sbjct: 198 EQRHGQRVVVLLTDGVNTAG--VLNPLKAAELAKAEGVRVHTIAFGGSGSYSLFGVPIPA 255

Query: 336 ----------LRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                     LR  A  +   F+   +   +   ++ + +  
Sbjct: 256 GGGDDIDEDGLRKIAEQTGGRFFRARDTEELAGIYAELDRLE 297


>gi|149632101|ref|XP_001514410.1| PREDICTED: hypothetical protein [Ornithorhynchus anatinus]
          Length = 2392

 Score = 96.5 bits (238), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 52/334 (15%), Positives = 104/334 (31%), Gaps = 26/334 (7%)

Query: 42  HIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDN 101
           + +  KT +   ID   +     ++                       + +   +    +
Sbjct: 675 NQYDTKTKISDAIDGLSLIGRGTLIGGALTFVSDYFSVSKGARPNVKKFLVLLTDGKSQD 734

Query: 102 GFVNDIDDIVRSTSLDIVVVPQNEGYS--ISAISRYKIPLKFCTFIPWYTNSRHIVMPIT 159
                   + +   +   V      YS       R  +      F         +V  I 
Sbjct: 735 AVKEAAVALRQDGVIIYSVGVFGSEYSQLEEISGRSDMVFYVENFDILKPVEDVLVFGIC 794

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSI--TKIDMAIKSINAMLEEVKLIPDVNN 217
           S  +V  +    LD++ V+D S S++S   + +    ID+  K+               N
Sbjct: 795 SPYEV-CKRIEVLDIVFVIDSSGSIDSNEYNIMKAFMIDLVKKA-----------DVGKN 842

Query: 218 VVQSGLVTFSNKIEEFFL--LEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQG 275
            VQ G + +S+  E  F        S +   I+     G ST +   L +          
Sbjct: 843 QVQFGALKYSDFPEVLFNLNEFSSKSEIISFIQNDHPRGGSTYTAKALAH-----SAHLF 897

Query: 276 MRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF 335
                +       ++++ +TDGE+    +           + +G +V A+GI      E 
Sbjct: 898 SESLGSRMHRGVPQVLIVITDGESH---DAHLLNATARALRDKGILVLAVGIEGANHEEL 954

Query: 336 LRACASPNSFYLVENPHSMYDAFSHIGKDIVTKR 369
           L    S + ++ VEN   +   F ++   +    
Sbjct: 955 LSMAGSTDRYFFVENFEGLKGIFENVSASVCNTS 988



 Score = 93.0 bits (229), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 39/265 (14%), Positives = 82/265 (30%), Gaps = 24/265 (9%)

Query: 109 DIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPW----YTNSRHIVMPITSSVKV 164
           +    T LD +     E Y     S   +   +  F         N   +    T  +K 
Sbjct: 366 EGANETQLDQIASYPREQYVSMVKSYSDMGAYYRIFQKKLRNEIQNKVSVASEQTERLKS 425

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
                   D+ +++D S S++      + +           +  +  I        +   
Sbjct: 426 GCADTEAADIYLLIDGSGSIQVADFQEMKRFLA-------EVIGMFNIGPHKVRFGAVQY 478

Query: 225 TFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
           +   + E         + L + ++ + + G +T++   L          +  R       
Sbjct: 479 SHLWEWEFEMDRYSNKNDLVKAVENIRQLGGNTDTGAALDKMLPLFQRARQQRAR----- 533

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPN- 343
               + +V +TDG +                +     VYAIG+    +H  L   A  + 
Sbjct: 534 -KVPQHLVVLTDGLSH-----DSVREPAGRLRGDNINVYAIGV-KEANHTQLEEIAGSDS 586

Query: 344 SFYLVENPHSMYDAFSHIGKDIVTK 368
             Y V N  S+ D  + + + I ++
Sbjct: 587 RVYYVHNFDSLKDIKNRVVRSICSE 611



 Score = 75.7 bits (184), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 27/229 (11%), Positives = 72/229 (31%), Gaps = 21/229 (9%)

Query: 141  FCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIK 200
            F             V     +           D++ ++D S S+               K
Sbjct: 966  FVENFEGLKGIFENVSASVCNTSKVDCELGMADLVFLIDGSTSILEEDF---------KK 1016

Query: 201  SINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFF--LLEWGVSHLQRKIKYLSKFGVSTN 258
              + ++  V         V  GL  FS++    F  +       ++ +I  + +   +T 
Sbjct: 1017 MKDFLVTIVNDFDIRPGKVHVGLAQFSHEYRPEFSLIPFRDKIEVKNQIGRIQQIFGNTL 1076

Query: 259  STPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKR 318
                      +           +  +A  +++++ +TD      +   +      + + +
Sbjct: 1077 IGAA-----LRNVGSYFWPDFGSRINAGVQQVLLVLTD-----GQSQDEVAQAAEDLRNK 1126

Query: 319  GAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVT 367
            G  +Y++G+  +   + ++   S      V+N   +      + +D+ T
Sbjct: 1127 GIDIYSLGVGQVNDQQLIQISGSAKKKLTVDNFSELDKIKKRVVRDVCT 1175



 Score = 67.6 bits (163), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 42/249 (16%), Positives = 82/249 (32%), Gaps = 29/249 (11%)

Query: 113 STSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARL 172
           + ++  + V +     +  I+     + +        + ++ V+    S +     +   
Sbjct: 562 NINVYAIGVKEANHTQLEEIAGSDSRVYYVHNFDSLKDIKNRVVRSICSEEA--CKEMSA 619

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN--KI 230
           D+M ++D S S+           +     +  ++          N VQ GLV FS+  K 
Sbjct: 620 DIMFLVDSSGSIGGDN------FEKMKTFMKNVVNR---TKIGANQVQVGLVQFSDINKE 670

Query: 231 EEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKI 290
                     + +   I  LS  G  T     L +  +     +G R        N KK 
Sbjct: 671 GFQLNQYDTKTKISDAIDGLSLIGRGTLIGGALTFVSDYFSVSKGAR-------PNVKKF 723

Query: 291 IVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIG-IRVIRSHEFLRACAS-PNSFYLV 348
           +V +TD      K            ++ G I+Y++G      S   L   +   +  + V
Sbjct: 724 LVLLTD-----GKSQDAVKEAAVALRQDGVIIYSVGVFGSEYSQ--LEEISGRSDMVFYV 776

Query: 349 ENPHSMYDA 357
           EN   +   
Sbjct: 777 ENFDILKPV 785



 Score = 57.2 bits (136), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 31/198 (15%), Positives = 67/198 (33%), Gaps = 25/198 (12%)

Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
           +D++ ++D S       + +    +        ++E +       N ++ GLV +SN+ +
Sbjct: 226 VDIVFLVDES------VNGTDENFEHLK---GFLVETIDSFDVKENCMRIGLVMYSNETK 276

Query: 232 EFFL--LEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
                      S + ++I  LS       +   +     +IF           +     +
Sbjct: 277 LVSRLGTGTNKSDILQQIDGLSPKAGRALTGAAINVTRKEIFSRGAGS----RKSQGVLQ 332

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACAS---PNSFY 346
           I V +T         +          ++ G  V+A+GI    +   L   AS        
Sbjct: 333 ITVLITH-----RSSEDNVSEAALSLRREGVTVFAVGI-EGANETQLDQIASYPREQYVS 386

Query: 347 LVENPHSMYDAFSHIGKD 364
           +V++   M  A+  I + 
Sbjct: 387 MVKSYSDM-GAYYRIFQK 403


>gi|73990557|ref|XP_853279.1| PREDICTED: similar to alpha 3 type VI collagen isoform 1 precursor
           [Canis familiaris]
          Length = 1634

 Score = 96.5 bits (238), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 39/267 (14%), Positives = 92/267 (34%), Gaps = 28/267 (10%)

Query: 109 DIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQT 168
           +    + L+ +     E +     +  ++     TF+    N   + + + S      ++
Sbjct: 366 EGASDSQLEKIASHPAEQHVSKLKTFSELAAHNQTFLKKLRNQITLTVSVFSERTETLKS 425

Query: 169 D----ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
                   D+ +++D S S ++             +    + E V +       V+ G V
Sbjct: 426 GCVDTEEADIYLLIDGSGSTQATDFH---------EMKTFLSEVVGMFNIAPQKVRVGAV 476

Query: 225 TFSNKIEEFF--LLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +++  +  F          L + I+ + + G +TN+   L +    +   +  R     
Sbjct: 477 QYADSWDLEFEINKYTNKHDLGKAIENIRQMGGNTNTGAALNFTLGLLQKAKKQR----- 531

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                   +V +T+            L   N  ++    VYAIG+    +   LR  A  
Sbjct: 532 -GNRVPCHLVVLTN-----GMSKDSILEPANRLREELIRVYAIGV-KEANQTQLREIAGE 584

Query: 343 N-SFYLVENPHSMYDAFSHIGKDIVTK 368
           +   Y V +  ++ D  + + ++I  +
Sbjct: 585 DKRVYYVHDFDALKDIRNQVVQEICAE 611



 Score = 84.1 bits (206), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 44/332 (13%), Positives = 104/332 (31%), Gaps = 26/332 (7%)

Query: 44  FFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGF 103
           +  +  + + IDR      T +         +              + +   +    +  
Sbjct: 677 YMSQNEISNAIDRMAHIGETTLTGSALTFVSQYFSPAKGARPNVRRFLILITDGEAQDIV 736

Query: 104 VNDIDDIVRSTSLDIVVVPQNEGYS--ISAISRYKIPLKFCTFIPWYTNSRHIVMPITSS 161
            +    + +   +   V       +       R ++      F         +V  I  S
Sbjct: 737 KDPAVALRQEGIIIYSVGVFGSNVTQLEEISGRPEMVFYVENFDILQHIEDDLVFGI-CS 795

Query: 162 VKVNSQTDARLDMMIVLDVSRSMESFFDSSITKI--DMAIKSINAMLEEVKLIPDVNNVV 219
            +   +    LD++ V+D S S++    + +     D+  K+               N V
Sbjct: 796 PREECKRIEVLDVVFVIDSSGSIDHDEYNIMKDFMVDLVKKA-----------DVGKNQV 844

Query: 220 QSGLVTFSNKIEEFFLLE--WGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           + G + +++  E  F L+       +   ++     G +T +   L +      D     
Sbjct: 845 RFGALKYADDPEVLFYLDDLSTKWEVISVLQKDQPMGGNTYTAEALGF-----SDHMFTE 899

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
              +       ++++ +TDGE+    +  +        + +G +V A+GI      E L 
Sbjct: 900 ARGSRLHKGVPQVLIVITDGESH---DADKLNDTAKALRDKGILVLAVGIAGANPVELLA 956

Query: 338 ACASPNSFYLVENPHSMYDAFSHIGKDIVTKR 369
              S + ++ VE    +   FS +   +    
Sbjct: 957 MAGSSDKYFFVETFGGLKGIFSDVSASVCNSS 988



 Score = 81.8 bits (200), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 34/309 (11%), Positives = 86/309 (27%), Gaps = 21/309 (6%)

Query: 61   AATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVV 120
             A  +    +     +                   +   D           +   +  V 
Sbjct: 886  TAEALGFSDHMFTEARGSRLHKGVPQVLIVITDGESHDADKLNDTAKALRDKGILVLAVG 945

Query: 121  VPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDV 180
            +       + A++       F             V     +         ++D++ ++D 
Sbjct: 946  IAGANPVELLAMAGSSDKYFFVETFGGLKGIFSDVSASVCNSSKVDCEIEKVDLVFLMDG 1005

Query: 181  SRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFL--LEW 238
            S S+               K    +   V+      N V+ G   FS+     F      
Sbjct: 1006 SNSIHPDDF---------KKMKEFLASVVQDFDVSVNRVRIGAAQFSHTYRPEFPLGTFI 1056

Query: 239  GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGE 298
            G   +  +I+ + +    T+          +           +  +A   ++++ +TD  
Sbjct: 1057 GKKEISFQIENIQQIFGYTHIGAA-----LREVGDYFRPDMGSRINAGTPQVLLVLTD-- 1109

Query: 299  NLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAF 358
                +   +      E + +G  +Y++GI  +   + ++   + +    V N   +    
Sbjct: 1110 ---GQSQDEVAQAAEELRHKGIDIYSVGIGDVDDQQLIQITGTADKKLTVHNFDELTKVK 1166

Query: 359  SHIGKDIVT 367
              I ++I T
Sbjct: 1167 KRIVRNICT 1175



 Score = 55.2 bits (131), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 34/232 (14%), Positives = 76/232 (32%), Gaps = 32/232 (13%)

Query: 123 QNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARL---------- 172
                 + A++  +      +       + ++   I  + +        +          
Sbjct: 166 SASEQELKAMATGQFHFNLRSARDLGAFAPNMTQIIKEATQYREVATDDILVEVCQGPSV 225

Query: 173 -DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
            D++ +LDVS       + S    D   +    + E V  +    N ++ GLVT+SN+ +
Sbjct: 226 ADLVFLLDVS------VNGSQENFDYLKE---FLEESVSALDIKENCMRVGLVTYSNETK 276

Query: 232 EFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
               L      S + + I+ LS       +      A  +I       ++ + ++    +
Sbjct: 277 VINSLSRGVNKSEVLQNIQNLSPRAGKAYTGA----AIRKIRKEVFSARNGSRKNQGVPQ 332

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACAS 341
           I V +T         +          ++ G  ++ +GI      + L   AS
Sbjct: 333 IAVLVTH-----RPSEDNVTKAAVNLRREGVTIFTMGIEGASDSQ-LEKIAS 378



 Score = 49.1 bits (115), Expect = 0.001,   Method: Composition-based stats.
 Identities = 24/206 (11%), Positives = 64/206 (31%), Gaps = 25/206 (12%)

Query: 168 TDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFS 227
           +    D++ ++D S               +       +   +  +P   +  +  L  +S
Sbjct: 20  SPEYADVVFLVDSS------DHLGAKSFPLVKT---FINRMISSLPIEAHKYRVALAQYS 70

Query: 228 NKIEEFFL--LEWGVSHLQRKIK-YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
           +++   F        + +   +K      G S      L+ A+   F           + 
Sbjct: 71  DQLHSEFQLGTFKSRNPMLNHLKKNFGFVGGSLRIGQALREAHRTYFSRP----DSGRDK 126

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNS 344
             +  I+V +   E      +          +  G  + ++G++   S + L+A A+   
Sbjct: 127 KQFPPILVVLASAE-----SEDDVEEPSKALRGDGVRIISVGLQS-ASEQELKAMATGQF 180

Query: 345 FYLVENPHSMYDA---FSHIGKDIVT 367
            + + +   +       + I K+   
Sbjct: 181 HFNLRSARDLGAFAPNMTQIIKEATQ 206


>gi|119946440|ref|YP_944120.1| von Willebrand factor, type A [Psychromonas ingrahamii 37]
 gi|119865044|gb|ABM04521.1| von Willebrand factor, type A [Psychromonas ingrahamii 37]
          Length = 327

 Score = 96.5 bits (238), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 34/227 (14%), Positives = 75/227 (33%), Gaps = 36/227 (15%)

Query: 168 TDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFS 227
                DM+I LD+S SM+             +  +  + + +K         + GL+ F+
Sbjct: 82  QQQSRDMIISLDLSGSMQEVDMPLNG---QTVDRLTLLKDLLKTFIKQRQGDRLGLILFA 138

Query: 228 NKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287
           +       L + +  +Q+ +         T +  G   A                E+ N 
Sbjct: 139 DHAYLQTPLTFDLKTIQQMVDESEIGLAGTRTAIGESIAM---------AIKRFVENKNE 189

Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR------------------V 329
           +++++ ++DG N S     + +    +A K    +Y IG+                    
Sbjct: 190 QRVLILVSDGANNSGSI--EPIQAAKQAAKNNITIYTIGMGAEQMIKRGLFGNQRINPSA 247

Query: 330 IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKD--IVTKRIWY 372
               + L   A  +   ++   N   + + +  + K   I T  + +
Sbjct: 248 DLDEKTLTEIANLTGGKYFRARNQTELQNIYQTLNKLEPIDTDSLTF 294


>gi|197336748|ref|YP_002158568.1| von Willebrand factor, type A [Vibrio fischeri MJ11]
 gi|197314000|gb|ACH63449.1| von Willebrand factor, type A [Vibrio fischeri MJ11]
          Length = 350

 Score = 96.5 bits (238), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 35/242 (14%), Positives = 73/242 (30%), Gaps = 25/242 (10%)

Query: 142 CTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSIT-----KID 196
              + W      +  P T      ++     D+M+V+D+S SM     +SI      ++D
Sbjct: 72  LLSLSWIMILVALTKP-TLLGPPQTREQFGRDVMVVVDLSGSMAEKDFTSIDGIKISRLD 130

Query: 197 MAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVS 256
              K +N   +            + GL+ F +                  +         
Sbjct: 131 AVKKVLNDFAKT-------RKGDRLGLILFGDAAFVQTPFTADHEVWLDLLNQTRVEMAG 183

Query: 257 TNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAK 316
            ++  G           +       +   + KK+ + +TDG +         +     AK
Sbjct: 184 KSTHLGDAIGLTIKRFEENDNSQPLST-TSRKKVAIILTDGNDT--DSYVPPMDAAKVAK 240

Query: 317 KRGAIVYAIGIRVIR-------SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVT 367
            +G  ++ I I   +         + +   A  S    +   N   + +A++ I K    
Sbjct: 241 VKGIRIHMIAIGDPQTVGEQALDMDTINTIADASGGQAFQALNQDELINAYAEISKLEPQ 300

Query: 368 KR 369
             
Sbjct: 301 LY 302


>gi|218528586|ref|YP_002419402.1| hypothetical protein Mchl_0543 [Methylobacterium chloromethanicum
           CM4]
 gi|218520889|gb|ACK81474.1| conserved hypothetical protein [Methylobacterium chloromethanicum
           CM4]
          Length = 518

 Score = 96.5 bits (238), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 29/286 (10%), Positives = 85/286 (29%), Gaps = 40/286 (13%)

Query: 2   FSLNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHA 61
            SL   +  F +   G + ++ A+ L  +  + GM I+ +    ++      +D + +  
Sbjct: 6   RSLTARLARFRHTESGSVLVIFALALVPMAFLAGMTIDYAQNTNLRQQAQVAVDATALAL 65

Query: 62  ATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVV 121
           A   ++  + +   K +   +                            +   +L + + 
Sbjct: 66  AKLPLDTTDKDLAAKAEAQVLTAL-----------------------KGLPIDALTVTMR 102

Query: 122 PQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVS 181
              +   ++A           T +        + + +++    +      L++ +VLD +
Sbjct: 103 HNGDLIEVAAKGAT------PTSLTRLAGFMSMPLSVSAISNRSM---TNLEIALVLDNT 153

Query: 182 RSMESFFDSSITKIDMAIKSINAMLEEVKLIPDV--NNVVQSGLVTFSNKIEEFFLLEWG 239
            SM+        K+     +   ++  +    D    N ++ G+V FS  +         
Sbjct: 154 GSMKGT------KLTNLKAAARDLVTSLFQQADPAKPNALKIGVVPFSMTVNVGSGFAGS 207

Query: 240 VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDA 285
                     + +   +    P  +++              +    
Sbjct: 208 DWLDINAKSPIHQQIFNAQGVPANRFSLFADMGKPWAGCVESRPAP 253



 Score = 57.6 bits (137), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 46/355 (12%), Positives = 97/355 (27%), Gaps = 55/355 (15%)

Query: 70  NGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTS---LDIVVVPQNEG 126
           N     +     +  +       + +  +       ++      +    ++       + 
Sbjct: 163 NLKAAARDLVTSLFQQADPAKPNALKIGVVPFSMTVNVGSGFAGSDWLDINAKSPIHQQI 222

Query: 127 YSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMM--IVLDVSRSM 184
           ++   +   +  L      PW         P        SQ       +     D S + 
Sbjct: 223 FNAQGVPANRFSLFADMGKPWAGCVESRPAPYDVQDTAPSQATPSTLFVPFFAPDESDND 282

Query: 185 ESFFDSSITKIDMAIKSINAMLEEVKLIP--------------DVNNVVQSGLVTFSNKI 230
               +  +  +     +  A   +++ +                 +            +I
Sbjct: 283 SRAVNDYMADLPSGGSAGGASNRQLQGMTAKYDKNAFKVSTTARQDGTNYLFGPNAGCEI 342

Query: 231 EEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKI 290
           +    L    + L   I  ++  G  TN   GL + ++ +      +      +   KK 
Sbjct: 343 QPLTRLTTSQTQLTNAIAAMTVIGD-TNIPIGLAWGWHLLSPNGPFKDGVAYGEIKTKKF 401

Query: 291 IVFMTDGENLSTKE---------------------------------DQQSLYYCNEAKK 317
           IV MTDG+N S                                    D +    C+  +K
Sbjct: 402 IVLMTDGQNQSAVSSSDNRSYYSGLGFIWQNRIGTTSNDNAVRTKAIDTRLTLLCDNIRK 461

Query: 318 RGAIVYAIGIR-VIRSHEFLRACASPNS-FYLVENPHSMYDAFSHIGKDIVTKRI 370
               V+A+ +         L+ACA+  + F+ V+N   +   F  I   I   RI
Sbjct: 462 ARIQVFAVRVEVNDGDSAVLKACATSPNMFFDVKNSSGLPAVFRAIADQISELRI 516


>gi|21232653|ref|NP_638570.1| hypothetical protein XCC3224 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66767265|ref|YP_242027.1| hypothetical protein XC_0933 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|21114459|gb|AAM42494.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66572597|gb|AAY48007.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. 8004]
          Length = 335

 Score = 96.5 bits (238), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 32/222 (14%), Positives = 68/222 (30%), Gaps = 45/222 (20%)

Query: 169 DARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
                MM+ +D+S SM         + + ++  A   ++  L       D     + GL+
Sbjct: 96  REARQMMLAVDLSGSMSEPDMVLGGNVVDRLTAAKAVLSDFL-------DRREGDRVGLL 148

Query: 225 TFSNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            F  +      L   ++ ++ ++    +   G  T                  +      
Sbjct: 149 VFGQRAYALTPLTADLTSVRDQLADSVVGLAGRETAIGDA-----------IALSVKRLR 197

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEF------- 335
           E    ++++V +TDG N +       L     AK  G  V+ I      S+         
Sbjct: 198 EQRQGQRVVVLLTDGVNTAG--VLNPLKAAELAKAEGVRVHTIAFGGSGSYSLFGVPIPA 255

Query: 336 ----------LRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                     LR  A  +   F+   +   +   ++ + +  
Sbjct: 256 GGGDDIDEDGLRKIAEQTGGRFFRARDTEELAGIYAELDRLE 297


>gi|88601902|ref|YP_502080.1| von Willebrand factor, type A [Methanospirillum hungatei JF-1]
 gi|88187364|gb|ABD40361.1| von Willebrand factor, type A [Methanospirillum hungatei JF-1]
          Length = 316

 Score = 96.5 bits (238), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 31/207 (14%), Positives = 78/207 (37%), Gaps = 39/207 (18%)

Query: 182 RSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVS 241
            SM++      T+++ + +S   +      +  ++    +G++TF +       L     
Sbjct: 98  GSMQATDY-QPTRLESSKRSAEIL------LKSLDPKDYAGIITFESGATSAAYLSPDKD 150

Query: 242 HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLS 301
            + RK++ +     +T    GL    +    M            N KK+++ ++DG N +
Sbjct: 151 RVIRKLQAIEPKEGATAIGDGLALGIDMAESM-----------PNRKKVVILLSDGVNNA 199

Query: 302 TKEDQQSLYYCNEAKKRGAIVYAIGIRVIR-----------------SHEFLRACA--SP 342
                +       A+++G  V+ IG+                         L+  A  + 
Sbjct: 200 GVIHPE--QAAGFAREKGIQVFTIGMGSDSPVVLGYDWFGNPQYATLDEAMLQQIAASTN 257

Query: 343 NSFYLVENPHSMYDAFSHIGKDIVTKR 369
             ++   +  ++ + +S++ K+IV ++
Sbjct: 258 GQYFKSVDDRTLSEIYSNLNKEIVREK 284


>gi|90412167|ref|ZP_01220173.1| hypothetical protein P3TCK_27759 [Photobacterium profundum 3TCK]
 gi|90326891|gb|EAS43276.1| hypothetical protein P3TCK_27759 [Photobacterium profundum 3TCK]
          Length = 504

 Score = 96.5 bits (238), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 43/266 (16%), Positives = 89/266 (33%), Gaps = 18/266 (6%)

Query: 13  YNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGN 72
            + +G   I TA+ L  +F ++   +E +     K  L    + + +   T   N+ +  
Sbjct: 15  RHQRGAAGIYTALALIPLFGMIFWALEGTRYIQKKNRLADATEAATLAITTA--NQDDKT 72

Query: 73  NRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSISAI 132
              +L  G I   I+N  +++     R  G  N         + D     +   Y ++A 
Sbjct: 73  YENQLATGYIQAYIRNITSINNIKIERSEGIDNYP-------TPDGNEEREYFQYRVTAK 125

Query: 133 SRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSI 192
               I       IP +  +  +     +        D  +D++ V D S SM+       
Sbjct: 126 -TNHISWLSSDIIPSFAPTETVANRALARNYPIYLGDKDIDIVFVSDFSGSMKGN----- 179

Query: 193 TKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIK-YLS 251
            KI     +I A+  E+ +  D   V  +  + F                   ++    +
Sbjct: 180 -KIRALKDAIQAIANEILVPRD-GEVEVTNRIAFVPYNMRVQEKRSNTRWCITQLDYRPN 237

Query: 252 KFGVSTNSTPGLKYAYNQIFDMQGMR 277
             G + +S   + ++    +    +R
Sbjct: 238 FNGGNYSSYEDIDWSTWSTWTRNQVR 263


>gi|169629808|ref|YP_001703457.1| hypothetical protein MAB_2724c [Mycobacterium abscessus ATCC 19977]
 gi|169241775|emb|CAM62803.1| Conserved hypothetical protein [Mycobacterium abscessus]
          Length = 336

 Score = 96.5 bits (238), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 34/260 (13%), Positives = 70/260 (26%), Gaps = 30/260 (11%)

Query: 130 SAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFD 189
           S         +             + + +            R  +M+V+DVSRSMES   
Sbjct: 56  SVAPTRPRTWRHAATALLVVGLMVLTIALAGPTHDVRIPRNRAVVMLVIDVSRSMESTD- 114

Query: 190 SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKY 249
            +  ++  A ++       +    +       GL+ ++                   +  
Sbjct: 115 VAPNRLGAAKEAGKEFARNLTPGIN------LGLIAYAGTATVLVSPTTNRDATVNALDN 168

Query: 250 LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSL 309
           L      T +  G+  A   I  +          D      IV M+DG+           
Sbjct: 169 LQ-LADRTATGEGIFTALQAIATV---GAVIGGGDKPPPARIVLMSDGKETVPSNPDNPK 224

Query: 310 ---YYCNEAKKRGAIVYAIGIRV--------------IRSHEFLRACA--SPNSFYLVEN 350
                   AK +   +  I                    + + +   A  S    Y    
Sbjct: 225 GAYTAARTAKDQQVPISTIAFGTKDGYVEINGQRQNVPYAPDMMEKVAKLSGGETYTAST 284

Query: 351 PHSMYDAFSHIGKDIVTKRI 370
              + + ++++ + I  + I
Sbjct: 285 LGQLKEVYANLQQQIGYETI 304


>gi|218708116|ref|YP_002415737.1| hypothetical protein VS_0028 [Vibrio splendidus LGP32]
 gi|218321135|emb|CAV17085.1| Conserved hypothetical protein, putative exported, TadG [Vibrio
           splendidus LGP32]
          Length = 435

 Score = 96.5 bits (238), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 29/233 (12%), Positives = 72/233 (30%), Gaps = 16/233 (6%)

Query: 8   IRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMN 67
           +++      G   +L AI +P +F V  +  + +     K  L    + +++  +     
Sbjct: 1   MKHAMRKQSGHAAMLFAIMIPALFGVFMLGSDGARALQTKARLEEASEAAVLAVS----- 55

Query: 68  EGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGY 127
                  K  +   +  R    +     + L         D++    +       +   Y
Sbjct: 56  ------AKDEQDHQLAERYIQHYLYDMDSILDIEVKKLGCDEMPECIAATERGEARYFEY 109

Query: 128 SISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESF 187
            ++  + +K        I  + +S      +T S K        +D+  ++D S SM   
Sbjct: 110 RVAGQTLHKSWFPGNDVISGFGDS----FNVTGSSKARRYQSQPIDITFIVDFSESMNDS 165

Query: 188 FD-SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWG 239
           +     +K++     I  + +E+    D+       +             +  
Sbjct: 166 WSGGRHSKLNDLKDIIEDVADELGAYNDLYPEHPHRVALTGFNRRTINKDKND 218


>gi|15608619|ref|NP_215997.1| hypothetical protein Rv1481 [Mycobacterium tuberculosis H37Rv]
 gi|31792676|ref|NP_855169.1| hypothetical protein Mb1517 [Mycobacterium bovis AF2122/97]
 gi|148661274|ref|YP_001282797.1| hypothetical protein MRA_1491 [Mycobacterium tuberculosis H37Ra]
 gi|148822701|ref|YP_001287455.1| hypothetical protein TBFG_11510 [Mycobacterium tuberculosis F11]
 gi|167968028|ref|ZP_02550305.1| hypothetical membrane protein [Mycobacterium tuberculosis H37Ra]
 gi|215403336|ref|ZP_03415517.1| hypothetical protein Mtub0_06533 [Mycobacterium tuberculosis
           02_1987]
 gi|215411140|ref|ZP_03419948.1| hypothetical protein Mtub9_07385 [Mycobacterium tuberculosis
           94_M4241A]
 gi|215426820|ref|ZP_03424739.1| hypothetical protein MtubT9_10680 [Mycobacterium tuberculosis T92]
 gi|215430374|ref|ZP_03428293.1| hypothetical protein MtubE_06801 [Mycobacterium tuberculosis
           EAS054]
 gi|215445676|ref|ZP_03432428.1| hypothetical protein MtubT_06934 [Mycobacterium tuberculosis T85]
 gi|218753198|ref|ZP_03531994.1| hypothetical protein MtubG1_07054 [Mycobacterium tuberculosis GM
           1503]
 gi|219557390|ref|ZP_03536466.1| hypothetical protein MtubT1_08827 [Mycobacterium tuberculosis T17]
 gi|253799469|ref|YP_003032470.1| hypothetical protein TBMG_02500 [Mycobacterium tuberculosis KZN
           1435]
 gi|254231712|ref|ZP_04925039.1| hypothetical protein TBCG_01457 [Mycobacterium tuberculosis C]
 gi|254364352|ref|ZP_04980398.1| hypothetical membrane protein [Mycobacterium tuberculosis str.
           Haarlem]
 gi|254550498|ref|ZP_05140945.1| hypothetical protein Mtube_08557 [Mycobacterium tuberculosis
           '98-R604 INH-RIF-EM']
 gi|260186427|ref|ZP_05763901.1| hypothetical protein MtubCP_10429 [Mycobacterium tuberculosis
           CPHL_A]
 gi|260204765|ref|ZP_05772256.1| hypothetical protein MtubK8_10713 [Mycobacterium tuberculosis K85]
 gi|289447084|ref|ZP_06436828.1| membrane protein [Mycobacterium tuberculosis CPHL_A]
 gi|289554729|ref|ZP_06443939.1| membrane protein [Mycobacterium tuberculosis KZN 605]
 gi|289569506|ref|ZP_06449733.1| membrane protein [Mycobacterium tuberculosis T17]
 gi|289574162|ref|ZP_06454389.1| membrane protein [Mycobacterium tuberculosis K85]
 gi|289745232|ref|ZP_06504610.1| conserved hypothetical protein [Mycobacterium tuberculosis 02_1987]
 gi|289750042|ref|ZP_06509420.1| membrane protein [Mycobacterium tuberculosis T92]
 gi|289753564|ref|ZP_06512942.1| hypothetical protein TBGG_00680 [Mycobacterium tuberculosis EAS054]
 gi|289757593|ref|ZP_06516971.1| conserved hypothetical protein [Mycobacterium tuberculosis T85]
 gi|289761639|ref|ZP_06521017.1| conserved hypothetical protein [Mycobacterium tuberculosis GM 1503]
 gi|294993225|ref|ZP_06798916.1| hypothetical protein Mtub2_01637 [Mycobacterium tuberculosis 210]
 gi|297634047|ref|ZP_06951827.1| hypothetical protein MtubK4_07987 [Mycobacterium tuberculosis KZN
           4207]
 gi|297731033|ref|ZP_06960151.1| hypothetical protein MtubKR_08072 [Mycobacterium tuberculosis KZN
           R506]
 gi|298524990|ref|ZP_07012399.1| conserved hypothetical protein [Mycobacterium tuberculosis
           94_M4241A]
 gi|306775670|ref|ZP_07414007.1| membrane protein [Mycobacterium tuberculosis SUMu001]
 gi|306779490|ref|ZP_07417827.1| membrane protein [Mycobacterium tuberculosis SUMu002]
 gi|306784220|ref|ZP_07422542.1| membrane protein [Mycobacterium tuberculosis SUMu003]
 gi|306788587|ref|ZP_07426909.1| membrane protein [Mycobacterium tuberculosis SUMu004]
 gi|306792930|ref|ZP_07431232.1| membrane protein [Mycobacterium tuberculosis SUMu005]
 gi|306797308|ref|ZP_07435610.1| membrane protein [Mycobacterium tuberculosis SUMu006]
 gi|306803189|ref|ZP_07439857.1| membrane protein [Mycobacterium tuberculosis SUMu008]
 gi|306967588|ref|ZP_07480249.1| membrane protein [Mycobacterium tuberculosis SUMu009]
 gi|306971779|ref|ZP_07484440.1| membrane protein [Mycobacterium tuberculosis SUMu010]
 gi|307079498|ref|ZP_07488668.1| membrane protein [Mycobacterium tuberculosis SUMu011]
 gi|307084057|ref|ZP_07493170.1| membrane protein [Mycobacterium tuberculosis SUMu012]
 gi|313658366|ref|ZP_07815246.1| hypothetical protein MtubKV_08092 [Mycobacterium tuberculosis KZN
           V2475]
 gi|54040185|sp|P64856|Y1517_MYCBO RecName: Full=UPF0353 protein Mb1517
 gi|54042534|sp|P64855|Y1481_MYCTU RecName: Full=UPF0353 protein Rv1481/MT1528
 gi|166979870|sp|A5U2I5|Y1491_MYCTA RecName: Full=UPF0353 protein MRA_1491
 gi|3261503|emb|CAA16011.1| PROBABLE MEMBRANE PROTEIN [Mycobacterium tuberculosis H37Rv]
 gi|31618266|emb|CAD96184.1| PROBABLE MEMBRANE PROTEIN [Mycobacterium bovis AF2122/97]
 gi|124600771|gb|EAY59781.1| hypothetical protein TBCG_01457 [Mycobacterium tuberculosis C]
 gi|134149866|gb|EBA41911.1| hypothetical membrane protein [Mycobacterium tuberculosis str.
           Haarlem]
 gi|148505426|gb|ABQ73235.1| putative membrane protein [Mycobacterium tuberculosis H37Ra]
 gi|148721228|gb|ABR05853.1| hypothetical membrane protein [Mycobacterium tuberculosis F11]
 gi|253320972|gb|ACT25575.1| membrane protein [Mycobacterium tuberculosis KZN 1435]
 gi|289420042|gb|EFD17243.1| membrane protein [Mycobacterium tuberculosis CPHL_A]
 gi|289439361|gb|EFD21854.1| membrane protein [Mycobacterium tuberculosis KZN 605]
 gi|289538593|gb|EFD43171.1| membrane protein [Mycobacterium tuberculosis K85]
 gi|289543260|gb|EFD46908.1| membrane protein [Mycobacterium tuberculosis T17]
 gi|289685760|gb|EFD53248.1| conserved hypothetical protein [Mycobacterium tuberculosis 02_1987]
 gi|289690629|gb|EFD58058.1| membrane protein [Mycobacterium tuberculosis T92]
 gi|289694151|gb|EFD61580.1| hypothetical protein TBGG_00680 [Mycobacterium tuberculosis EAS054]
 gi|289709145|gb|EFD73161.1| conserved hypothetical protein [Mycobacterium tuberculosis GM 1503]
 gi|289713157|gb|EFD77169.1| conserved hypothetical protein [Mycobacterium tuberculosis T85]
 gi|298494784|gb|EFI30078.1| conserved hypothetical protein [Mycobacterium tuberculosis
           94_M4241A]
 gi|308215767|gb|EFO75166.1| membrane protein [Mycobacterium tuberculosis SUMu001]
 gi|308327531|gb|EFP16382.1| membrane protein [Mycobacterium tuberculosis SUMu002]
 gi|308330994|gb|EFP19845.1| membrane protein [Mycobacterium tuberculosis SUMu003]
 gi|308334816|gb|EFP23667.1| membrane protein [Mycobacterium tuberculosis SUMu004]
 gi|308338604|gb|EFP27455.1| membrane protein [Mycobacterium tuberculosis SUMu005]
 gi|308342306|gb|EFP31157.1| membrane protein [Mycobacterium tuberculosis SUMu006]
 gi|308350100|gb|EFP38951.1| membrane protein [Mycobacterium tuberculosis SUMu008]
 gi|308354737|gb|EFP43588.1| membrane protein [Mycobacterium tuberculosis SUMu009]
 gi|308358644|gb|EFP47495.1| membrane protein [Mycobacterium tuberculosis SUMu010]
 gi|308362622|gb|EFP51473.1| membrane protein [Mycobacterium tuberculosis SUMu011]
 gi|308366304|gb|EFP55155.1| membrane protein [Mycobacterium tuberculosis SUMu012]
 gi|323719929|gb|EGB29041.1| membrane protein [Mycobacterium tuberculosis CDC1551A]
 gi|326903107|gb|EGE50040.1| membrane protein [Mycobacterium tuberculosis W-148]
 gi|328459217|gb|AEB04640.1| membrane protein [Mycobacterium tuberculosis KZN 4207]
          Length = 335

 Score = 96.1 bits (237), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 32/216 (14%), Positives = 65/216 (30%), Gaps = 30/216 (13%)

Query: 174 MMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEF 233
           +M+V+DVS+SM +      +++  A ++     +E+    +       GL+ ++      
Sbjct: 99  VMLVIDVSQSMRATD-VEPSRMVAAQEAAKQFADELTPGIN------LGLIAYAGTATVL 151

Query: 234 FLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVF 293
                     +  +  L  F   T +   +  A   I  +          D      IV 
Sbjct: 152 VSPTTNREATKNALDKLQ-FADRTATGEAIFTALQAIATV---GAVIGGGDTPPPARIVL 207

Query: 294 MTDGENLSTKEDQQSL---YYCNEAKKRGAIVYAIGIRVIR--------------SHEFL 336
            +DG+                   AK +G  +  I                      E +
Sbjct: 208 FSDGKETMPTNPDNPKGAYTAARTAKDQGVPISTISFGTPYGFVEINDQRQPVPVDDETM 267

Query: 337 RACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           +  A  S  + Y       +   +S + + I  + I
Sbjct: 268 KKVAQLSGGNSYNAATLAELRAVYSSLQQQIGYETI 303


>gi|50842462|ref|YP_055689.1| aerotolerance protein BatA [Propionibacterium acnes KPA171202]
 gi|289427042|ref|ZP_06428758.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes J165]
 gi|295130539|ref|YP_003581202.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes SK137]
 gi|50840064|gb|AAT82731.1| conserved protein, putative BatA (bacteroides aerotolerance operon)
           [Propionibacterium acnes KPA171202]
 gi|289159511|gb|EFD07699.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes J165]
 gi|291375600|gb|ADD99454.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes SK137]
 gi|332675379|gb|AEE72195.1| hypothetical protein PAZ_c10200 [Propionibacterium acnes 266]
          Length = 318

 Score = 96.1 bits (237), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 37/219 (16%), Positives = 73/219 (33%), Gaps = 30/219 (13%)

Query: 169 DARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
             R  +++ +DVSRSM +      +++  A  +          + D+       LV F+ 
Sbjct: 84  RDRATVVVAIDVSRSMVATD-VEPSRLSAAKTAAKDF------LGDLPPRFNVSLVKFAA 136

Query: 229 KIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
             +         + +   I  L     ST    G+  + N +  +    +H         
Sbjct: 137 SAQVVVPPTTDRAAVSTAITNLQVL-PSTAIGEGIYSSLNALKLVPDDPKH---PGQKPP 192

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV--------------IRSHE 334
             IV ++DG     +     L    EA ++   VY I                    +H 
Sbjct: 193 AAIVLLSDGATNVGRPS---LEAAKEAGRQHVPVYTIAYGTAGGYVVEGGQRQPVPVNHY 249

Query: 335 FLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKRIW 371
            L A A  S    +  E+   + D +  I + +  ++++
Sbjct: 250 ELAAIAKASGGEKFSAESLGQLSDVYKSIAQSVGYEKVF 288


>gi|308270599|emb|CBX27211.1| hypothetical protein N47_A12400 [uncultured Desulfobacterium sp.]
          Length = 330

 Score = 96.1 bits (237), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 38/227 (16%), Positives = 75/227 (33%), Gaps = 49/227 (21%)

Query: 171 RLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
            +D+M+ LD S SM++         +T++ +  K +   ++E           + GLV F
Sbjct: 85  GVDIMLCLDTSGSMQALDFELDGKPVTRLTVVKKVVADFIKE-------RETDRIGLVVF 137

Query: 227 SNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
             +      L      L   +    +   G ST     +  A  ++ D++          
Sbjct: 138 GQEAFTQSPLTMDKGLLLSLVDKMEIGMAGDSTAIGNAIAVAGKRLKDLKAKS------- 190

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIR---------------- 328
               KI++ +TDG + +   D         A   G  +Y IG+                 
Sbjct: 191 ----KIMIILTDGRSNTG--DITPEEAAGAAAALGIKIYTIGVGGTGPAPFKVNTFFGPR 244

Query: 329 -----VIRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                V    + L+  A      ++   +   + + +  I K   T+
Sbjct: 245 IVNQSVDLDEKTLKEIAAIGKGKYFRATDSKELANIYEIINKAEKTE 291


>gi|289607418|emb|CBI60804.1| unnamed protein product [Sordaria macrospora]
          Length = 814

 Score = 96.1 bits (237), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 23/244 (9%), Positives = 69/244 (28%), Gaps = 41/244 (16%)

Query: 2   FSLNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHA 61
            +L + +   + + +G    L  + L  +  ++G  ++++  +  +       D   +  
Sbjct: 1   MALRMLLGRLWSDQRGNTLALMTLALIPLVALMGSGLDMTRAYVAQNRFRQACDAGSLAG 60

Query: 62  ATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVV 121
              +         +                  F  +       +    +  S        
Sbjct: 61  RRMLAGLTLPQAARDEAT------------KYFMFDFPQGYLQSAPYTLTMSVPT----- 103

Query: 122 PQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVS 181
                 ++   S+  +P               + +  T      +Q     D+M V D+S
Sbjct: 104 ----AGTLQISSQTTVPTTLM----GLFGFDTLPISTTC---SATQDFVNTDIMFVFDLS 152

Query: 182 RSME---------SFFDSSITKIDMAIKSINAMLEEVKLIPDV----NNVVQSGLVTFSN 228
            SM             + S +++     +  +  + ++         N  ++ G V +++
Sbjct: 153 GSMNCAPGVTGYCGDVEQSGSRMGALRSAATSFYDTLETAQSQLAANNLRLRYGFVNYNS 212

Query: 229 KIEE 232
            +  
Sbjct: 213 TVNV 216



 Score = 42.5 bits (98), Expect = 0.099,   Method: Composition-based stats.
 Identities = 33/202 (16%), Positives = 55/202 (27%), Gaps = 43/202 (21%)

Query: 208 EVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAY 267
                     V +  +     + +         S     +  L   G + +    +  A 
Sbjct: 436 YYPDWSWSYGVGRQPVAYCPTEAKRLQNYHNNRSGFVSYLNGLVARGGTYHDIGMIWGAR 495

Query: 268 NQIFDMQGMRQHCNTEDAN------------YKKIIVFMTDGENLSTKED---------- 305
                         T D N             KK ++FMTDG+   T  D          
Sbjct: 496 FLSTTGLFKSATPETNDVNDPDNPAKIRGFSVKKYMIFMTDGDMSPTWSDYSAYGIEYLD 555

Query: 306 -------------------QQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACAS-PNSF 345
                              Q+    CN AK +G  ++ I      + + +  CAS P   
Sbjct: 556 GRVMGSPTTDNTALLARHLQRFRMACNAAKAKGIDIWVIAFSTTLTAD-MTNCASKPEQA 614

Query: 346 YLVENPHSMYDAFSHIGKDIVT 367
             + +  ++   F  IG  I T
Sbjct: 615 AGLSSNAALIAKFKEIGSKIAT 636


>gi|121637412|ref|YP_977635.1| hypothetical protein BCG_1543 [Mycobacterium bovis BCG str. Pasteur
           1173P2]
 gi|224989887|ref|YP_002644574.1| hypothetical protein JTY_1518 [Mycobacterium bovis BCG str. Tokyo
           172]
 gi|166979775|sp|A1KIS1|Y1543_MYCBP RecName: Full=UPF0353 protein BCG_1543
 gi|254800546|sp|C1ANC7|Y1518_MYCBT RecName: Full=UPF0353 protein JTY_1518
 gi|121493059|emb|CAL71530.1| Probable membrane protein [Mycobacterium bovis BCG str. Pasteur
           1173P2]
 gi|224773000|dbj|BAH25806.1| hypothetical protein JTY_1518 [Mycobacterium bovis BCG str. Tokyo
           172]
          Length = 335

 Score = 96.1 bits (237), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 32/216 (14%), Positives = 65/216 (30%), Gaps = 30/216 (13%)

Query: 174 MMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEF 233
           +M+V+DVS+SM +      +++  A ++     +E+    +       GL+ ++      
Sbjct: 99  VMLVIDVSQSMRATD-VEPSRMVAAQEAAKQFADELTPGIN------LGLIAYAGTATVL 151

Query: 234 FLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVF 293
                     +  +  L  F   T +   +  A   I  +          D      IV 
Sbjct: 152 VSPTTNREATKNALDKLQ-FADRTATGEAIFTALQAIATV---GAVIGGGDTPPPARIVL 207

Query: 294 MTDGENLSTKEDQQSL---YYCNEAKKRGAIVYAIGIRVIR--------------SHEFL 336
            +DG+                   AK +G  +  I                      E +
Sbjct: 208 FSDGKETMPTNPDNPKGAYTAARTAKDQGVPISTISFGTPYGFVEIDDQRQPVPVDDETM 267

Query: 337 RACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           +  A  S  + Y       +   +S + + I  + I
Sbjct: 268 KKVAQLSGGNSYNAATLAELRAVYSSLQQQIGYETI 303


>gi|59711129|ref|YP_203905.1| TadG-like protein [Vibrio fischeri ES114]
 gi|59479230|gb|AAW85017.1| TadG-like protein [Vibrio fischeri ES114]
          Length = 465

 Score = 96.1 bits (237), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 33/310 (10%), Positives = 83/310 (26%), Gaps = 34/310 (10%)

Query: 8   IRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMN 67
           I        G   IL  + +P++F V  +  + +     K  L    + +++  +     
Sbjct: 2   IMKLKKQQSGHAAILFVMCIPVLFGVFTLASDGARALQSKARLEDAAEAAVLAVSAYGEE 61

Query: 68  EGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQN-EG 126
           +       K      +                 N    +++ +  S   +      +   
Sbjct: 62  DEVSTQTGKDYVAHYM-------------HDMSNLVDIEVEKLECSELPECTADDNDRPF 108

Query: 127 YSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMES 186
                  R K    F              +   S  +   Q+   +D+  +LD S SM  
Sbjct: 109 VEYQVSGRTKHKSWFPGNDVTVGFGESFDVTGMSKAR-KFQSSQPMDITFILDFSGSMNY 167

Query: 187 FFDSS------------------ITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
            ++                     +++      +  + +E+++  +     +  +     
Sbjct: 168 DWEGHAPSYMEEEVPKVPGRYSPPSRLSDLKDVVQMVTDELQVYNNSTTGPKHRVAMTGY 227

Query: 229 KIEEFFLLEWGVSHLQ-RKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287
                     G   ++ ++I   +  G         K   N+ F ++G        D   
Sbjct: 228 NRRTVNESSNGKFVIRDQRITKYNSDGYDAGDKFYPKKTINKQFMVKGAAARVPNGDEKA 287

Query: 288 KKIIVFMTDG 297
           +   +  T  
Sbjct: 288 EFTDIMYTSD 297


>gi|314981157|gb|EFT25251.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL110PA3]
 gi|315091980|gb|EFT63956.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL110PA4]
          Length = 320

 Score = 96.1 bits (237), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 37/238 (15%), Positives = 80/238 (33%), Gaps = 33/238 (13%)

Query: 153 HIVMPITSSVKVNSQTDARLD---MMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEV 209
            + + + +  +  +  +   D   +++ +DVSRSM +      +++  A  +        
Sbjct: 67  SMAIMVLAFAQPKAYHEVPRDRATVVVAIDVSRSMVATD-VEPSRLSAAKTAAKDF---- 121

Query: 210 KLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQ 269
             + D+       LV F+   +         + +   I  L     ST    G+  + N 
Sbjct: 122 --LGDLPPRFNVSLVKFAASAQVVVPPTTDRAAVSTAITNLQVL-PSTAIGEGIYSSLNA 178

Query: 270 IFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV 329
           +  +    +H           IV ++DG     +     L    EA ++   VY I    
Sbjct: 179 LKLVPDDPKH---PGQKPPAAIVLLSDGATNVGRPS---LEAAKEAGRQHVPVYTIAYGT 232

Query: 330 --------------IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKRIW 371
                           +H  L A A  S    +  E+   + D +  I + +  ++++
Sbjct: 233 AGGYVVEGGQRQPVPVNHYELAAIAKASGGEKFSAESLGQLSDVYKSIAQSVGYEKVF 290


>gi|314923047|gb|EFS86878.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL001PA1]
 gi|314966819|gb|EFT10918.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL082PA2]
 gi|315093261|gb|EFT65237.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL060PA1]
 gi|315103481|gb|EFT75457.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL050PA2]
 gi|327327645|gb|EGE69421.1| von Willebrand factor, type A [Propionibacterium acnes HL103PA1]
          Length = 320

 Score = 96.1 bits (237), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 37/238 (15%), Positives = 80/238 (33%), Gaps = 33/238 (13%)

Query: 153 HIVMPITSSVKVNSQTDARLD---MMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEV 209
            + + + +  +  +  +   D   +++ +DVSRSM +      +++  A  +        
Sbjct: 67  SMAIMVLAFAQPKAYHEVPRDRATVVVAIDVSRSMVATD-VEPSRLSAAKTAAKDF---- 121

Query: 210 KLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQ 269
             + D+       LV F+   +         + +   I  L     ST    G+  + N 
Sbjct: 122 --LGDLPPRFNVSLVKFAASAQVVVPPTTDRAAVSTAITNLQVL-PSTAIGEGIYSSLNA 178

Query: 270 IFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV 329
           +  +    +H           IV ++DG     +     L    EA ++   VY I    
Sbjct: 179 LKLVPDDPKH---PGQKPPAAIVLLSDGATNVGRPS---LEAAKEAGRQHVPVYTIAYGT 232

Query: 330 --------------IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKRIW 371
                           +H  L A A  S    +  E+   + D +  I + +  ++++
Sbjct: 233 AGGYVVEGGQRQPVPVNHYELAAIAKASGGEKFSAESLGQLSDVYKSIAQSVGYEKVF 290


>gi|317508725|ref|ZP_07966378.1| von Willebrand factor type A domain-containing protein
           [Segniliparus rugosus ATCC BAA-974]
 gi|316252973|gb|EFV12390.1| von Willebrand factor type A domain-containing protein
           [Segniliparus rugosus ATCC BAA-974]
          Length = 350

 Score = 96.1 bits (237), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 39/251 (15%), Positives = 83/251 (33%), Gaps = 34/251 (13%)

Query: 139 LKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMA 198
           L       +      + + ++    +      R  +++V+D+S SM        T++D A
Sbjct: 74  LTHVPVAVFLVGLLLLTVALSGPTTLAKVPKNRATVVLVIDISLSMMCDD-VRPTRVDAA 132

Query: 199 IKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIK-YLSKFGVS- 256
            ++    ++E++           GLVTF+   +           ++R +   +    ++ 
Sbjct: 133 RQAAIKFVDEMEPTLQ------LGLVTFAGTAQTLIAPSSDHEVVKRALDDAIRPDKLAA 186

Query: 257 -TNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSL---YYC 312
            T +  G+  A  QI  ++G               IV  +DG+     +           
Sbjct: 187 RTATGEGIYTALQQIETLKG---ILGGASKAPPARIVLESDGKETVPDDLNAPRGAFTAA 243

Query: 313 NEAKKRGAIVYAIGIRV----------------IRSHEFLRACA--SPNSFYLVENPHSM 354
            EAK +   +Y+I                          L+  A  S   F+   +   +
Sbjct: 244 KEAKAKEVPIYSISFGTASPIPYVNIQGSRVPVPADDASLQKVAELSGGKFFTASSLDQL 303

Query: 355 YDAFSHIGKDI 365
            D +S +  +I
Sbjct: 304 TDVYSSLNAEI 314


>gi|90420284|ref|ZP_01228192.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335618|gb|EAS49368.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 593

 Score = 96.1 bits (237), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 29/205 (14%), Positives = 69/205 (33%), Gaps = 24/205 (11%)

Query: 9   RNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNE 68
           + F+    G + ++  + LPI+   +G  +++S I+  K  L   +D + + A  +  N 
Sbjct: 13  KRFWTAKSGNVAVVFGLTLPILACCMGAAVDISGIYASKRNLQHSVDIAALAAGREYSNN 72

Query: 69  GNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYS 128
              ++  K+  G            +                    T      +   +G +
Sbjct: 73  QQDSHLSKVAEGYFFENAGADARAN--------------------TDFSYDGIFNEDGST 112

Query: 129 I-SAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVN-SQTDARLDMMIVLDVSRSMES 186
           +    +  + P  F   + + T           + +      +  +++++VLD S SM  
Sbjct: 113 VLQVSAARRHPTIFGDLLSFVTAGELDWRAFPLAARSQIVVQNQSIELVMVLDNSGSMTG 172

Query: 187 --FFDSSITKIDMAIKSINAMLEEV 209
                    KID   ++   +  + 
Sbjct: 173 RPKSGGGKRKIDTIKEAAIGLTGQF 197



 Score = 64.1 bits (154), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 30/260 (11%), Positives = 70/260 (26%), Gaps = 69/260 (26%)

Query: 179 DVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEW 238
           D S+    + +    +   A  +++   +  K     +    +        +        
Sbjct: 333 DGSKGDNDYLEDEGRRSMPAETAMSVQAKVAKYFDGSDLQRGNHPGPNRGCLSTPVTPLT 392

Query: 239 GVSHLQRK-IKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDG 297
                    I  +   G  TN   G+ + +  +   +   Q    +  +  K++V MTDG
Sbjct: 393 DNQATINAAINAMDADGE-TNIPEGIAWGWRLLSAREPFTQGRANDAKDNLKVLVLMTDG 451

Query: 298 ENLSTKE-------------------------------------------------DQQS 308
           +N    +                                                 +++ 
Sbjct: 452 DNNYGSDENDYNESGYGTFGYASTYDAYGNHSWGRIFDDTSTTSKRANRSSFVSAMNEKV 511

Query: 309 LYYCNEAK--------KRGAIVYAIGIRVIRS---HEFLRACASPN-------SFYLVEN 350
              C   K        + G +++ I   +       + +  CAS          +Y  ++
Sbjct: 512 AAICQNIKDDGRKATGEDGIVIFTIAFDLNDGSSVKKLMEQCASYGITDPTKKLYYDAKS 571

Query: 351 PHSMYDAFSHIGKDIVTKRI 370
              +  AF  I + + + RI
Sbjct: 572 SSDLMAAFDSITEQVSSLRI 591


>gi|242076422|ref|XP_002448147.1| hypothetical protein SORBIDRAFT_06g022130 [Sorghum bicolor]
 gi|241939330|gb|EES12475.1| hypothetical protein SORBIDRAFT_06g022130 [Sorghum bicolor]
          Length = 697

 Score = 96.1 bits (237), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 44/232 (18%), Positives = 83/232 (35%), Gaps = 38/232 (16%)

Query: 151 SRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVK 210
           S  +   + +   + S     +D++ VLDVS SM         K+ +  +++  +     
Sbjct: 243 SNDVTGSLVNESSMRSSRRVPIDLVTVLDVSGSMAGT------KLALLKQAMGFV----- 291

Query: 211 LIPDVNNVVQSGLVTFSNKIEEFF----LLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYA 266
            I  +    +  ++ FS+     F    +   G     + I  L   G  TN    LK A
Sbjct: 292 -IQHLRPSDRLSVIAFSSTARRLFPLQRMSHHGRQQALQAISSLGA-GGGTNIADALKKA 349

Query: 267 YNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENL--------STKEDQQSLYYCNEAKKR 318
              I          +    N    I+ ++DG++          T   ++SL   +   + 
Sbjct: 350 VKVIE---------DRNYKNSVCSIILLSDGQDTFNISSNFQGTSAGRRSLVPPSILNEL 400

Query: 319 G-AIVYAIGIRVIRSHEFLRAC--ASPNSFYLVENPHSMYDAFSH-IGKDIV 366
               ++  G       + L +   AS  +F  +E+   M DAF+  IG  + 
Sbjct: 401 HMVPLHTFGFGADHDSDTLHSISEASGGTFSFIEDEGVMQDAFAQCIGGLLS 452


>gi|161529149|ref|YP_001582975.1| von Willebrand factor type A [Nitrosopumilus maritimus SCM1]
 gi|160340450|gb|ABX13537.1| von Willebrand factor type A [Nitrosopumilus maritimus SCM1]
          Length = 316

 Score = 96.1 bits (237), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 34/243 (13%), Positives = 80/243 (32%), Gaps = 41/243 (16%)

Query: 145 IPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINA 204
           +        I +       ++ +    +++ IVLD S SM +      T++D A  +IN 
Sbjct: 63  MMGILGLAIIGLANPQIPTLSVEN--GINLSIVLDGSESMAATDY-EPTRLDAAKNAINN 119

Query: 205 MLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLK 264
           ++ ++    +       G+V F +       L          I  + +   +T    GL 
Sbjct: 120 LILKMGPQHN------VGVVLFESGATTVSYLTPDKEKSVNAISSIEQGLGATAIGDGLA 173

Query: 265 YAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYA 324
              +    +            + K +++ ++DG + S             AK     ++ 
Sbjct: 174 LGVDMASSI-----------PDKKGVVILLSDGVHNSG--LVTPEEATEYAKINNVQIHT 220

Query: 325 IGIRV-----------------IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
           IG+                       E L   A  +  ++Y   +  ++ + F ++  ++
Sbjct: 221 IGLGSIEPVFLRDDIYGEPQYAELDEETLVIIAQQTSGNYYKSLDEQTLNEIFVNLSSNL 280

Query: 366 VTK 368
             +
Sbjct: 281 AYE 283


>gi|254820232|ref|ZP_05225233.1| hypothetical protein MintA_09906 [Mycobacterium intracellulare ATCC
           13950]
          Length = 327

 Score = 96.1 bits (237), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 34/217 (15%), Positives = 66/217 (30%), Gaps = 33/217 (15%)

Query: 174 MMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEF 233
           +M+V+D+S+SM +       ++  A ++ +    ++    +       GLV F+      
Sbjct: 92  IMLVIDMSQSMRATD-VEPNRLKAAEQAASQFASQLTPGIN------LGLVGFAGTPYLL 144

Query: 234 FLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVF 293
                        +K L  F  ST +   +  A + I             D      IV 
Sbjct: 145 VPPTPQHQATIDALKKLD-FADSTATGQAIFTALHAI-----GATAVTGGDNPPPARIVL 198

Query: 294 MTDGENLSTKEDQQSLY----YCNEAKKRGAIVYAIGIRV--------------IRSHEF 335
           ++DG                     AK  G  +  I                    S + 
Sbjct: 199 LSDGRENKPSNPSDPHDGVYTAARLAKDEGVPISTISFGTKGGEIEMDGQRVAVPVSTDQ 258

Query: 336 LRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           ++  A  S    Y   N   +  +++ I  +I  + +
Sbjct: 259 MKTIARLSGGQPYTATNIGELNKSYNAIENEIGYRTV 295


>gi|126341666|ref|XP_001379908.1| PREDICTED: hypothetical protein [Monodelphis domestica]
          Length = 2347

 Score = 96.1 bits (237), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 35/201 (17%), Positives = 69/201 (34%), Gaps = 18/201 (8%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D+ +++D S S+       +       K+  + + E+  I      V +   +   ++E 
Sbjct: 442 DIYLLIDGSGSIYPTDFQEM-------KAFLSEVIEMFTIAPYKVRVGAVQYSHIQELEF 494

Query: 233 FFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIV 292
                   + L + I  + + G +TN+   L +    +      R      +     +IV
Sbjct: 495 EINKYSNKNDLGKAIDNIWQLGGNTNTGAALDFTLGLL-----QRAKTQRGNKVPCHLIV 549

Query: 293 FMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPH 352
                       D   L    + K     VYAIG++     + L    +    Y V N  
Sbjct: 550 L------TDGMSDDNVLEPAKKLKDENINVYAIGVKEANRTQLLEIAGTEKRVYYVYNFD 603

Query: 353 SMYDAFSHIGKDIVTKRIWYD 373
           S+ D  + + + I +K    D
Sbjct: 604 SLKDIKNQVVQGICSKEACKD 624



 Score = 87.6 bits (215), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 33/199 (16%), Positives = 74/199 (37%), Gaps = 23/199 (11%)

Query: 172 LDMMIVLDVSRSMESFFDSSITK--IDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229
           LD++ V+D S S++    + + +  I +  K+               + V+ G + +S  
Sbjct: 814 LDIVFVIDSSGSIDYNEYNIMKEFMIKLVKKA-----------DVAKDRVRFGALKYSYD 862

Query: 230 IEEFFL--LEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287
               F        S +   ++  S  G  T +   L +      +        +  +   
Sbjct: 863 PTILFYLDEFDTRSKVISLLQNDSPKGGDTYTAKALAF-----SEHMFTEARGSRINQKV 917

Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYL 347
            ++++ +TDGE+    +  Q        + +G ++ A+GI    + E L    S + ++ 
Sbjct: 918 PQVLIVITDGESH---DANQLNATAKALRDKGILILAVGIAGANTEELLAMAGSTDKYFF 974

Query: 348 VENPHSMYDAFSHIGKDIV 366
           VE    +   F ++   I 
Sbjct: 975 VETFGGLKGIFQNVSDSIC 993



 Score = 69.9 bits (169), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 35/311 (11%), Positives = 96/311 (30%), Gaps = 25/311 (8%)

Query: 61   AATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVV 120
             A  +    +     +    +              +   +           +   +  V 
Sbjct: 894  TAKALAFSEHMFTEARGSRINQKVPQVLIVITDGESHDANQLNATAKALRDKGILILAVG 953

Query: 121  VPQNEGYSISAISRYKIPLKFCTFIPWYTN-SRHIVMPITSSVKVNSQTDARLDMMIVLD 179
            +       + A++       F           +++   I    KV  + +   D++ +LD
Sbjct: 954  IAGANTEELLAMAGSTDKYFFVETFGGLKGIFQNVSDSICGPSKVECKMEKA-DLVFLLD 1012

Query: 180  VSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWG 239
             S S+               K  + ++  V       + V  GL  FS+     F L   
Sbjct: 1013 GSNSIYPENF---------KKMKDFLVSVVDDFDIGPSRVHIGLAQFSHVYRAEFFLGSF 1063

Query: 240  VSHLQ--RKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDG 297
             S  +   +I+   +   +T+          +  +     +  +  +   +++++ +TD 
Sbjct: 1064 TSEGEVSTQIEMTQQVFGNTHIGAA-----LKQVEQYFRPEMGSRINVGIQQVLLVLTD- 1117

Query: 298  ENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA-SPNSFYLVENPHSMYD 356
                 +   +      + +++G  +Y++GI      + L   + + +    ++N   +  
Sbjct: 1118 ----GQSQDEVAKAAEDLRRKGIDIYSLGIG-DVDEQQLIQISGTSDKKLTIDNFDELKK 1172

Query: 357  AFSHIGKDIVT 367
                I ++I T
Sbjct: 1173 IKKRIVRNICT 1183



 Score = 58.3 bits (139), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 28/213 (13%), Positives = 65/213 (30%), Gaps = 21/213 (9%)

Query: 158 ITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNN 217
           +       +  D + D+M ++D SRS+                 +  ++ + ++  D   
Sbjct: 613 VQGICSKEACKDVKADVMFLVDSSRSIGLENFG------KMKTFMKNLVNKSQIGEDQVQ 666

Query: 218 VVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
           V        + +  +              I  +S     T +   LK+  +     +G R
Sbjct: 667 VGIVQFSDVNKEEFQLNRYWTQHEIF-DAIDRMSNIDRETLTGSALKFVSDYFHPSKGAR 725

Query: 278 QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
                     +K ++ +TD      +            ++ G I+Y++G+    +   L 
Sbjct: 726 -------PGVRKFLILITD-----GESQDPVKDPAMALRQDGVIIYSVGV-YGANETQLV 772

Query: 338 ACASPNSF-YLVENPHSMYDAFSHIGKDIVTKR 369
             +      + VE    +      +   I   R
Sbjct: 773 EISGKPEMIFYVETFDILKHIEDDLVFGICNPR 805



 Score = 48.3 bits (113), Expect = 0.002,   Method: Composition-based stats.
 Identities = 22/171 (12%), Positives = 60/171 (35%), Gaps = 21/171 (12%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D++ +LD       + + +   ++        + E V       N ++ GLVT++++ + 
Sbjct: 235 DVVFLLD------EYVNGTQENLEHLK---GFLEESVSSFDVKENCMRIGLVTYTDETKV 285

Query: 233 FFL--LEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKI 290
                     S + ++I+ LS       +   +     ++F +Q   +          +I
Sbjct: 286 IHSLSTGTNKSEVLQEIQKLSPKAGRAYTGAAMTKVRKEVFSVQKGSRRM----QGVPQI 341

Query: 291 IVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACAS 341
            + +          +        + ++ G  V+ +G+      + L   +S
Sbjct: 342 AILVAH-----RPSEDNVSEAALDLRREGVTVFTVGLEGSDDTQ-LGQISS 386



 Score = 41.0 bits (94), Expect = 0.33,   Method: Composition-based stats.
 Identities = 21/200 (10%), Positives = 62/200 (31%), Gaps = 23/200 (11%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D++ ++D S                       + + +  +P      +  L  +S+ + +
Sbjct: 26  DVVFLVDSS------DHVGSKSFPFVRT---FISKTINSLPVEARKFRIALAQYSDDLHQ 76

Query: 233 FF--LLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKI 290
            F        + +   +K    +   +     +  A  ++            +   + ++
Sbjct: 77  EFLLSPFMTKNAILNHLKRNFTYMGGS---LRIGNALEKVHKTYFSGPMNGRDKNQFPQV 133

Query: 291 IVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYL--- 347
           +V +T         +          ++ G  +  +G++   S E L+  A+    Y    
Sbjct: 134 LVVLTSAH-----SEDDVEGPAKALQRDGVKIITLGMQ-NASEENLKTMATAQFHYNLRT 187

Query: 348 VENPHSMYDAFSHIGKDIVT 367
           V +  +     + I K++  
Sbjct: 188 VRDVGTFSTNMTSIIKEVAK 207



 Score = 39.1 bits (89), Expect = 1.3,   Method: Composition-based stats.
 Identities = 30/283 (10%), Positives = 70/283 (24%), Gaps = 17/283 (6%)

Query: 68   EGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGY 127
              N      +          +    +      D   V    + V +      +       
Sbjct: 1985 GVNTRRIATIFSDGQSTDASSIVTATMEFNALDVIPVVIAFNNVPAVKRAFAIDDTGAFQ 2044

Query: 128  SISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVS---RSM 184
             ++   R                       ++          + +D   +   S    S 
Sbjct: 2045 VLTIPPRADYKPMLKRLQQCTFCYDRCKPDVSCEQAKPPAAPSYIDAAFLFQGSRDVGSA 2104

Query: 185  ESFFDSSITK-----IDMAIK-SINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEW 238
            E        K      ++AI+   +A+ + V L+            +   ++E  F    
Sbjct: 2105 EFEDVKVFLKALLDNFEVAIEPETSAVGDRVALLSHAPPGFMPNTRSSPVRMEFNFTTYN 2164

Query: 239  GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGE 298
                ++R ++   +             A+        +    +      K  I+F+    
Sbjct: 2165 DKRLMKRHVEESVQQLNG--------EAFLGHALQWTVDNIFSGTSNMRKNRIIFVVSTG 2216

Query: 299  NLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACAS 341
              S  + +        AK +G  ++     +  + E L   AS
Sbjct: 2217 ETSYLDRKVLKKESLRAKCQGYAIFVFSFGLSHNDEELEELAS 2259


>gi|315080701|gb|EFT52677.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL078PA1]
          Length = 320

 Score = 96.1 bits (237), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 39/257 (15%), Positives = 80/257 (31%), Gaps = 30/257 (11%)

Query: 131 AISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDS 190
                +   +         +   IV+        +     R  +++ +DVSRSM +    
Sbjct: 48  LSPSSRPWKQHLAMGLSVLSMAIIVLAFAQPKAYHEVPRDRATVVVAIDVSRSMVATD-V 106

Query: 191 SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYL 250
             +++  A  +          + D+       LV F+   +         + +   I  L
Sbjct: 107 EPSRLSAAKTAAKDF------LGDLPPRFNVSLVKFAASAQVVVPPTTDRAAVSTAITNL 160

Query: 251 SKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLY 310
                ST    G+  + N +  +    +H           IV ++DG     +     L 
Sbjct: 161 QVL-PSTAIGEGIYSSLNALKLVPDDPKH---PGQKPPAAIVLLSDGATNVGRPS---LE 213

Query: 311 YCNEAKKRGAIVYAIGIRV--------------IRSHEFLRACA--SPNSFYLVENPHSM 354
              EA ++   VY I                    +H  L A A  S    +  E+   +
Sbjct: 214 AAKEAGRQHVPVYTIAYGTAGGYVVEGGQRQPVPVNHYELAAIAKASGGEKFSAESLGQL 273

Query: 355 YDAFSHIGKDIVTKRIW 371
            D +  I + +  ++++
Sbjct: 274 SDVYKSIAQSVGYEKVF 290


>gi|116329598|ref|YP_799317.1| BatA [Leptospira borgpetersenii serovar Hardjo-bovis L550]
 gi|116332487|ref|YP_802204.1| BatA [Leptospira borgpetersenii serovar Hardjo-bovis JB197]
 gi|116122491|gb|ABJ80384.1| BatA [Leptospira borgpetersenii serovar Hardjo-bovis L550]
 gi|116127354|gb|ABJ77446.1| BatA [Leptospira borgpetersenii serovar Hardjo-bovis JB197]
          Length = 312

 Score = 96.1 bits (237), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 43/237 (18%), Positives = 79/237 (33%), Gaps = 34/237 (14%)

Query: 144 FIPWYTNSRHIVMPITSSVKVNS---QTDARLDMMIVLDVSRSM-ESFFDSSITKIDMAI 199
            +        +V+ +    K  +        +D+MI LDVS SM  S      T++ ++ 
Sbjct: 55  PLLRPIAISLVVVALAGPGKKTTFLPNEKKGVDVMIALDVSGSMSRSRDFLPETRLGVSK 114

Query: 200 KSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFG---VS 256
           K +   +       D     + GLV F+        L      L   +  + +       
Sbjct: 115 KLLRKFI-------DKRKSDRLGLVVFAGAAYLQAPLTGDRESLNEILGTIEEETVAEQG 167

Query: 257 TNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAK 316
           T     +            +  +         K+IV +TDG + + K D   +   + A+
Sbjct: 168 TAIGDAII-----------LSTYRLRASQARSKVIVLITDGVSNTGKID--PVTATDLAE 214

Query: 317 KRGAIVYAIGIRVIRSH-----EFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIV 366
             G  +Y++GI           E LR  +  +   F+  E+P  M    + I     
Sbjct: 215 HIGVKIYSVGIGKEDGSYEINFEILRELSASTGGKFFRAEDPEEMKAVLTSIDSLEK 271


>gi|119358220|ref|YP_912864.1| von Willebrand factor, type A [Chlorobium phaeobacteroides DSM 266]
 gi|119355569|gb|ABL66440.1| von Willebrand factor, type A [Chlorobium phaeobacteroides DSM 266]
          Length = 344

 Score = 96.1 bits (237), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 38/262 (14%), Positives = 84/262 (32%), Gaps = 54/262 (20%)

Query: 139 LKFCTFIPWYTNSRHIVMPITSSVK------VNSQTDARLDMMIVLDVSRSMESFFDSSI 192
             F   +P++  +  +++ + +  +              +D+++VLDVSRSM     +  
Sbjct: 64  SFFLGRLPFFLRAAVLLLSVFAMAQPRIVQRQTVAETRGIDLLLVLDVSRSMHQQDFNGQ 123

Query: 193 TKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSK 252
           ++++         +          +  + GLV FS K      L      L   +  +S 
Sbjct: 124 SRLEAVKGVGKQFVLS-------RSADRIGLVVFSGKGYTPCPLTLDHLTLGTVLDNISS 176

Query: 253 FGV---STNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSL 309
             +    T     +  A            +      + +K I+ +TDG+N +   D   L
Sbjct: 177 EVIQEEGTAIGTAILIAV-----------NRLRASESRQKAIILLTDGQNNAGDID--PL 223

Query: 310 YYCNEAKKRGAIVYAIGI----------------------RVIRSHEFLRACA--SPNSF 345
                A + G  +Y I                         +    + L + +  +    
Sbjct: 224 TAAGFALQDGIKIYTIAATAQDARPFVRSAESLPAGGALSGLPA-EDVLVSISRLTQGRS 282

Query: 346 YLVENPHSMYDAFSHIGKDIVT 367
           + V +   + + F  I +   +
Sbjct: 283 FRVGDKAGLAETFDDIDRLEKS 304


>gi|194221587|ref|XP_001495285.2| PREDICTED: similar to collagen type VI alpha 6 [Equus caballus]
          Length = 2301

 Score = 95.7 bits (236), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 42/267 (15%), Positives = 90/267 (33%), Gaps = 28/267 (10%)

Query: 109 DIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQT 168
           +    T L+ +     E Y     S   +     TF+    N     + + S      ++
Sbjct: 402 EGASDTQLEKIASHPAEQYVSKLKSFSDLAAHNQTFLKKLRNQITHTLSVFSERTETLKS 461

Query: 169 D----ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
                   D+ +++D S S ++             +    + E V +       V+ G V
Sbjct: 462 GCVDTEEADIYLLIDGSGSTQATDFH---------EMKTFLSELVGMFNIAPQKVRFGAV 512

Query: 225 TFSNKIEEFF--LLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +++  +  F          L + I+ + + G +TN+   L +    +   +  R     
Sbjct: 513 QYADSWDLEFEINKYSNKHDLGKAIENIRQMGGNTNTGAALNFTLGLLQKAKKER----- 567

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
                   +V +T+G           +   N  ++    VYAIG+    +   LR  A  
Sbjct: 568 -GNKVPCHLVVLTNGV-----SKDSIVEPANRLREELIHVYAIGV-REANQTQLREIAGE 620

Query: 343 N-SFYLVENPHSMYDAFSHIGKDIVTK 368
               Y V +  ++ D  + + ++I  +
Sbjct: 621 EKRMYYVHDFDALKDIRNQVVQEICAQ 647



 Score = 84.1 bits (206), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 43/332 (12%), Positives = 104/332 (31%), Gaps = 26/332 (7%)

Query: 44   FFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGF 103
            +  ++ +   IDR      T +         +              + +   +    +  
Sbjct: 713  YMSQSEISDAIDRMAHIGETTLTGHALTFVSQYFSPAKGARPNVRKFLILITDGEAQDIV 772

Query: 104  VNDIDDIVRSTSLDIVVVPQNEGYS--ISAISRYKIPLKFCTFIPWYTNSRHIVMPITSS 161
             +    + +   +   V       +       R ++      F         +V  I  S
Sbjct: 773  KDPAVALRQEGIIIYSVGVFGSNVTQLEEISGRPEMVFYVENFDILQHIEDDLVFGI-CS 831

Query: 162  VKVNSQTDARLDMMIVLDVSRSMESFFDSSITKI--DMAIKSINAMLEEVKLIPDVNNVV 219
             +   +    LD++ V+D S S++    + +     D+  K+               N V
Sbjct: 832  PREECKRIEVLDVVFVIDSSGSIDYDEYNIMKDFMTDLVKKA-----------DVGKNQV 880

Query: 220  QSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMR 277
            + G + +++  E  F L+       +   ++     G +T +   L +      D     
Sbjct: 881  RFGALKYADDPEVLFYLDTLGTKWEVISVLQNDQPMGGNTYTAEALAF-----SDHMFTE 935

Query: 278  QHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLR 337
               +       ++++ +TDGE+    +  +        + +G ++ A+GI      E L 
Sbjct: 936  ARGSRLQRGVPQVLIVITDGESH---DADKLNATAKALRDKGILILAVGIAGANPVELLA 992

Query: 338  ACASPNSFYLVENPHSMYDAFSHIGKDIVTKR 369
               S + ++ VE    +   FS +   +    
Sbjct: 993  MAGSSDKYFFVETFGGLKGIFSDVSASVCNSS 1024



 Score = 81.4 bits (199), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 32/309 (10%), Positives = 87/309 (28%), Gaps = 21/309 (6%)

Query: 61   AATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVV 120
             A  +    +     +                   +   D           +   +  V 
Sbjct: 922  TAEALAFSDHMFTEARGSRLQRGVPQVLIVITDGESHDADKLNATAKALRDKGILILAVG 981

Query: 121  VPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDV 180
            +       + A++       F             V     +         ++D++ ++D 
Sbjct: 982  IAGANPVELLAMAGSSDKYFFVETFGGLKGIFSDVSASVCNSSKVDCEIGQIDLVFLMDG 1041

Query: 181  SRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFL--LEW 238
            S S+               K    +   V+      N V+ G   FS+  +  F      
Sbjct: 1042 SNSIHPDDF---------KKMKAFLASVVQDFDVTVNRVRIGAAQFSHNYQPEFPLGTFT 1092

Query: 239  GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGE 298
            G   +  +I+ + +    T+          +           +  +A   ++++ +TD  
Sbjct: 1093 GEEEISLQIEKIQQIFGYTHIGAA-----LRRVGRYFRPDMGSRINAGTPQVLLVLTD-- 1145

Query: 299  NLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAF 358
                +   +      + +++G  +Y++GI  +   + ++   + +    V +   +    
Sbjct: 1146 ---GQSQDEVAQAAEDLRRKGINIYSVGIGDVDDQQLVQITGTADKKLTVHDFDELRKVK 1202

Query: 359  SHIGKDIVT 367
              I + I T
Sbjct: 1203 KRIVRHICT 1211



 Score = 60.6 bits (145), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 42/277 (15%), Positives = 94/277 (33%), Gaps = 40/277 (14%)

Query: 119 VVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARL------ 172
           V V +    ++ A++  +      T     T S+++   I  + +        +      
Sbjct: 198 VGVQKASEENLKAMATAQFHFNLRTVRDLSTFSQNMTQIIKDAAQYKDGAVNDILVEVCQ 257

Query: 173 -----DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFS 227
                D++ +LDVS +       S    D   +    + E V  +    N ++ GLV FS
Sbjct: 258 GPSVADVVFLLDVSLN------GSQENFDYLKE---FLEESVSALDIKENCMRVGLVAFS 308

Query: 228 NKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDA 285
           N+ +    L      S + + I+ LS    +  +      A  +I       Q+ + ++ 
Sbjct: 309 NETKVINSLSRGINKSEVLQYIQNLSPQAGNAYTGA----AIRKIRKEVFGAQNGSRKNQ 364

Query: 286 NYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACAS---P 342
              +I V +T         +          +++G  ++ +GI      + L   AS    
Sbjct: 365 GVPQIAVLVTH-----RPSEDNVTKAAVNLRRQGVTIFTMGIEGASDTQ-LEKIASHPAE 418

Query: 343 NSFYLVENPHSM----YDAFSHIGKDIV-TKRIWYDK 374
                +++   +          +   I  T  ++ ++
Sbjct: 419 QYVSKLKSFSDLAAHNQTFLKKLRNQITHTLSVFSER 455



 Score = 47.9 bits (112), Expect = 0.002,   Method: Composition-based stats.
 Identities = 26/194 (13%), Positives = 64/194 (32%), Gaps = 16/194 (8%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D++ ++D S               +       + + +  +P   N  +  L  +S+K   
Sbjct: 61  DLVFLVDSS------DHLGTKSFPLVK---IFITKLISSLPIEANKYRVALAQYSDKFHS 111

Query: 233 FFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIV 292
            F L    S     + +L K    T  +  +  A  +           + +   +  I+V
Sbjct: 112 EFQLGTFKSRN-PMLNHLRKNVSFTGGSLRIGNALQEAHRTYFSGHANSRDKKQFPPILV 170

Query: 293 FMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPH 352
            +   E      +          ++ G  + ++G++   S E L+A A+    + +    
Sbjct: 171 VLASAE-----SEDDVEEASKALRRDGVRIISVGVQK-ASEENLKAMATAQFHFNLRTVR 224

Query: 353 SMYDAFSHIGKDIV 366
            +     ++ + I 
Sbjct: 225 DLSTFSQNMTQIIK 238


>gi|284030499|ref|YP_003380430.1| von Willebrand factor type A [Kribbella flavida DSM 17836]
 gi|283809792|gb|ADB31631.1| von Willebrand factor type A [Kribbella flavida DSM 17836]
          Length = 317

 Score = 95.7 bits (236), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 38/221 (17%), Positives = 76/221 (34%), Gaps = 30/221 (13%)

Query: 169 DARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
             R  +++ +DVS SM +       +++ A KS    + ++    +        LV F+ 
Sbjct: 83  RERATIVVAIDVSLSMMATDVD-PNRLEAAKKSAKNFVNQLPSKFN------VALVNFAG 135

Query: 229 KIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
                       + +QR I  L     ST +  G+  +   +  +    +H N       
Sbjct: 136 TASIIVPPTTDRATVQRSIDGLE-LAESTATGEGIFTSLQALTQVPPDPEHPNDPAPAR- 193

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR--------------SHE 334
             IV ++DG+    +  Q+       AK++   +Y I                       
Sbjct: 194 --IVLLSDGKRTVGRTAQEG---AQAAKEKNTPIYTITFGTDSGFIEMDGIRQRVPPDRA 248

Query: 335 FLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
            LR+ A  +    Y  E+   + D +  IG  +   ++  +
Sbjct: 249 ELRSVAEITGGEAYTAESAGELEDVYKDIGSSVGYDKVDKE 289


>gi|288942396|ref|YP_003444636.1| von Willebrand factor type A [Allochromatium vinosum DSM 180]
 gi|288897768|gb|ADC63604.1| von Willebrand factor type A [Allochromatium vinosum DSM 180]
          Length = 346

 Score = 95.7 bits (236), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 30/226 (13%), Positives = 70/226 (30%), Gaps = 43/226 (19%)

Query: 168 TDARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGL 223
           +    D+MI +D S SME+         + ++ +    +   +       D     + GL
Sbjct: 95  STPGYDLMIAVDASHSMEALDFTVEGRQVNRMAVVKGVMGRFI-------DARQGDRVGL 147

Query: 224 VTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           + F ++      L       ++ +  +        +  G   A                E
Sbjct: 148 ILFGSQAFILSPLTLDRHAARQLLDGVVPSIAGPATALGDAIALGVS---------KLRE 198

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR------------ 331
                ++++ + DG+N +             A+  G  +Y IG+   +            
Sbjct: 199 RPEGSRVMIVIADGDNNAGS--FAPKEAARLARATGTRIYVIGVGSKQPSIPILEEGSVR 256

Query: 332 -------SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                      L+  A  +   ++   +  ++ +  S IG+   T+
Sbjct: 257 YRDDLTMDEGTLQEIADLTGGGYFRATDTRALEEISSRIGQLEKTE 302


>gi|15840942|ref|NP_335979.1| hypothetical protein MT1528 [Mycobacterium tuberculosis CDC1551]
 gi|13881148|gb|AAK45793.1| conserved hypothetical protein [Mycobacterium tuberculosis CDC1551]
          Length = 335

 Score = 95.7 bits (236), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 32/216 (14%), Positives = 65/216 (30%), Gaps = 30/216 (13%)

Query: 174 MMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEF 233
           +M+V+DVS+SM +      +++  A ++     +E+    +       GL+ ++      
Sbjct: 99  VMLVIDVSQSMRATD-VEPSRMVAAQEAAKQFADELTPGIN------LGLIAYAGTATVL 151

Query: 234 FLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVF 293
                     +  +  L  F   T +   +  A   I  +          D      IV 
Sbjct: 152 VSPTTNREATKNALDKLQ-FADRTATGEAIFTALQAIATV---GAVIGGGDTXPPARIVL 207

Query: 294 MTDGENLSTKEDQQSL---YYCNEAKKRGAIVYAIGIRVIR--------------SHEFL 336
            +DG+                   AK +G  +  I                      E +
Sbjct: 208 FSDGKETMPTNPDNPKGAYTAARTAKDQGVPISTISFGTPYGFVEINDQRQPVPVDDETM 267

Query: 337 RACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           +  A  S  + Y       +   +S + + I  + I
Sbjct: 268 KKVAQLSGGNSYNAATLAELRAVYSSLQQQIGYETI 303


>gi|313792199|gb|EFS40300.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL110PA1]
 gi|314984000|gb|EFT28092.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL005PA1]
          Length = 320

 Score = 95.7 bits (236), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 37/219 (16%), Positives = 73/219 (33%), Gaps = 30/219 (13%)

Query: 169 DARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
             R  +++ +DVSRSM +      +++  A  +          + D+       LV F+ 
Sbjct: 86  RDRATVVVAIDVSRSMVATD-VEPSRLSAAKTAAKDF------LGDLPPRFNVSLVKFAA 138

Query: 229 KIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
             +         + +   I  L     ST    G+  + N +  +    +H         
Sbjct: 139 SAQVVVPPTPDRAAVSTAITNLQVL-PSTAIGEGIYSSLNALKLVPDDPKH---PGQKPP 194

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV--------------IRSHE 334
             IV ++DG     +     L    EA ++   VY I                    +H 
Sbjct: 195 AAIVLLSDGATNVGRPS---LEAAKEAGRQHVPVYTIAYGTAGGYVVEGGQRQPVPVNHY 251

Query: 335 FLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKRIW 371
            L A A  S    +  E+   + D +  I + +  ++++
Sbjct: 252 ELAAIAKASGGEKFSAESLGQLSDVYKSIAQSVGYEKVF 290


>gi|56696619|ref|YP_166980.1| hypothetical protein SPO1742 [Ruegeria pomeroyi DSS-3]
 gi|56678356|gb|AAV95022.1| conserved hypothetical protein [Ruegeria pomeroyi DSS-3]
          Length = 558

 Score = 95.7 bits (236), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 33/246 (13%), Positives = 73/246 (29%), Gaps = 49/246 (19%)

Query: 11  FFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGN 70
           F     G MT++       +    G+ +++      +  L   +DR+++ AA        
Sbjct: 27  FAREEDGLMTVMALFLFLALVGAAGIGVDLMRYEQKRAALQYTMDRAVLAAA-------- 78

Query: 71  GNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSIS 130
                     D     +                              + V        +S
Sbjct: 79  --------DLDQQVSPETVVRSYLEKAGLLEYLS------------SVTVQEGLGYRKVS 118

Query: 131 AISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDS 190
           A +  ++P  F       +    + +P  S+ +   ++   +++ +VLDVS SM S    
Sbjct: 119 ATATAELPTHFM----KLSGYDSLTIPAASTAE---ESIGNVEISLVLDVSGSMNSN--- 168

Query: 191 SITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI--------EEFFLLEWGVSH 242
             +++     +    ++   L       V   +V ++ ++              E   SH
Sbjct: 169 --SRLYNLKNAAKEFVD-HMLSATEPGTVSISIVPYATQVNAGADILSYYNVSTEHNYSH 225

Query: 243 LQRKIK 248
               I 
Sbjct: 226 CVNFID 231



 Score = 66.0 bits (159), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 33/67 (49%), Gaps = 1/67 (1%)

Query: 305 DQQSLYYCNEAKKRGAIVYAIGIRVIR-SHEFLRACASPNSFYLVENPHSMYDAFSHIGK 363
           DQ++ + C+ AK  G IVY +G          L+ CAS +S Y   +   + DAF+ I  
Sbjct: 490 DQRTDHVCDAAKDEGIIVYTVGFEAPYSGRRVLKRCASSDSHYYDADGLEISDAFTSIAS 549

Query: 364 DIVTKRI 370
            I   R+
Sbjct: 550 SIRKLRL 556


>gi|311695164|gb|ADP98037.1| von Willebrand factor type A domain protein [marine bacterium HP15]
          Length = 342

 Score = 95.7 bits (236), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 30/221 (13%), Positives = 67/221 (30%), Gaps = 46/221 (20%)

Query: 171 RLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226
             D+M+V+D+S SM+         SI ++    + ++  +             + GL+ F
Sbjct: 88  GRDLMLVVDISPSMDEQDMVLQGRSINRLQAVKRVLDDFI-------SRRQGDRLGLILF 140

Query: 227 SNKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
             +      L + +  ++  ++   L   G +T     +  A                  
Sbjct: 141 GTEPYVQAPLTFDLETVRTLMREAGLGMAGRATAIGDAVGLATK-----------RLRNR 189

Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV--------------- 329
              ++++V +TDG N + +           A      +Y IGI                 
Sbjct: 190 PQDQRVVVLLTDGANTAGEITPD--KATEIAAAASIRLYTIGIGAESMVQRGLLGSRRVN 247

Query: 330 ---IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                    L   A  +   ++   +   +   +  I +  
Sbjct: 248 PSRDLDENLLTRMAQQTGGEYFRARSLPELELIYESIDRLE 288


>gi|289425049|ref|ZP_06426826.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes SK187]
 gi|289154027|gb|EFD02715.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes SK187]
 gi|313764512|gb|EFS35876.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL013PA1]
 gi|313772105|gb|EFS38071.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL074PA1]
 gi|313801850|gb|EFS43084.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL110PA2]
 gi|313807459|gb|EFS45946.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL087PA2]
 gi|313809969|gb|EFS47690.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL083PA1]
 gi|313812999|gb|EFS50713.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL025PA1]
 gi|313816053|gb|EFS53767.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL059PA1]
 gi|313818504|gb|EFS56218.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL046PA2]
 gi|313820270|gb|EFS57984.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL036PA1]
 gi|313822921|gb|EFS60635.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL036PA2]
 gi|313825147|gb|EFS62861.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL063PA1]
 gi|313827718|gb|EFS65432.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL063PA2]
 gi|313830298|gb|EFS68012.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL007PA1]
 gi|313833672|gb|EFS71386.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL056PA1]
 gi|314915506|gb|EFS79337.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL005PA4]
 gi|314920024|gb|EFS83855.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL050PA3]
 gi|314925157|gb|EFS88988.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL036PA3]
 gi|314932038|gb|EFS95869.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL067PA1]
 gi|314955908|gb|EFT00308.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL027PA1]
 gi|314958220|gb|EFT02323.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL002PA1]
 gi|314960059|gb|EFT04161.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL002PA2]
 gi|314962858|gb|EFT06958.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL082PA1]
 gi|314967774|gb|EFT11873.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL037PA1]
 gi|314973303|gb|EFT17399.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL053PA1]
 gi|314975981|gb|EFT20076.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL045PA1]
 gi|314978482|gb|EFT22576.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL072PA2]
 gi|314988184|gb|EFT32275.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL005PA2]
 gi|314989987|gb|EFT34078.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL005PA3]
 gi|315078073|gb|EFT50124.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL053PA2]
 gi|315084373|gb|EFT56349.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL027PA2]
 gi|315085714|gb|EFT57690.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL002PA3]
 gi|315088866|gb|EFT60842.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL072PA1]
 gi|315096218|gb|EFT68194.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL038PA1]
 gi|315098476|gb|EFT70452.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL059PA2]
 gi|315101164|gb|EFT73140.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL046PA1]
 gi|315105440|gb|EFT77416.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL030PA1]
 gi|315108385|gb|EFT80361.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL030PA2]
 gi|327326130|gb|EGE67920.1| von Willebrand factor, type A [Propionibacterium acnes HL096PA2]
 gi|327330198|gb|EGE71947.1| von Willebrand factor, type A [Propionibacterium acnes HL097PA1]
 gi|327331995|gb|EGE73732.1| von Willebrand factor, type A [Propionibacterium acnes HL096PA3]
 gi|327443197|gb|EGE89851.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL013PA2]
 gi|327445982|gb|EGE92636.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL043PA2]
 gi|327448038|gb|EGE94692.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL043PA1]
 gi|327450840|gb|EGE97494.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL087PA3]
 gi|327453083|gb|EGE99737.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL092PA1]
 gi|327453814|gb|EGF00469.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL083PA2]
 gi|328753528|gb|EGF67144.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL020PA1]
 gi|328754259|gb|EGF67875.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL087PA1]
 gi|328754490|gb|EGF68106.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL025PA2]
 gi|328760648|gb|EGF74215.1| von Willebrand factor, type A [Propionibacterium acnes HL099PA1]
          Length = 320

 Score = 95.7 bits (236), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 37/219 (16%), Positives = 73/219 (33%), Gaps = 30/219 (13%)

Query: 169 DARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
             R  +++ +DVSRSM +      +++  A  +          + D+       LV F+ 
Sbjct: 86  RDRATVVVAIDVSRSMVATD-VEPSRLSAAKTAAKDF------LGDLPPRFNVSLVKFAA 138

Query: 229 KIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
             +         + +   I  L     ST    G+  + N +  +    +H         
Sbjct: 139 SAQVVVPPTTDRAAVSTAITNLQVL-PSTAIGEGIYSSLNALKLVPDDPKH---PGQKPP 194

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV--------------IRSHE 334
             IV ++DG     +     L    EA ++   VY I                    +H 
Sbjct: 195 AAIVLLSDGATNVGRPS---LEAAKEAGRQHVPVYTIAYGTAGGYVVEGGQRQPVPVNHY 251

Query: 335 FLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKRIW 371
            L A A  S    +  E+   + D +  I + +  ++++
Sbjct: 252 ELAAIAKASGGEKFSAESLGQLSDVYKSIAQSVGYEKVF 290


>gi|329850248|ref|ZP_08265093.1| von Willebrand factor type A [Asticcacaulis biprosthecum C19]
 gi|328840563|gb|EGF90134.1| von Willebrand factor type A [Asticcacaulis biprosthecum C19]
          Length = 575

 Score = 95.3 bits (235), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 29/194 (14%), Positives = 70/194 (36%), Gaps = 13/194 (6%)

Query: 1   MFSLNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVH 60
           M  ++  +R F  + +G +T++ A  +  I   +G  ++ ++I   +  L   +D   + 
Sbjct: 1   MTKVSRYLRKFSADIRGNVTMIVAFSVIPIVAAVGGGLDFANIQAARAKLQDAVDAGAIA 60

Query: 61  AATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVV 120
           A            R+ +        IK          L+++       D + + S  +  
Sbjct: 61  ATIDPTATPTQTTREAVAKKAFCGNIKQ------SGGLQNSFCNTTTLDTLGTASATLST 114

Query: 121 VPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDV 180
              N   +++  +   +P     ++        + +   +   V++ T    ++  VLD 
Sbjct: 115 ATSNNIMTVTYSATAHVPT----YLLGLVGIDTVDIDAVAKSGVSTST---AEVAFVLDN 167

Query: 181 SRSMESFFDSSITK 194
           + SM S    +  K
Sbjct: 168 TGSMSSNNKMTYLK 181



 Score = 59.5 bits (142), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 42/301 (13%), Positives = 93/301 (30%), Gaps = 22/301 (7%)

Query: 80  GDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPL 139
                +  NT+                +   V S++L +        Y  +  + Y  P 
Sbjct: 285 ATSYYQSSNTYRSYGNTYYYTYIAWRQVVYRVNSSTLTLNSTNNGGDY-YTYQAYYNQPN 343

Query: 140 KFCTFI--PWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDM 197
            +  +     Y+         TS+  +   T    +  ++   + +            D+
Sbjct: 344 NYSRYYGAVTYSTPTAGGYNSTSTTIIKDNTTITANSDLLGVGTSNWTGCVIDRTQSYDV 403

Query: 198 AIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVST 257
              +          +      +       +N +     L   ++  +     ++  G +T
Sbjct: 404 TSDAP---------VAGTPATLYPAAKCATNTLLPVMALTQDIAAARTYAARMAPAG-NT 453

Query: 258 NSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGEN-------LSTKEDQQSLY 310
           N T G+++    +       +     D    K ++ +TDG N        +++ + +   
Sbjct: 454 NVTIGVQWGMEVLSPTAPFSEGGAFTDKAVLKYMIVLTDGINTQNRWTTNNSQINARLAL 513

Query: 311 YCNEAKKRGAIVYAIGIRVIRSHEFLRACASP-NSFYLVENPHSMYDAFSHIGKDIVTKR 369
            C  AK  G  V+ + +        L+ CAS    +Y + N   +    S I K I   R
Sbjct: 514 ACTNAKNLGITVFTVRVEQG-DSTTLQNCASQTAYYYNLSNADQLPATMSKIMKSIRKVR 572

Query: 370 I 370
           +
Sbjct: 573 L 573


>gi|314918209|gb|EFS82040.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL050PA1]
          Length = 320

 Score = 95.3 bits (235), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 38/219 (17%), Positives = 73/219 (33%), Gaps = 30/219 (13%)

Query: 169 DARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
             R  +++ +DVSRSM +      T++  A  +          + D+       LV F+ 
Sbjct: 86  RDRATVVVAIDVSRSMVATD-VEPTRLSAAKTAAKDF------LGDLPPRFNVSLVKFAA 138

Query: 229 KIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
             +         + +   I  L     ST    G+  + N +  +    +H         
Sbjct: 139 SAQVVVPPTTDRAAVSTAITNLQVL-PSTAIGEGIYSSLNALKLVPDDPKH---PGQKPP 194

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV--------------IRSHE 334
             IV ++DG     +     L    EA ++   VY I                    +H 
Sbjct: 195 AAIVLLSDGATNVGRPS---LEAAKEAGRQHVPVYTIAYGTAGGYVVEGGQRQPVPVNHY 251

Query: 335 FLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKRIW 371
            L A A  S    +  E+   + D +  I + +  ++++
Sbjct: 252 ELAAIAKASGGEKFSAESLGQLSDVYKSIAQSVGYEKVF 290


>gi|73542573|ref|YP_297093.1| von Willebrand factor, type A [Ralstonia eutropha JMP134]
 gi|72119986|gb|AAZ62249.1| von Willebrand factor, type A [Ralstonia eutropha JMP134]
          Length = 340

 Score = 95.3 bits (235), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 31/213 (14%), Positives = 77/213 (36%), Gaps = 36/213 (16%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDSSI-----TKIDMAIKSINAMLEEVKLIPDVNNVVQS 221
           +T    D+++ LD+S+SM++            ++    + +++ +             + 
Sbjct: 89  KTQPVRDLLLALDLSQSMDTRDFRDPSGALIPRVQAVREVVSSFVAR-------RPGDRI 141

Query: 222 GLVTFSNKIEEFFLLEWGVSHLQRKIKYL--SKFGVSTNSTPGLKYAYNQIFDMQGMRQH 279
           GL+ F +            + +Q  I+ L     G ST     +                
Sbjct: 142 GLIVFGDAPYPLAPFTLDHALVQTMIRDLLPGMAGPSTALGDAVGLGIKMFDQ------- 194

Query: 280 CNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSH------ 333
                   +K+++ +TDG + ++K   +     + AK+R   V+ IGI    +       
Sbjct: 195 ----SPAPEKVLIVLTDGNDTASKMPPE--RAADIAKQRHVTVHTIGIGDPSAEGEQRVD 248

Query: 334 -EFLRACA--SPNSFYLVENPHSMYDAFSHIGK 363
              L+  A  +   ++   + +S+   ++ + +
Sbjct: 249 LGVLQRMAAQTGGRYFFGADQNSLESIYATLDR 281


>gi|163747459|ref|ZP_02154811.1| hypothetical protein OIHEL45_00415 [Oceanibulbus indolifex HEL-45]
 gi|161379312|gb|EDQ03729.1| hypothetical protein OIHEL45_00415 [Oceanibulbus indolifex HEL-45]
          Length = 476

 Score = 95.3 bits (235), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 54/457 (11%), Positives = 126/457 (27%), Gaps = 95/457 (20%)

Query: 8   IRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAA----- 62
           +R F     G +T+   + + ++ L+ G+ +++      +  + ++ DR+++ AA     
Sbjct: 19  LRRFAREEDGLVTLFAILMILLMILLGGVGVDLMRHERERARVQAVADRAVLAAADLDQT 78

Query: 63  ---TQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIV 119
                +  +    +        +       +     +  RD   +           +   
Sbjct: 79  LSPEAVARDYFDKSGLADYISSVTVEEGLNYRRVTVDASRDLKTMFIDKFGQEKLHVPAK 138

Query: 120 VVPQNEGYSISAISRYKIPLK----------------FCTFIPWYTNSRHIVMPITS-SV 162
              + +   +       I                   F   +        I + +   + 
Sbjct: 139 ATAEEKVAKVEISMVLDISGSMRENDKMNNLHDASNVFIDTVIQTDTEDLISISVVPYTA 198

Query: 163 KVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLI-PDVNNVVQS 221
           +VN   D   ++ +    S S    F+ S   +    ++ +    +        N   + 
Sbjct: 199 QVNVGKDIMDELNVTQLHSYSHCVDFEDSDFNLTTISQTRSYEHMQHFEAGYYWNGNDRD 258

Query: 222 GLVTFSNKIEEFFLLEW---------GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFD 272
               + N        +            + L+ +I        +T    GLK+    +  
Sbjct: 259 RTGHYDNISNPGCPKQSYEEIETFSQNAAALKSRIANFQPR-ANTAIHLGLKWGVALLDP 317

Query: 273 MQ------------GMRQHCNTEDANYKKIIVFMTDGEN--------------------- 299
                            +     D +  K ++ MTDG N                     
Sbjct: 318 SFRAINEAIGGDAVFRGRPAEYNDIDTLKTVILMTDGVNVTTRRIAPEAYSNRDHYRHWS 377

Query: 300 -------------------------LSTKEDQQSLYYCNEAKKRGAIVYAIGIR-VIRSH 333
                                     + + D      C+ AK +G ++++IG        
Sbjct: 378 DYPFYWWLGRNVRSSEHYRWYRTKYTAGQADNLLDNICDAAKAKGIVIWSIGFEVTDHGA 437

Query: 334 EFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
             ++ CAS +S +       + DAF  I + I   R+
Sbjct: 438 AVMKNCASSDSHFFRVEGVEIVDAFEAIARQINQLRL 474


>gi|212276002|ref|NP_001130333.1| hypothetical protein LOC100191428 [Zea mays]
 gi|194688870|gb|ACF78519.1| unknown [Zea mays]
          Length = 704

 Score = 95.3 bits (235), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 41/214 (19%), Positives = 74/214 (34%), Gaps = 38/214 (17%)

Query: 169 DARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
              +D++ VLDVS SM         K+ +  +++  +      I  +    +  ++ FS+
Sbjct: 257 RVPIDIVTVLDVSGSMAGT------KMALLKQAMGFV------IQHLRPSDRLSVIAFSS 304

Query: 229 KIEEFF----LLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
                F    +   G     + I  L   G  TN    LK A   I          +   
Sbjct: 305 TARRLFPLQRMSHHGRQQALQAINSLGA-GGGTNIADALKKAVKVI---------ADRSY 354

Query: 285 ANYKKIIVFMTDGENLSTKEDQ--------QSLYYCNEAKKRG-AIVYAIGIRVIRSHEF 335
            N    I+ ++DG++               +SL       +     ++  G       + 
Sbjct: 355 KNSVCSIILLSDGQDTYNISSNFQGTSAGRRSLVPSANPNELHMVPLHTFGFGADHDSDT 414

Query: 336 LRAC--ASPNSFYLVENPHSMYDAFSH-IGKDIV 366
           L +   AS  +F  +E+   M DAF+  IG  + 
Sbjct: 415 LHSISEASGGTFSFIEDEGVMQDAFAQCIGGLLS 448


>gi|308375589|ref|ZP_07444436.2| membrane protein [Mycobacterium tuberculosis SUMu007]
 gi|308345800|gb|EFP34651.1| membrane protein [Mycobacterium tuberculosis SUMu007]
          Length = 327

 Score = 95.3 bits (235), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 32/216 (14%), Positives = 65/216 (30%), Gaps = 30/216 (13%)

Query: 174 MMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEF 233
           +M+V+DVS+SM +      +++  A ++     +E+    +       GL+ ++      
Sbjct: 91  VMLVIDVSQSMRATD-VEPSRMVAAQEAAKQFADELTPGIN------LGLIAYAGTATVL 143

Query: 234 FLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVF 293
                     +  +  L  F   T +   +  A   I  +          D      IV 
Sbjct: 144 VSPTTNREATKNALDKLQ-FADRTATGEAIFTALQAIATV---GAVIGGGDTPPPARIVL 199

Query: 294 MTDGENLSTKEDQQSL---YYCNEAKKRGAIVYAIGIRVIR--------------SHEFL 336
            +DG+                   AK +G  +  I                      E +
Sbjct: 200 FSDGKETMPTNPDNPKGAYTAARTAKDQGVPISTISFGTPYGFVEINDQRQPVPVDDETM 259

Query: 337 RACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           +  A  S  + Y       +   +S + + I  + I
Sbjct: 260 KKVAQLSGGNSYNAATLAELRAVYSSLQQQIGYETI 295


>gi|94498567|ref|ZP_01305122.1| hypothetical protein SKA58_08339 [Sphingomonas sp. SKA58]
 gi|94422010|gb|EAT07056.1| hypothetical protein SKA58_08339 [Sphingomonas sp. SKA58]
          Length = 678

 Score = 95.3 bits (235), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 24/238 (10%), Positives = 69/238 (28%), Gaps = 30/238 (12%)

Query: 7   NIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIM 66
            +     N KG +  + A  +  +  ++G  +++   +  +  +    D + +     + 
Sbjct: 11  FMSRLARNQKGNVMAMVAAAIIPLAALIGGGLDMGRAYMARARMQQACDAAALAGRRAMT 70

Query: 67  NEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEG 126
                   K                           F         +T   ++     E 
Sbjct: 71  TSSMTQANKDEAKKFF-------------------DFNFPQGTFQAATFTPVIRSKPGET 111

Query: 127 YSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMES 186
            ++   +   +P               + + +T   +         D+M+VLD + SM  
Sbjct: 112 TTVQVTASTTMPTTVM----KIFRYETLPLSVTCEARF---DIGNTDVMLVLDTTGSMAY 164

Query: 187 FFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGV 240
                   S T++    +++    + +    +    ++ G + +S+ +   + L    
Sbjct: 165 AISDGKGGSTTRLAALKQAVKDFYDTLGAGSNATGRIRYGFMPYSSTVNVGYQLPTNY 222



 Score = 49.9 bits (117), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 30/163 (18%), Positives = 52/163 (31%), Gaps = 33/163 (20%)

Query: 241 SHLQRKIKYLSKFGVS-TNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGE- 298
           S     I  L   G +  +        +     +     +      N  + IVFMTDG+ 
Sbjct: 514 SSFNSYIDNLIAVGGTYHDIGMLWGARFLSPKGIFASDNNSAPNGFNISRHIVFMTDGDM 573

Query: 299 ----------------------NLSTKE-----DQQSLYYCNEAKKRGAIVYAIGIRVIR 331
                                 N S  +     + +    CN  K +G  ++ IG R   
Sbjct: 574 SAYQQVYGAYGYQQLDARVAPGNTSDTDLTAIHNTRLQMLCNAIKAKGITIWVIGFRNQS 633

Query: 332 SHEF---LRACASPNSFYL-VENPHSMYDAFSHIGKDIVTKRI 370
                  L+ CA+ ++ +    +  S+   F  I K+I   R+
Sbjct: 634 EGNIQTPLQNCATSSNHWTMAYDATSLSQKFKDIAKNIGGLRV 676


>gi|260434111|ref|ZP_05788082.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260417939|gb|EEX11198.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 600

 Score = 95.3 bits (235), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 41/229 (17%), Positives = 81/229 (35%), Gaps = 32/229 (13%)

Query: 10  NFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEG 69
           +F  +  G MTILT   + I+F+  G  ++V      +  L   +DR+++ AA       
Sbjct: 24  SFATSESGAMTILTLFLIMIVFVASGFAVDVMRYDRERAKLQYALDRAVLAAA------- 76

Query: 70  NGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSI 129
                      D     K+      + E  D         +          V +     +
Sbjct: 77  ---------DLDQELCPKDVVIDYLKKEGLDKYL-TGDPKVEPDVCGSTAAVLKG-YRRV 125

Query: 130 SAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFD 189
            A +   I + F  +         I    TS  +   ++   +++ +VLDVS SM     
Sbjct: 126 EANADMDIEMHFMKW----RGIETIASAATSVAE---ESIGNVEISLVLDVSGSMRG--- 175

Query: 190 SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEW 238
              +K++   K+ N  ++++      +  V   +V +S ++     L  
Sbjct: 176 ---SKLENLKKAANLFIDDMF-AKTEDGKVSISIVPYSEQVSIPDYLMN 220



 Score = 58.7 bits (140), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 30/261 (11%), Positives = 70/261 (26%), Gaps = 12/261 (4%)

Query: 121 VPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDV 180
               +  +   ++  K+P  F            + + I  +   N++    ++       
Sbjct: 339 DDSFQPLTKKLVTESKVPSIFKDRPDQNKGYDTMKVMILMTDGENTKQHK-VNPPYNHGT 397

Query: 181 SRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV---TFSNKIEEFFLLE 237
           S    +      +  D    +   +   +       +     L        +        
Sbjct: 398 SDIWWNADKEKYSVYDREAGNFIWIDVPMAEKHSRRDWYWVRLYRQDHAYGQGTYMQYKC 457

Query: 238 WGVS----HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE-DANYKKIIV 292
              S    H     +   K    + +      A  +      +     T    +Y     
Sbjct: 458 NDYSYGVCHDINFSRSREKKDEGSGAVELSWPALWERTPKGKIYDIFKTAFGTSYANEWY 517

Query: 293 FMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRS-HEFLRACAS-PNSFYLVEN 350
             +       ++D +    C +AK    I+++I           L+ C S   ++Y  ++
Sbjct: 518 NTSTTVLNQVQKDPRLTSICQKAKDEKIIIFSIAFDAPDGVKPLLKGCVSDDGAYYEAKD 577

Query: 351 PH-SMYDAFSHIGKDIVTKRI 370
               +   FS IG  I   R+
Sbjct: 578 NDKDIISVFSSIGSTIQNLRL 598


>gi|88798929|ref|ZP_01114511.1| hypothetical protein MED297_12762 [Reinekea sp. MED297]
 gi|88778409|gb|EAR09602.1| hypothetical protein MED297_12762 [Reinekea sp. MED297]
          Length = 322

 Score = 95.3 bits (235), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 36/214 (16%), Positives = 65/214 (30%), Gaps = 35/214 (16%)

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
              + + +D+S SM         +     +++ A++ E             GLV F +  
Sbjct: 83  GRSLYLAVDLSESMLEQDMIWNQRPVSRYEAMQAVISEFVED---RRGDFIGLVVFGSFA 139

Query: 231 EEFFLLEWGVSHLQRKIKYLSKFGVS--TNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
           +    L   ++ +Q  +  L        T    GL  A  Q             E     
Sbjct: 140 DVQAPLTPDLNAIQSLLADLRPGMADSRTAIGDGLALAVRQ-----------LRESTTED 188

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR---------------SH 333
           +++V ++DGEN S +           A      VY IG                      
Sbjct: 189 RVVVLLSDGENNSGEIRPDEATAV--AAAENIRVYTIGFGSAGRDSLLQSFGLRSSSLDE 246

Query: 334 EFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
           + LR  A  +   +Y   +   + + F  I +  
Sbjct: 247 QTLREIAEQTQGRYYRATSSAELAEVFRDIERLE 280


>gi|241113476|ref|YP_002973311.1| von Willebrand factor type A [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240861684|gb|ACS59350.1| von Willebrand factor type A [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 329

 Score = 95.3 bits (235), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/207 (13%), Positives = 66/207 (31%), Gaps = 36/207 (17%)

Query: 173 DMMIVLDVSRSM-----ESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFS 227
           D+++ LD+S+SM            + +++   + +   + +           + GLV F 
Sbjct: 95  DILLALDLSQSMDARDFPGADGKPLARVEAVRQVVADFVGK-------RPGDRIGLVAFG 147

Query: 228 NKIEEFFLLEWGVSHLQRKIKYLSKFGVS--TNSTPGLKYAYNQIFDMQGMRQHCNTEDA 285
           +              ++  I           T+    L  A                   
Sbjct: 148 DAPYPLAPFTMDHELVRTMIADTVPGMAGPRTSLGDALGLAIKMFGKT-----------T 196

Query: 286 NYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR-------SHEFLRA 338
             +K+++ +TDG + +++     L     AK +G I + +GI               L+ 
Sbjct: 197 APEKVLIVLTDGNDTASRMP--PLKAAEIAKSKGVIFHTVGIGDPAATGEDKLDTATLQK 254

Query: 339 CA--SPNSFYLVENPHSMYDAFSHIGK 363
            A  +   ++   +   +   +  + +
Sbjct: 255 IAASTGGRYFFGGDQSQLAAIYEVLDQ 281


>gi|116753518|ref|YP_842636.1| von Willebrand factor, type A [Methanosaeta thermophila PT]
 gi|116664969|gb|ABK13996.1| von Willebrand factor, type A [Methanosaeta thermophila PT]
          Length = 795

 Score = 95.3 bits (235), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 36/201 (17%), Positives = 74/201 (36%), Gaps = 29/201 (14%)

Query: 171 RLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKI 230
            +D+++ +D S SM +     + K   A + +  +   +          + G+V+++   
Sbjct: 63  PVDVVLSIDSSGSMTTSDPGDLRK-SAAKEFVTGLDLSMD---------RVGVVSWNTSA 112

Query: 231 EEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKI 290
              + L      ++  I      G +T    GLK A + + +  G             K+
Sbjct: 113 -ISWPLTNNTKDIESAIDSTGADG-NTCLDTGLKSAIDLLSECSGS------------KV 158

Query: 291 IVFMTDGENLSTKEDQQSL---YYCNEAKKRGAIVYAIGIRVIRSHEFLRACA--SPNSF 345
           IV +TDG +                +EA+ +G +V+ IG+        L   A  +   F
Sbjct: 159 IVLLTDGISTDGGHYTPPGVPGSPVDEARSKGILVFTIGLGPDADARNLTEIAHSTGGEF 218

Query: 346 YLVENPHSMYDAFSHIGKDIV 366
           Y   + +++   +  I   I 
Sbjct: 219 YSAPDANALAGIYKRIRSSIT 239


>gi|163751139|ref|ZP_02158369.1| von Willebrand factor type A domain protein [Shewanella benthica
           KT99]
 gi|161329095|gb|EDQ00167.1| von Willebrand factor type A domain protein [Shewanella benthica
           KT99]
          Length = 334

 Score = 94.9 bits (234), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 32/218 (14%), Positives = 66/218 (30%), Gaps = 38/218 (17%)

Query: 170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229
              D+M+ +D+S SM+             +     + + V    +     + GL+ F++ 
Sbjct: 81  KGRDLMLAVDLSGSMQIEDMVLNG---QTVDRFTMIQDVVSDFIERRKGDKLGLILFADH 137

Query: 230 IEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287
                 L      + + ++   +   G  T     +     +   +              
Sbjct: 138 AYLQAPLTQDRRSVAQFLQEAQIGLVGKQTAIGEAIALGVKRFDMV-----------DKS 186

Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR---------------- 331
            +I+V +TDG N S     +       A KRG  +YAIG+                    
Sbjct: 187 NRILVLLTDGSNNSGSISPE--QAAAIAAKRGVKIYAIGVGADVMERRSIFGTERVNPSM 244

Query: 332 --SHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
                 L + A  +   ++   +   +   +  I K  
Sbjct: 245 DLDEAQLISLAKTTGGLYFRARSSQDLQLIYQEIDKLE 282


>gi|323135950|ref|ZP_08071033.1| hypothetical protein Met49242DRAFT_0420 [Methylocystis sp. ATCC
           49242]
 gi|322399041|gb|EFY01560.1| hypothetical protein Met49242DRAFT_0420 [Methylocystis sp. ATCC
           49242]
          Length = 432

 Score = 94.9 bits (234), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 49/432 (11%), Positives = 126/432 (29%), Gaps = 74/432 (17%)

Query: 9   RNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHA------- 61
           R+F  N +GG+ I   + L  + L+ G  ++ S I   K+ L+   D  ++ A       
Sbjct: 3   RSFLQNRRGGVAIFFGLALMPLALMAGGAVDFSQISRQKSALNQAADAGVLTALKEAREQ 62

Query: 62  ---ATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDI 118
                            K    +       +   +  N     G ++   +   +     
Sbjct: 63  LKQGKPDWQSIAEKQGGKAFTNNASKIGGVSGTGATINLSLSGGVLSGSLNYAANAPTHF 122

Query: 119 VVVPQNEGYSISAISRYKIP-LKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIV 177
           + +      ++   +   +   ++         S  + +  T + +   Q      +   
Sbjct: 123 LRIAGLNTINLKGSASATMSAAQYRDIHFVIDVSASMGIGATKADQQAMQNSVGCAVACH 182

Query: 178 L----DVSRSMESFFD--SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231
                D +    +      +  +ID+  K++   L ++      +   +  + +FSN ++
Sbjct: 183 HAEAADPATDNLAAVRAIGATLRIDVVRKAVMDALAKI----PNDGSTRVAIHSFSNSLK 238

Query: 232 EFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKII 291
             F L   ++      + +     +        Y+ NQ+ ++     +  T       ++
Sbjct: 239 TVFPLSTNIAGAISATQSIDLTNENGQGGTNFHYSLNQLNNLLASAGNGLTASQPRGFVL 298

Query: 292 VFMTDGENLS------TKEDQQSLYY---------------------------CNEAKKR 318
           +     E+ S            +  +                           C+  K +
Sbjct: 299 LATDAVEDSSLFFYADGVAPPFARQWVEPNFVVGNPSYFAWGLHYVQAPDAANCSAIKAK 358

Query: 319 GAIVYAI--------GI-----------RVIRSHEFLRACAS-PNSFYLVENPHSMYDAF 358
           G  +  +        G+                 + +  CAS P+ ++  E+P  +  A 
Sbjct: 359 GYTMMTLETEYLIPDGVYNPTFDAVRGDMGPAMTKSMTDCASAPDYYFHAESPQEIDRAV 418

Query: 359 SHIGKDIVTKRI 370
             +    V   +
Sbjct: 419 QTMVSKTVNLSL 430


>gi|330945007|gb|EGH46785.1| von Willebrand factor, type A [Pseudomonas syringae pv. pisi str.
           1704B]
          Length = 258

 Score = 94.9 bits (234), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 29/213 (13%), Positives = 64/213 (30%), Gaps = 45/213 (21%)

Query: 178 LDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEF 233
           +DVS SM+          ++++ +  + +   LE            + GL+ F  +    
Sbjct: 2   VDVSGSMDYPDMQWKSDEVSRLVLVQQLLGDFLEG-------RKGDRVGLILFGTQAFVQ 54

Query: 234 FLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKII 291
             L +    ++  +    +   G +T     +  A                      + +
Sbjct: 55  APLTYDRRTVRVWLDEARIGIAGKNTALGDAIGLALK-----------RLRMRPATSRAL 103

Query: 292 VFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHE----------------- 334
           V +TDG N + + D   +     A + G  +Y IGI      +                 
Sbjct: 104 VLVTDGANNAGQID--PITAARLAAEEGVKIYPIGIGSDPDKDALQSVLGLNPSLDLDEP 161

Query: 335 FLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
            L+  A  S   ++   +   +    + +    
Sbjct: 162 TLKEIASLSGGQYFRARDGDQLEKIRATLDALE 194


>gi|311106403|ref|YP_003979256.1| von Willebrand factor type A domain-containing protein 2
           [Achromobacter xylosoxidans A8]
 gi|310761092|gb|ADP16541.1| von Willebrand factor type A domain protein 2 [Achromobacter
           xylosoxidans A8]
          Length = 340

 Score = 94.9 bits (234), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 31/207 (14%), Positives = 70/207 (33%), Gaps = 36/207 (17%)

Query: 173 DMMIVLDVSRSMESFFDSSIT-----KIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFS 227
           D+++ +D+S+SME+    +       ++      +   +       D     + GL+ F 
Sbjct: 93  DLLLAIDISQSMETEDFVAPDGRREDRLSGVKAVVADFI-------DRRQDDRLGLIVFG 145

Query: 228 NKIEEFFLLEWGVSHLQRKIKYL--SKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDA 285
                   L    + L+  +  +     G +T     +  A  Q        Q       
Sbjct: 146 TAAYPQAPLTQDHATLKLLLGQVSTRMAGPNTAIGDAIGVAIKQFEHAGEHDQV------ 199

Query: 286 NYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI-------RSHEFLRA 338
                ++ +TDG +  +          + A  R  +V+ +GI             + LRA
Sbjct: 200 -----LILLTDGNDTGSAVPPD--RAASMAAARHIVVHTVGIGDPQAEGEEKVDFDALRA 252

Query: 339 CA--SPNSFYLVENPHSMYDAFSHIGK 363
            A  +   F+  ++  S+   ++ + +
Sbjct: 253 IAAKTGGRFFPAQDQASLRQVYAELDR 279


>gi|328907235|gb|EGG27001.1| von Willebrand factor type A domain protein [Propionibacterium sp.
           P08]
          Length = 318

 Score = 94.9 bits (234), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 39/250 (15%), Positives = 81/250 (32%), Gaps = 30/250 (12%)

Query: 138 PLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDM 197
             +  T      +   +V+        ++    R  +++ +DVSRSM +      +++  
Sbjct: 53  WRQHVTMGLSVLSMATMVLAFAQPKAYHNVPRDRATVVVAIDVSRSMVATDVD-PSRLSA 111

Query: 198 AIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVST 257
           A  +          + D+       LV F+   +         + +   I  L     ST
Sbjct: 112 AKTAAKDF------LGDLPPRFNVSLVKFAASSQVVVPPTTDRAVVSTAIANLQVL-PST 164

Query: 258 NSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKK 317
               G+  + N +  +    +H           IV ++DG     +     L    EA +
Sbjct: 165 AIGEGIYSSLNALKLVPDDPKH---PGQKPPAAIVLLSDGATNVGRPS---LEAAKEAGR 218

Query: 318 RGAIVYAIGIRV--------------IRSHEFLRACA--SPNSFYLVENPHSMYDAFSHI 361
           +   VY I                    +H  L A A  S    +  E+   + D +  I
Sbjct: 219 QHVPVYTIAYGTAGGYVVEGGQRQPVPVNHYELAAVAKASGGEKFSAESLGQLSDVYKSI 278

Query: 362 GKDIVTKRIW 371
            + +  ++++
Sbjct: 279 AQSVGYEKVF 288


>gi|54309668|ref|YP_130688.1| hypothetical protein PBPRA2504 [Photobacterium profundum SS9]
 gi|46914106|emb|CAG20886.1| hypothetical protein PBPRA2504 [Photobacterium profundum SS9]
          Length = 494

 Score = 94.9 bits (234), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 40/266 (15%), Positives = 88/266 (33%), Gaps = 18/266 (6%)

Query: 13  YNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGN 72
              +G   I TA+ L  +F ++   +E +     K  L    + + +   T   N+ +  
Sbjct: 5   RQQRGAAGIYTALALIPLFGMIFWALEGTRYIQKKNRLADATEAATLAVTTA--NQDDKT 62

Query: 73  NRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSISAI 132
              +L    +   I+N   ++     R  G            + D     +   Y ++A 
Sbjct: 63  YENQLATNYVQTYIRNIAIINDIKVERSEGIDYYP-------TPDGNEEREYFQYRVTAK 115

Query: 133 SRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSI 192
           + +   L     IP ++ +  +     +        D  +D++ V D S SM+       
Sbjct: 116 TDHTSWLS-SDIIPSFSPTETVANRALARNYPIYLGDKDIDIVFVSDFSGSMKGN----- 169

Query: 193 TKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIK-YLS 251
            KI     +I A+  E+ +  D   V  +  + F                   ++    +
Sbjct: 170 -KIRALKDAIQAIANEILVPRD-GEVEVTNRIAFVPYNMRVQEKRSNTRWCLTQLDYRPN 227

Query: 252 KFGVSTNSTPGLKYAYNQIFDMQGMR 277
             G + +S   + ++    +    +R
Sbjct: 228 FNGGNYSSYEDIDWSTWSTWTRNQVR 253


>gi|88707026|ref|ZP_01104723.1| von Willebrand factor type A domain protein [Congregibacter
           litoralis KT71]
 gi|88698754|gb|EAQ95876.1| von Willebrand factor type A domain protein [Congregibacter
           litoralis KT71]
          Length = 330

 Score = 94.9 bits (234), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 29/213 (13%), Positives = 65/213 (30%), Gaps = 36/213 (16%)

Query: 173 DMMIVLDVSRSMESFFD-----SSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFS 227
           D+M+ LD+S SM++            ++  A   +     +           + GL+ F 
Sbjct: 95  DLMLALDLSGSMDARDFRDAEGHEQNRLTAAKDVLEGFAAQ-------REGDRLGLIVFG 147

Query: 228 NKIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDA 285
           N               Q  ++   ++  G ST     +  A +                 
Sbjct: 148 NAAYLQAPFTDDRETWQTLLEESEVAMAGQSTALGDAIGLAISIFQ-----------ASD 196

Query: 286 NYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR-------SHEFLRA 338
              ++++ +TDG +  ++           A      +Y + +             E L A
Sbjct: 197 TTNRVLIVLTDGNDTGSRVP--PRDAATIAAANDVTIYTVAVGDPATIGEEALDLETLNA 254

Query: 339 CA--SPNSFYLVENPHSMYDAFSHIGKDIVTKR 369
            A  +  + +   +  ++  A+  I +    K 
Sbjct: 255 VAETTGGASFQALDTQALEKAYDEINRLEPAKY 287


>gi|332285111|ref|YP_004417022.1| hypothetical protein PT7_1858 [Pusillimonas sp. T7-7]
 gi|330429064|gb|AEC20398.1| hypothetical protein PT7_1858 [Pusillimonas sp. T7-7]
          Length = 342

 Score = 94.9 bits (234), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 34/209 (16%), Positives = 70/209 (33%), Gaps = 26/209 (12%)

Query: 166 SQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVT 225
           + T+   D+++ LD+S+SM+S          ++      +   V    D     + GL+ 
Sbjct: 86  THTEPVRDILLALDISQSMDSQDFRDAQDRQVSR--WTVVKAVVADFIDKRTDDRLGLIV 143

Query: 226 FSNKIEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283
           F         L      L+  +    +   G +T     +                    
Sbjct: 144 FGTGAFPQAPLTRDHKSLRLLLDHTAVGMAGPNTAIGDAIGMGIRM-----------LDS 192

Query: 284 DANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI-------RSHEFL 336
                K+++ +TDG +         L   N A +    V+ IGI             + L
Sbjct: 193 AQERDKVLILLTDGNDTG--SAVPPLRAANLAAQHHVTVHTIGIGSPTASGDDQVDFDTL 250

Query: 337 RAC--ASPNSFYLVENPHSMYDAFSHIGK 363
           R    AS   F+  ++  +++D ++ + +
Sbjct: 251 RGISSASGGQFFQAQDGAALHDVYATLDR 279


>gi|21539497|gb|AAM53301.1| putative protein [Arabidopsis thaliana]
 gi|23198328|gb|AAN15691.1| putative protein [Arabidopsis thaliana]
          Length = 704

 Score = 94.9 bits (234), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 42/212 (19%), Positives = 76/212 (35%), Gaps = 36/212 (16%)

Query: 169 DARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
            A +D++ VLDVS SM         K+ +  +++  +      I ++    +  +++FS+
Sbjct: 248 RAPVDLVTVLDVSGSMAGT------KLALLKRAMGFV------IQNLGPFDRLSVISFSS 295

Query: 229 KIEEFF----LLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
                F    + E G     + +  L   G  TN   GLK     + D +          
Sbjct: 296 TARRNFPLRLMTETGKQEALQAVNSLVSNG-GTNIAEGLKKGARVLIDRRF--------- 345

Query: 285 ANYKKIIVFMTDGENLS------TKEDQQSLYYC-NEAKKRGAIVYAIGIRVIRSHEFLR 337
            N    IV ++DG++                     E       V+A G         + 
Sbjct: 346 KNPVSSIVLLSDGQDTYTMTSPNGSRGTDYKALLPKEINGNRIPVHAFGFGADHDASLMH 405

Query: 338 ACA--SPNSFYLVENPHSMYDAFSH-IGKDIV 366
           + A  S  +F  +E+   + DAF+  IG  + 
Sbjct: 406 SIAENSGGTFSFIESETVIQDAFAQCIGGLLS 437


>gi|15239414|ref|NP_200879.1| zinc finger (C3HC4-type RING finger) family protein [Arabidopsis
           thaliana]
 gi|9759335|dbj|BAB09844.1| retroelement pol polyprotein-like [Arabidopsis thaliana]
 gi|332009986|gb|AED97369.1| C3H4 type zinc finger protein [Arabidopsis thaliana]
          Length = 704

 Score = 94.9 bits (234), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 42/212 (19%), Positives = 76/212 (35%), Gaps = 36/212 (16%)

Query: 169 DARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
            A +D++ VLDVS SM         K+ +  +++  +      I ++    +  +++FS+
Sbjct: 248 RAPVDLVTVLDVSGSMAGT------KLALLKRAMGFV------IQNLGPFDRLSVISFSS 295

Query: 229 KIEEFF----LLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284
                F    + E G     + +  L   G  TN   GLK     + D +          
Sbjct: 296 TARRNFPLRLMTETGKQEALQAVNSLVSNG-GTNIAEGLKKGARVLIDRRF--------- 345

Query: 285 ANYKKIIVFMTDGENLS------TKEDQQSLYYC-NEAKKRGAIVYAIGIRVIRSHEFLR 337
            N    IV ++DG++                     E       V+A G         + 
Sbjct: 346 KNPVSSIVLLSDGQDTYTMTSPNGSRGTDYKALLPKEINGNRIPVHAFGFGADHDASLMH 405

Query: 338 ACA--SPNSFYLVENPHSMYDAFSH-IGKDIV 366
           + A  S  +F  +E+   + DAF+  IG  + 
Sbjct: 406 SIAENSGGTFSFIESETVIQDAFAQCIGGLLS 437


>gi|226504618|ref|NP_001148048.1| protein binding protein [Zea mays]
 gi|195615516|gb|ACG29588.1| protein binding protein [Zea mays]
          Length = 696

 Score = 94.9 bits (234), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 51/300 (17%), Positives = 103/300 (34%), Gaps = 39/300 (13%)

Query: 84  CRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCT 143
            R       S  ++  D+  ++ ++     +S  + +   +E  +I   S+    +    
Sbjct: 169 QREGPVLVTSEPSDFNDDEPLHKMEPANIGSSRTVEIKTYSEFSAIQQSSQDDFAVLIHL 228

Query: 144 FIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSIN 203
             P+    + I  P+ ++        A +D++ VLDVS SM         K+ +  +++ 
Sbjct: 229 KAPYANPEQVIGRPVNATSVGYPTARAPVDLVTVLDVSGSMAGT------KLALLKRAMG 282

Query: 204 AMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFL----LEWGVSHLQRKIKYLSKFGVSTNS 259
            +      I  +    +  ++ FS+     F        G     + +  L   G  TN 
Sbjct: 283 FV------IQHLGPSDRLSVIAFSSTARRLFHLQRMSHSGRQQALQTVNSLVASG-GTNI 335

Query: 260 TPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKE---------DQQSLY 310
              LK A   I          +    N    I+ ++DG++                  + 
Sbjct: 336 ADALKKAAKVIE---------DRSHQNPVCSIILLSDGQDTYNIPSNIRGARPEYSSLVP 386

Query: 311 YCNEAKKRG-AIVYAIGIRVIRSHEFLRAC--ASPNSFYLVENPHSMYDAFSH-IGKDIV 366
                +  G   V+  G  V    + L +   AS  +F  +E+   + DAF+  IG  + 
Sbjct: 387 SSILNRTFGLVPVHGFGFGVDHDSDALHSIAEASGGTFSFIEDEGVIQDAFAQCIGGLLS 446


>gi|284990593|ref|YP_003409147.1| von Willebrand factor type A [Geodermatophilus obscurus DSM 43160]
 gi|284063838|gb|ADB74776.1| von Willebrand factor type A [Geodermatophilus obscurus DSM 43160]
          Length = 318

 Score = 94.5 bits (233), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 30/213 (14%), Positives = 63/213 (29%), Gaps = 29/213 (13%)

Query: 169 DARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
             R  +++ +DVS SM++      ++ +    +    ++       + + +  GLV+F+ 
Sbjct: 83  RERATVVMAVDVSLSMQATDI-EPSRFEAMQVAAKEFVD------VLPDRINLGLVSFAG 135

Query: 229 KIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
                         +   I  L     ST     +  +                 +    
Sbjct: 136 TATTVVTPTTDRGQVSTAIDNLE-LAESTAIGEAVFTSL--TAIENFQSSLDADGEEVPP 192

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR--------------SHE 334
             IV ++DG N   + D Q++    +A   G  V  I                       
Sbjct: 193 ARIVLLSDGYNTVGRPDTQAVSAALDA---GIPVSTIAFGTDYGTLDLDGERVPVPVDRA 249

Query: 335 FLRACA--SPNSFYLVENPHSMYDAFSHIGKDI 365
            L   A  +  S+    +   +   +  +G  I
Sbjct: 250 TLEEIADQTGGSYSEAASAAELEQVYQDLGSQI 282


>gi|218781310|ref|YP_002432628.1| hypothetical protein Dalk_3472 [Desulfatibacillum alkenivorans
           AK-01]
 gi|218762694|gb|ACL05160.1| conserved hypothetical protein [Desulfatibacillum alkenivorans
           AK-01]
          Length = 308

 Score = 94.5 bits (233), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 36/218 (16%), Positives = 67/218 (30%), Gaps = 29/218 (13%)

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFD----SSITKIDMAIKSINAMLEEVKLIPDV 215
           +           +D+++ LD S SM           + ++    K ++  ++        
Sbjct: 74  TVDASREIKTPGVDIILCLDASESMAQPDFAIDGQRVNRLTAVKKVVHDFVKR------- 126

Query: 216 NNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVS--TNSTPGLKYAYNQIFDM 273
            +  + GLV F +       L      L   I+ L        T     L  A  +I   
Sbjct: 127 RDTDRIGLVVFGDYAFTQAPLTLDKGLLLNLIENLRIGMAGRKTAIGDALGVAGKRI--- 183

Query: 274 QGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI-RS 332
                    +     K+++ ++DGEN +   D             G  +Y IG+      
Sbjct: 184 --------KDIPAMSKVVILLSDGENTAG--DMTPQGAAEALAALGIKIYTIGMGTEQAG 233

Query: 333 HEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
            + L   A      +Y   N   +   +  I K   T+
Sbjct: 234 SKELAQIAAIGQGKYYHASNTEQLDSIYKEIDKAEKTE 271


>gi|293361343|ref|XP_236593.5| PREDICTED: collagen type VI alpha 6 [Rattus norvegicus]
          Length = 2264

 Score = 94.5 bits (233), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 37/272 (13%), Positives = 91/272 (33%), Gaps = 28/272 (10%)

Query: 109 DIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPI----TSSVKV 164
           +      L+ +     E ++    +  ++     TF+    N     + +    T ++K 
Sbjct: 367 EGANPEQLEKIASYPAEQFTSKLSNFSELATHNQTFLKKLRNQITHTVSVFSERTETLKS 426

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
                   D+ +++D S + +              +    + E V +     + V+ G V
Sbjct: 427 ACVDTEEADIYLLIDGSGNTQPTDFH---------EMKIFLSEVVDMFNIAPHKVRVGAV 477

Query: 225 TFSNKIEEFFLL--EWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +++  +  F +        L + I  + + G +TN+   L +    +      R     
Sbjct: 478 QYADTWDLEFEISKYTNKPDLGKAIDNIRQMGGNTNTGAALNFTLTLL-----QRAKKQR 532

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
            +     ++V        +       L   ++ ++    V+AIG+    +   LR  A  
Sbjct: 533 GNKVPCHLVVL------TNGMSQDSVLGPAHKLREENIRVHAIGV-KEANQTQLREIAGD 585

Query: 343 N-SFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
               Y V    ++ D  + + ++I  +    D
Sbjct: 586 EKRVYYVHEFDALRDIRNQVVQEICAEEACRD 617



 Score = 81.1 bits (198), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 33/309 (10%), Positives = 87/309 (28%), Gaps = 21/309 (6%)

Query: 61   AATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVV 120
             A  +    +     +                   +   +           +   +  V 
Sbjct: 887  TAEALAFSDHMFTEARGSRLHKGVPQVLIVITDGESHDAEKLNATAKALRDKGILVLAVG 946

Query: 121  VPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDV 180
            +     + + A++       F             V     +         ++D++ ++D 
Sbjct: 947  IAGANTWELLAMAGSSDKYYFVETFGGLKGIFSDVSASVCNSSKVDCEIEKVDLVFLMDG 1006

Query: 181  SRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFF--LLEW 238
            S S+               K    +   V+      N V+ G+  FS+     F      
Sbjct: 1007 SNSIHPDDF---------QKMKEFLASVVQDFDVSLNRVRIGVAQFSDSYRSEFLLGTFT 1057

Query: 239  GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGE 298
            G   +  +I+ + +    T+          +           +  +A   ++++ +TD  
Sbjct: 1058 GEKEISTQIEAIQQIFGYTHIGDA-----LRKVKHYFRPDTGSRINAGTPQVLLVLTD-- 1110

Query: 299  NLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAF 358
                +   +      E + +G  +Y++GI  +   + ++   +      V N   +    
Sbjct: 1111 ---GRSQDEVAQAAEELRHKGVDIYSVGIGDVDDQQLIQITGTAEKKLTVHNFDELKKVK 1167

Query: 359  SHIGKDIVT 367
              I ++I T
Sbjct: 1168 KRIVRNICT 1176



 Score = 81.1 bits (198), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 42/336 (12%), Positives = 106/336 (31%), Gaps = 30/336 (8%)

Query: 42  HIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDN 101
           + F  +  + + ID+      T +         +              + +   +    +
Sbjct: 676 NTFMSQNDIANAIDQMAHIGETTLTGSALTFVSQYFSPEKGARPNVRKFLILITDGEAQD 735

Query: 102 GFVNDIDDIVRSTSLDIVVVPQNEGYS----ISAISRYKIPLKFCTFIPWYTNSRHIVMP 157
              +    + +   +   V       +    IS        ++    +    +   + + 
Sbjct: 736 IVKDPAVALRKDGVIIYSVGVFGSNVTQLEEISGKPEMVFYVENFDILQHIEDDLVLGIC 795

Query: 158 ITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSI--TKIDMAIKSINAMLEEVKLIPDV 215
                    +    LD++ V+D S S++    + +    I +  K+              
Sbjct: 796 SPREECKRIEV---LDVVFVIDSSGSIDYQEYNIMKDFMIGLVKKA-----------DVG 841

Query: 216 NNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM 273
            N V+ G + +++  E  F L+       +   ++     G +T +   L +      D 
Sbjct: 842 KNQVRFGALKYADDPEVLFYLDELGTKLEVISVLQNDQPMGGNTYTAEALAF-----SDH 896

Query: 274 QGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSH 333
                  +       ++++ +TDGE+    + ++        + +G +V A+GI    + 
Sbjct: 897 MFTEARGSRLHKGVPQVLIVITDGESH---DAEKLNATAKALRDKGILVLAVGIAGANTW 953

Query: 334 EFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKR 369
           E L    S + +Y VE    +   FS +   +    
Sbjct: 954 ELLAMAGSSDKYYFVETFGGLKGIFSDVSASVCNSS 989



 Score = 66.0 bits (159), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 36/205 (17%), Positives = 70/205 (34%), Gaps = 27/205 (13%)

Query: 169 DARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
           D + D+M ++D S S+          ++   K    M   V       + VQ G+V FS+
Sbjct: 617 DMKADIMFLVDSSGSIG---------LENFSKMKVFMKNLVSKSQIGADRVQIGVVQFSH 667

Query: 229 KIEEFFL--LEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
           +  E F        + +   I  ++  G +T +          +  +            N
Sbjct: 668 ENREEFQLNTFMSQNDIANAIDQMAHIGETTLTGSA-------LTFVSQYFSPEKGARPN 720

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIG-IRVIRSHEFLRACAS-PNS 344
            +K ++ +TD      +            +K G I+Y++G      +   L   +  P  
Sbjct: 721 VRKFLILITD-----GEAQDIVKDPAVALRKDGVIIYSVGVFGSNVTQ--LEEISGKPEM 773

Query: 345 FYLVENPHSMYDAFSHIGKDIVTKR 369
            + VEN   +      +   I + R
Sbjct: 774 VFYVENFDILQHIEDDLVLGICSPR 798



 Score = 56.4 bits (134), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 40/297 (13%), Positives = 84/297 (28%), Gaps = 47/297 (15%)

Query: 95  RNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHI 154
             E  D+              +  V V +     + A++  +      T       + ++
Sbjct: 139 SAESEDDVEEASKALREDGVKIISVGVQKASEEDLKAMATSQFHFNLRTARDLSMFAPNM 198

Query: 155 VMPITSSVKVNSQTDARL-----------DMMIVLDVSRSMESFFDSSITKIDMAIKSIN 203
              I    +        +           D++ +LD         + S   +D       
Sbjct: 199 TQIIKDVTQYREAMTDDIIVEACQGPSVADVVFLLD------MAINGSQENLDHLK---A 249

Query: 204 AMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFL--LEWGVSHLQRKIKYLSKFGVSTNSTP 261
            + E V  +    N ++ GLV +SN+        +    + + ++I+ LS       +  
Sbjct: 250 FLGESVSALDIKENCMRVGLVAYSNETRVISSLSMGVNKTEVLQRIQDLSPHVGQAYTGA 309

Query: 262 GLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAI 321
               A  +        Q  + ++    +I V +T         D          ++ G  
Sbjct: 310 ----ALRKTRKEVFSAQRGSRKNQGVPQIAVLVTH-----RASDDNVTKAAVNLRREGVT 360

Query: 322 VYAIGIRVIRSHEFLRACASPNSFYLVE-------NPHSM----YDAFSHIGKDIVT 367
           V+ +G+    + E L   AS    Y  E       N   +          +   I  
Sbjct: 361 VFTMGV-EGANPEQLEKIAS----YPAEQFTSKLSNFSELATHNQTFLKKLRNQITH 412



 Score = 49.9 bits (117), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 26/201 (12%), Positives = 64/201 (31%), Gaps = 25/201 (12%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D++ ++D S          +    +       + + V  +P   N  +  L  +S+ +  
Sbjct: 26  DVVFLVDSS------DHLGMKSFPLVKT---FIQKLVSSLPVEANKYRVALAQYSDALHN 76

Query: 233 FFL--LEWGVSHLQRKIK-YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
            F        + +   +K      G S      L+ A+   F           +   +  
Sbjct: 77  EFHLGAFKNRNPMLNHLKKNFGFIGGSLKIGNALQEAHRTYF----SAPTNGRDKKQFPP 132

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVE 349
           I+V +   E      +          ++ G  + ++G++     + L+A A+    + + 
Sbjct: 133 ILVVLASAE-----SEDDVEEASKALREDGVKIISVGVQKASEED-LKAMATSQFHFNLR 186

Query: 350 NPHSMYDA---FSHIGKDIVT 367
               +       + I KD+  
Sbjct: 187 TARDLSMFAPNMTQIIKDVTQ 207



 Score = 41.0 bits (94), Expect = 0.32,   Method: Composition-based stats.
 Identities = 27/230 (11%), Positives = 66/230 (28%), Gaps = 15/230 (6%)

Query: 120  VVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLD 179
             +     + +  +      +     +   T    +  P  S  +      + LD   +LD
Sbjct: 1910 SIDDTGTFQVLVVPSRPDQVPALERLQRCTFCYDLCKPDASCDQAKPPIQSYLDAAFLLD 1969

Query: 180  VSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWG 239
             S      +     + +     + A+L+  ++  +    V    V   +     FL    
Sbjct: 1970 SS------WHVGGAEFEDMRDLLEALLDHFEIASEPETSVTGDRVALLSHAPVDFLPNTQ 2023

Query: 240  VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN--------YKKII 291
             S ++ +   L+ +         ++ A  Q+     +         N         +  +
Sbjct: 2024 RSPVRTEFN-LTTYSSKHLMKRHVEQAVQQLNGDAFLGHALRWALDNVFLNTPNLRRNKV 2082

Query: 292  VFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACAS 341
            +F+      S  + +        AK  G  ++   +      + L   AS
Sbjct: 2083 IFVISAGETSHLDAETLKKESLRAKCHGYALFVFSLGPDWDDKELEDLAS 2132


>gi|293349448|ref|XP_002727144.1| PREDICTED: collagen type VI alpha 6-like [Rattus norvegicus]
          Length = 2264

 Score = 94.5 bits (233), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 37/272 (13%), Positives = 91/272 (33%), Gaps = 28/272 (10%)

Query: 109 DIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPI----TSSVKV 164
           +      L+ +     E ++    +  ++     TF+    N     + +    T ++K 
Sbjct: 367 EGANPEQLEKIASYPAEQFTSKLSNFSELATHNQTFLKKLRNQITHTVSVFSERTETLKS 426

Query: 165 NSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLV 224
                   D+ +++D S + +              +    + E V +     + V+ G V
Sbjct: 427 ACVDTEEADIYLLIDGSGNTQPTDFH---------EMKIFLSEVVDMFNIAPHKVRVGAV 477

Query: 225 TFSNKIEEFFLL--EWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
            +++  +  F +        L + I  + + G +TN+   L +    +      R     
Sbjct: 478 QYADTWDLEFEISKYTNKPDLGKAIDNIRQMGGNTNTGAALNFTLTLL-----QRAKKQR 532

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASP 342
            +     ++V        +       L   ++ ++    V+AIG+    +   LR  A  
Sbjct: 533 GNKVPCHLVVL------TNGMSQDSVLGPAHKLREENIRVHAIGV-KEANQTQLREIAGD 585

Query: 343 N-SFYLVENPHSMYDAFSHIGKDIVTKRIWYD 373
               Y V    ++ D  + + ++I  +    D
Sbjct: 586 EKRVYYVHEFDALRDIRNQVVQEICAEEACRD 617



 Score = 81.1 bits (198), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 33/309 (10%), Positives = 87/309 (28%), Gaps = 21/309 (6%)

Query: 61   AATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVV 120
             A  +    +     +                   +   +           +   +  V 
Sbjct: 887  TAEALAFSDHMFTEARGSRLHKGVPQVLIVITDGESHDAEKLNATAKALRDKGILVLAVG 946

Query: 121  VPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDV 180
            +     + + A++       F             V     +         ++D++ ++D 
Sbjct: 947  IAGANTWELLAMAGSSDKYYFVETFGGLKGIFSDVSASVCNSSKVDCEIEKVDLVFLMDG 1006

Query: 181  SRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFF--LLEW 238
            S S+               K    +   V+      N V+ G+  FS+     F      
Sbjct: 1007 SNSIHPDDF---------QKMKEFLASVVQDFDVSLNRVRIGVAQFSDSYRSEFLLGTFT 1057

Query: 239  GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGE 298
            G   +  +I+ + +    T+          +           +  +A   ++++ +TD  
Sbjct: 1058 GEKEISTQIEAIQQIFGYTHIGDA-----LRKVKHYFRPDTGSRINAGTPQVLLVLTD-- 1110

Query: 299  NLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAF 358
                +   +      E + +G  +Y++GI  +   + ++   +      V N   +    
Sbjct: 1111 ---GRSQDEVAQAAEELRHKGVDIYSVGIGDVDDQQLIQITGTAEKKLTVHNFDELKKVK 1167

Query: 359  SHIGKDIVT 367
              I ++I T
Sbjct: 1168 KRIVRNICT 1176



 Score = 81.1 bits (198), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 42/336 (12%), Positives = 106/336 (31%), Gaps = 30/336 (8%)

Query: 42  HIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDN 101
           + F  +  + + ID+      T +         +              + +   +    +
Sbjct: 676 NTFMSQNDIANAIDQMAHIGETTLTGSALTFVSQYFSPEKGARPNVRKFLILITDGEAQD 735

Query: 102 GFVNDIDDIVRSTSLDIVVVPQNEGYS----ISAISRYKIPLKFCTFIPWYTNSRHIVMP 157
              +    + +   +   V       +    IS        ++    +    +   + + 
Sbjct: 736 IVKDPAVALRKDGVIIYSVGVFGSNVTQLEEISGKPEMVFYVENFDILQHIEDDLVLGIC 795

Query: 158 ITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSI--TKIDMAIKSINAMLEEVKLIPDV 215
                    +    LD++ V+D S S++    + +    I +  K+              
Sbjct: 796 SPREECKRIEV---LDVVFVIDSSGSIDYQEYNIMKDFMIGLVKKA-----------DVG 841

Query: 216 NNVVQSGLVTFSNKIEEFFLLEW--GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM 273
            N V+ G + +++  E  F L+       +   ++     G +T +   L +      D 
Sbjct: 842 KNQVRFGALKYADDPEVLFYLDELGTKLEVISVLQNDQPMGGNTYTAEALAF-----SDH 896

Query: 274 QGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSH 333
                  +       ++++ +TDGE+    + ++        + +G +V A+GI    + 
Sbjct: 897 MFTEARGSRLHKGVPQVLIVITDGESH---DAEKLNATAKALRDKGILVLAVGIAGANTW 953

Query: 334 EFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKR 369
           E L    S + +Y VE    +   FS +   +    
Sbjct: 954 ELLAMAGSSDKYYFVETFGGLKGIFSDVSASVCNSS 989



 Score = 66.0 bits (159), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 36/205 (17%), Positives = 70/205 (34%), Gaps = 27/205 (13%)

Query: 169 DARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
           D + D+M ++D S S+          ++   K    M   V       + VQ G+V FS+
Sbjct: 617 DMKADIMFLVDSSGSIG---------LENFSKMKVFMKNLVSKSQIGADRVQIGVVQFSH 667

Query: 229 KIEEFFL--LEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
           +  E F        + +   I  ++  G +T +          +  +            N
Sbjct: 668 ENREEFQLNTFMSQNDIANAIDQMAHIGETTLTGSA-------LTFVSQYFSPEKGARPN 720

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIG-IRVIRSHEFLRACAS-PNS 344
            +K ++ +TD      +            +K G I+Y++G      +   L   +  P  
Sbjct: 721 VRKFLILITD-----GEAQDIVKDPAVALRKDGVIIYSVGVFGSNVTQ--LEEISGKPEM 773

Query: 345 FYLVENPHSMYDAFSHIGKDIVTKR 369
            + VEN   +      +   I + R
Sbjct: 774 VFYVENFDILQHIEDDLVLGICSPR 798



 Score = 56.4 bits (134), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 40/297 (13%), Positives = 84/297 (28%), Gaps = 47/297 (15%)

Query: 95  RNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHI 154
             E  D+              +  V V +     + A++  +      T       + ++
Sbjct: 139 SAESEDDVEEASKALREDGVKIISVGVQKASEEDLKAMATSQFHFNLRTARDLSMFAPNM 198

Query: 155 VMPITSSVKVNSQTDARL-----------DMMIVLDVSRSMESFFDSSITKIDMAIKSIN 203
              I    +        +           D++ +LD         + S   +D       
Sbjct: 199 TQIIKDVTQYREAMTDDIIVEACQGPSVADVVFLLD------MAINGSQENLDHLK---A 249

Query: 204 AMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFL--LEWGVSHLQRKIKYLSKFGVSTNSTP 261
            + E V  +    N ++ GLV +SN+        +    + + ++I+ LS       +  
Sbjct: 250 FLGESVSALDIKENCMRVGLVAYSNETRVISSLSMGVNKTEVLQRIQDLSPHVGQAYTGA 309

Query: 262 GLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAI 321
               A  +        Q  + ++    +I V +T         D          ++ G  
Sbjct: 310 ----ALRKTRKEVFSAQRGSRKNQGVPQIAVLVTH-----RASDDNVTKAAVNLRREGVT 360

Query: 322 VYAIGIRVIRSHEFLRACASPNSFYLVE-------NPHSM----YDAFSHIGKDIVT 367
           V+ +G+    + E L   AS    Y  E       N   +          +   I  
Sbjct: 361 VFTMGV-EGANPEQLEKIAS----YPAEQFTSKLSNFSELATHNQTFLKKLRNQITH 412



 Score = 49.9 bits (117), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 26/201 (12%), Positives = 64/201 (31%), Gaps = 25/201 (12%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D++ ++D S          +    +       + + V  +P   N  +  L  +S+ +  
Sbjct: 26  DVVFLVDSS------DHLGMKSFPLVKT---FIQKLVSSLPVEANKYRVALAQYSDALHN 76

Query: 233 FFL--LEWGVSHLQRKIK-YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKK 289
            F        + +   +K      G S      L+ A+   F           +   +  
Sbjct: 77  EFHLGAFKNRNPMLNHLKKNFGFIGGSLKIGNALQEAHRTYF----SAPTNGRDKKQFPP 132

Query: 290 IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVE 349
           I+V +   E      +          ++ G  + ++G++     + L+A A+    + + 
Sbjct: 133 ILVVLASAE-----SEDDVEEASKALREDGVKIISVGVQKASEED-LKAMATSQFHFNLR 186

Query: 350 NPHSMYDA---FSHIGKDIVT 367
               +       + I KD+  
Sbjct: 187 TARDLSMFAPNMTQIIKDVTQ 207



 Score = 41.0 bits (94), Expect = 0.32,   Method: Composition-based stats.
 Identities = 27/230 (11%), Positives = 66/230 (28%), Gaps = 15/230 (6%)

Query: 120  VVPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLD 179
             +     + +  +      +     +   T    +  P  S  +      + LD   +LD
Sbjct: 1910 SIDDTGTFQVLVVPSRPDQVPALERLQRCTFCYDLCKPDASCDQAKPPIQSYLDAAFLLD 1969

Query: 180  VSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWG 239
             S      +     + +     + A+L+  ++  +    V    V   +     FL    
Sbjct: 1970 SS------WHVGGAEFEDMRDLLEALLDHFEIASEPETSVTGDRVALLSHAPVDFLPNTQ 2023

Query: 240  VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN--------YKKII 291
             S ++ +   L+ +         ++ A  Q+     +         N         +  +
Sbjct: 2024 RSPVRTEFN-LTTYSSKHLMKRHVEQAVQQLNGDAFLGHALRWALDNVFLNTPNLRRNKV 2082

Query: 292  VFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACAS 341
            +F+      S  + +        AK  G  ++   +      + L   AS
Sbjct: 2083 IFVISAGETSHLDAETLKKESLRAKCHGYALFVFSLGPDWDDKELEDLAS 2132


>gi|313838674|gb|EFS76388.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL086PA1]
          Length = 320

 Score = 94.5 bits (233), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 37/219 (16%), Positives = 73/219 (33%), Gaps = 30/219 (13%)

Query: 169 DARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
             R  +++ +DVSRSM +      +++  A  +          + D+       LV F+ 
Sbjct: 86  RDRATVVVAIDVSRSMVATD-VEPSRLSAAKTAAKDF------LGDLPPRFNVSLVKFAA 138

Query: 229 KIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288
             +         + +   I  L     ST    G+  + N +  +    +H         
Sbjct: 139 SAQVVVAPTTDRAAVSTAITNLQVL-PSTAIGEGIYSSLNALKLVPDDPKH---PGQKPP 194

Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV--------------IRSHE 334
             IV ++DG     +     L    EA ++   VY I                    +H 
Sbjct: 195 AAIVLLSDGATNVGRPS---LEAAKEAGRQHVPVYTIAYGTAGGYVVEGGQRQPVPVNHY 251

Query: 335 FLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKRIW 371
            L A A  S    +  E+   + D +  I + +  ++++
Sbjct: 252 ELAAIAKASGGEKFSAESLGQLSDVYKSIAQSVGYEKVF 290


>gi|87306401|ref|ZP_01088548.1| hypothetical protein DSM3645_08717 [Blastopirellula marina DSM
           3645]
 gi|87290580|gb|EAQ82467.1| hypothetical protein DSM3645_08717 [Blastopirellula marina DSM
           3645]
          Length = 578

 Score = 94.5 bits (233), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 44/331 (13%), Positives = 105/331 (31%), Gaps = 32/331 (9%)

Query: 15  YKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNR 74
            +G + +L A+ + ++   + + ++V ++F M++ L   +D + +  A  ++   +    
Sbjct: 19  RRGVIVVLAAVLMIVMMGFMALSVDVGYMFTMQSQLQRSVDSAALAGAGTLIEGEDVATG 78

Query: 75  K-------KLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGY 127
                      G       +     +    L   G    +     + +   VV  +    
Sbjct: 79  TVHEYLTHNPVGLQWKEFTEGNTADNVDKFLTKYGDGLQLTIGEWNDTSGQVVAAEKNPT 138

Query: 128 SISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESF 187
           ++S    Y+       F           +   S     S+     D+M+VLD+S SM   
Sbjct: 139 TVSVRMTYE---NMPFFFGHLLGRDSFDITAESIATYQSR-----DIMLVLDLSGSMNDD 190

Query: 188 F-DSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRK 246
              +SI K+       +      ++  D+ + +   L                    +  
Sbjct: 191 SEFNSIGKLGF----DHIYSNSQQMYADLGSPIFGNLQFDPQYAVVNGPTPQSSGQAKSS 246

Query: 247 I----KYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLST 302
           +      +      T     +K +    ++         T + N +   V++T G+N + 
Sbjct: 247 VTYRGNSVVVKSDKTIKQISVKTSNGSTYNYYPGSSLNYTANPNKEIRYVWVTSGKNSNN 306

Query: 303 KEDQQSLYYCNEAKKRGAIVYAI--GIRVIR 331
            +  QS  +       G  +  I   + +  
Sbjct: 307 SDQVQSFDF------DGQRINTIKTALGLDN 331



 Score = 49.9 bits (117), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 21/201 (10%), Positives = 52/201 (25%), Gaps = 27/201 (13%)

Query: 180 VSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWG 239
            S S    + +S   I     S++  +  ++     + +  +     +        L   
Sbjct: 378 SSNSTPDLWKASAQPITAVKNSVDLFIHFMQEGDGRDRIGLAVYNAPNGDGLLESTLTEN 437

Query: 240 VS--HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDG 297
           +     Q + +    +   TN   G+              +          K++V +TDG
Sbjct: 438 LPFIMTQSRQRQAGHYHNYTNIGGGMTVGR---------EELQTRGRKGAVKMMVLLTDG 488

Query: 298 ENLSTKEDQQSLYY-------CNEAKKRGAIVYAIGIRVIRSHEFLRACA--SPNSFYLV 348
           +         +                +G  +  I +        +   A  +    + V
Sbjct: 489 QANWVNGGVNNNAAKNYVLNEAYLCADQGFTIITISLGAGADKALMDQVAEITGGVHFNV 548

Query: 349 -------ENPHSMYDAFSHIG 362
                  E    + + F  + 
Sbjct: 549 PGGQTVDEYSEDLTEIFRQVA 569


>gi|224372482|ref|YP_002606854.1| von Willebrand factor, type A [Nautilia profundicola AmH]
 gi|223588580|gb|ACM92316.1| von Willebrand factor, type A [Nautilia profundicola AmH]
          Length = 288

 Score = 94.5 bits (233), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 47/233 (20%), Positives = 78/233 (33%), Gaps = 31/233 (13%)

Query: 139 LKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMA 198
                F   +  S  +  P+ S +  N+      +++I LD S SM         KID A
Sbjct: 44  FSLLEFFIIFFLSVALASPVKSKIITNT-HKKGYNIVIDLDTSGSMA-----EFNKIDAA 97

Query: 199 IKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYL--SKFGVS 256
                   ++             GLV F N       L +     +  +K +  S  G  
Sbjct: 98  KAVSLDFAKK-------RKNDALGLVVFGNIAYIASPLTFDKKTFEDILKRIYVSIAGGK 150

Query: 257 TNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAK 316
           T     L  + N               +AN +KII+ +TDG +  +           + K
Sbjct: 151 TAIYDALFLSSNLFK------------NANGEKIIILLTDGMDNMSITPLDV--VIKKLK 196

Query: 317 KRGAIVYAIGIRVIRSHEFLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVT 367
           K    VY+I I        L+  +  +   FY+  +   +   +S I K   +
Sbjct: 197 KEHIKVYSIAIGGDADLSVLKKISKETNGKFYIASSLEDLKKIYSDINKLTKS 249


>gi|172087820|ref|YP_001816750.1| hypothetical protein VF_A1192 [Vibrio fischeri ES114]
 gi|171902402|gb|ACB55718.1| conserved hypothetical protein containing von Willebrand factor
           type A domain [Vibrio fischeri ES114]
          Length = 350

 Score = 94.5 bits (233), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 31/213 (14%), Positives = 66/213 (30%), Gaps = 24/213 (11%)

Query: 171 RLDMMIVLDVSRSMESFFDSSIT-----KIDMAIKSINAMLEEVKLIPDVNNVVQSGLVT 225
             D+M+V+D+S SM     +S       ++D   K +N  ++            + GL+ 
Sbjct: 100 GRDVMVVVDLSGSMAEKDFTSTNGLKISRLDAVKKVLNDFVKT-------RKGDRLGLIL 152

Query: 226 FSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDA 285
           F +                  +          ++  G       I   +           
Sbjct: 153 FGDAAFVQTPFTADHKVWLDLLNQTHVEMAGKSTHLGDAIGL-TIKRFEDSNNSQPLSTT 211

Query: 286 NYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR-------SHEFLRA 338
           + +K+ + +TDG +         +     AK +G  ++ I I   +         + +  
Sbjct: 212 SREKVAIILTDGNDT--DSYVPPMDAAKVAKVKGVRIHMIAIGDPQTVGEQALDMDTINT 269

Query: 339 CA--SPNSFYLVENPHSMYDAFSHIGKDIVTKR 369
            A  S    +   N   + +A++ I K      
Sbjct: 270 IADASGGQAFQALNQDELINAYAEISKLEPQLY 302


>gi|116251678|ref|YP_767516.1| transmembrane protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115256326|emb|CAK07407.1| putative transmembrane protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 329

 Score = 94.5 bits (233), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 29/207 (14%), Positives = 68/207 (32%), Gaps = 36/207 (17%)

Query: 173 DMMIVLDVSRSM-----ESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFS 227
           D+++ LD+S+SM            + ++D   + +   +             + GLV F 
Sbjct: 95  DILLALDLSQSMDTKDFPGADGKPLARVDAVKQVVADFVGR-------RPGDRIGLVAFG 147

Query: 228 NKIEEFFLLEWGVSHLQRKIKYLSKFGVS--TNSTPGLKYAYNQIFDMQGMRQHCNTEDA 285
           +            + ++  I           T+    L  A                   
Sbjct: 148 DAPYPLAPFTMDHALVETMIADAVPGMAGPRTSLGDALGLAVKMFEKT-----------T 196

Query: 286 NYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI-------RSHEFLRA 338
             +K+++ +TDG + +++     L     AK +G +V+A+GI               L+ 
Sbjct: 197 VPEKVLIVLTDGNDTASRMP--PLKAAEIAKSKGVVVHAVGIGDPLATGEDKLDTATLQK 254

Query: 339 CA--SPNSFYLVENPHSMYDAFSHIGK 363
            A  +   ++   +   +   +  + +
Sbjct: 255 IAEKTGGRYFFGGDQAQLASIYQVLDQ 281


>gi|118617151|ref|YP_905483.1| hypothetical protein MUL_1490 [Mycobacterium ulcerans Agy99]
 gi|166979868|sp|A0PNU3|Y1490_MYCUA RecName: Full=UPF0353 protein MUL_1490
 gi|118569261|gb|ABL04012.1| membrane protein [Mycobacterium ulcerans Agy99]
          Length = 335

 Score = 94.1 bits (232), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 32/249 (12%), Positives = 68/249 (27%), Gaps = 30/249 (12%)

Query: 141 FCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIK 200
               +    +     + +            R  +M+V+DVS+SM +       ++  A +
Sbjct: 66  HIPAMLLALSLVLFTVAMAGPTHDVRIPRNRAVVMLVIDVSQSMRATD-VEPNRMVAAQE 124

Query: 201 SINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNST 260
           +     +E+    +       GL+ ++                +  +  L  F   T + 
Sbjct: 125 AAKQFADELTPGIN------LGLIAYAGTATVLVSPTTNREATKAALDKLQ-FADRTATG 177

Query: 261 PGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSL---YYCNEAKK 317
             +  A   I  +          D      IV  +DG+                   AK 
Sbjct: 178 EAIFTALQAIATV---GAVIGGGDTPPPARIVLFSDGKETMPTNPDNPKGAYTAARTAKD 234

Query: 318 RGAIVYAIGIRVIR--------------SHEFLRACA--SPNSFYLVENPHSMYDAFSHI 361
           +G  +  I                      E ++  A  S  + Y       +   +  +
Sbjct: 235 QGVPISTISFGTPYGFVEINDQRQPVPVDDETMKKVAQLSGGNSYNAATLAELNSVYVSL 294

Query: 362 GKDIVTKRI 370
            + I  + I
Sbjct: 295 QQQIGYETI 303


>gi|41409532|ref|NP_962368.1| hypothetical protein MAP3434 [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|81570937|sp|Q73UD4|Y3434_MYCPA RecName: Full=UPF0353 protein MAP_3434
 gi|41398363|gb|AAS05984.1| hypothetical protein MAP_3434 [Mycobacterium avium subsp.
           paratuberculosis K-10]
          Length = 330

 Score = 94.1 bits (232), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 34/217 (15%), Positives = 66/217 (30%), Gaps = 33/217 (15%)

Query: 174 MMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEF 233
           +M+V+D+S+SM +       ++  A ++ +    ++    +       GLV F+      
Sbjct: 95  IMLVIDMSQSMRATD-VEPNRLKAAEQAASQFASQLTPGIN------LGLVGFAGTPYLL 147

Query: 234 FLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVF 293
                        +K L  F  ST +   +  A + I             D      IV 
Sbjct: 148 VPPTPQHQATIDALKKLD-FADSTATGEAIFTALHAI-----SATAVAGGDTPPPARIVL 201

Query: 294 MTDGENLSTKEDQQSLY----YCNEAKKRGAIVYAIGIRV--------------IRSHEF 335
           ++DG                     AK  G  +  I                    S + 
Sbjct: 202 LSDGGENKPSNPSDPHDGVYTAARLAKDEGVPISTITFGTKGGEIEMDGQKVAVPVSTDQ 261

Query: 336 LRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           ++  A  S    Y   N   +  +++ I  +I  + +
Sbjct: 262 MKMVAKLSGGQSYTATNLGELQKSYNAIENEIGYRTV 298


>gi|70730213|ref|YP_259952.1| von Willebrand factor type A domain-containing protein [Pseudomonas
           fluorescens Pf-5]
 gi|68344512|gb|AAY92118.1| von Willebrand factor type A domain protein [Pseudomonas
           fluorescens Pf-5]
          Length = 332

 Score = 94.1 bits (232), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 30/218 (13%), Positives = 77/218 (35%), Gaps = 36/218 (16%)

Query: 167 QTDARLDMMIVLDVSRSMESFFDS-----SITKIDMAIKSINAMLEEVKLIPDVNNVVQS 221
           Q     D+M+ +D+S+SM++   +      I ++    + +   ++            + 
Sbjct: 87  QQRPVRDLMLAIDLSQSMQTQDFNDANGQRIDRLSAVKEVVQGFIQR-------RKDDRL 139

Query: 222 GLVTFSNKIEEFFLLEWGVSHLQRKIK--YLSKFGVSTNSTPGLKYAYNQIFDMQGMRQH 279
           GL+ F +       L    + L   ++   +   G +T     +  A   +         
Sbjct: 140 GLIVFGSGAFAQAPLTLDHASLSLLLEDSGIGMAGPNTAIGDAIGLALKLLEQAHE---- 195

Query: 280 CNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHE----- 334
                   +K+++ +TDG + S+    Q       A+  G +++ IGI    +       
Sbjct: 196 -------PEKVLILLTDGNDTSSAITPQHAAAMAAAR--GVVIHTIGIGDPSAEGEAKVD 246

Query: 335 --FLRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
              L   A  +   ++  E+  ++   ++ + +    +
Sbjct: 247 LSALEQIARTTGGRYFRAEDRSALDQVYATLDRLTPHQ 284


>gi|319638170|ref|ZP_07992933.1| von Willebrand factor type A domain-containing protein [Neisseria
           mucosa C102]
 gi|317400443|gb|EFV81101.1| von Willebrand factor type A domain-containing protein [Neisseria
           mucosa C102]
          Length = 530

 Score = 94.1 bits (232), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 43/325 (13%), Positives = 105/325 (32%), Gaps = 33/325 (10%)

Query: 49  VLHSMIDRS--LVHAATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVN- 105
            LH   D +      A + ++      R + +    +  +      +F  ++    + N 
Sbjct: 33  NLHGAPDSALPATAVAEENLSLTENTERYQDQPDQPVKSVAQEPVSTFSIDVDTGSYANV 92

Query: 106 ----DIDDIVRSTSLDIVVVPQNEGYSISAISRYKIPLKFCTFI--PWYTNSRHIVMPIT 159
               +        ++ I  +     Y+    +  +        I  PW   ++ I + I 
Sbjct: 93  RRFLNSGKQPPKDAVRIEEIINYFPYNYPLPTDGRPFAVHTETIDSPWQPEAKLIKIGIQ 152

Query: 160 SSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVV 219
           +      +     +++ ++DVS SM+        K+ +  K++  + ++++      + V
Sbjct: 153 AQDTAK-KDLPPANLVFLVDVSGSMDEE-----NKLPLVQKTLRILTQQLRPQ----DKV 202

Query: 220 QSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQH 279
                +   ++            + + I  L   G ST+    L+ AY +          
Sbjct: 203 TLITYSSGEELVLPPTSGSDKETILKAIDKLKAEG-STSGESALRMAYEEAQKAFV---- 257

Query: 280 CNTEDANYKKIIVFMTDGENLSTKEDQQSLY-YCNEAKKRGAIVYAIGIRVI-RSHEFLR 337
                 N    I+  TDG+      D ++L     E +K G  +  +G      + + + 
Sbjct: 258 -----PNGINRILLATDGDFNVGVSDTETLKSMVAEKRKTGISLSTLGFGTDNYNEDMME 312

Query: 338 AC--ASPNSFYLVENPHSMYDAFSH 360
               A   ++  ++N          
Sbjct: 313 QIADAGDGNYSYIDNEKEAKKVLQQ 337


>gi|239995770|ref|ZP_04716294.1| von Willebrand factor, type A [Alteromonas macleodii ATCC 27126]
          Length = 358

 Score = 94.1 bits (232), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 27/219 (12%), Positives = 64/219 (29%), Gaps = 38/219 (17%)

Query: 169 DARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSN 228
           +   +MM+ +D+S SM+        +    +  +      V          + GL+ F++
Sbjct: 85  NEGREMMLAVDLSGSMKIDDMQLNGRQ---VNRLTMTKSVVYDFIQRRVGDRIGLILFAD 141

Query: 229 KIEEFFLLEWGVSHLQRKIKY--LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
                  L +    +   +    +   G  T     +  A  +  + +            
Sbjct: 142 TAYVQAPLTYDRDTVSTLLSEAVIGLVGEQTAIGDAIGLAVKRFDEREESN--------- 192

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIR--------------- 331
              +++ +TDG+N +     +       A  +G  VY IG+   +               
Sbjct: 193 --NVLILLTDGQNTAGNITPE--QAKELAISKGVKVYTIGVGADKMLIQSFFGSRQINPS 248

Query: 332 ---SHEFLRACAS--PNSFYLVENPHSMYDAFSHIGKDI 365
                  L   A+     ++   N   +   +  +    
Sbjct: 249 QELDEGMLTNIATSTGGQYFRARNAQELQAIYQQLDALE 287


>gi|167034052|ref|YP_001669283.1| von Willebrand factor type A [Pseudomonas putida GB-1]
 gi|166860540|gb|ABY98947.1| von Willebrand factor type A [Pseudomonas putida GB-1]
          Length = 324

 Score = 94.1 bits (232), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 30/215 (13%), Positives = 71/215 (33%), Gaps = 32/215 (14%)

Query: 168 TDARLDMMIVLDVSRSMESFFDSSIT-----KIDMAIKSINAMLEEVKLIPDVNNVVQSG 222
                D+M+ +D+S+SME+   +        ++      +   +             + G
Sbjct: 86  EQPIRDLMLAIDISQSMEATDYTDANGAKSDRLSAVKSVVRDFIAR-------RKDDRIG 138

Query: 223 LVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNT 282
           L+ F         L    + L   +  +       N+  G                    
Sbjct: 139 LIVFGTGAYPQAPLTLDHASLLLLLDEVGIGMAGPNTALGDAIGL---------TIKALE 189

Query: 283 EDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVI-------RSHEF 335
           +    +K+++ +TDG + S+       +  + A+  G +V+ IGI               
Sbjct: 190 KTPEQEKVLILLTDGNDTSSAITPD--HAAHLAQANGIVVHTIGIGDPQATGDAKVDLTT 247

Query: 336 LRACA--SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
           L+A A  +   F+  ++  ++   ++ + +    K
Sbjct: 248 LQAIARTTGGQFFRADDRQALQQVYATLDRLTPHK 282


>gi|254440702|ref|ZP_05054195.1| hypothetical protein OA307_117 [Octadecabacter antarcticus 307]
 gi|198250780|gb|EDY75095.1| hypothetical protein OA307_117 [Octadecabacter antarcticus 307]
          Length = 590

 Score = 94.1 bits (232), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 41/341 (12%), Positives = 93/341 (27%), Gaps = 47/341 (13%)

Query: 8   IRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMN 67
            + F  +  G + I + + + +I    GM +++      +  L   +DR+ + AA     
Sbjct: 19  FQRFRKDEDGALIIFSLMMMVMILWFGGMAVDLMRYETTRAKLQGSLDRATLAAA----- 73

Query: 68  EGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNEGY 127
           + +          D + +                         +     D +V       
Sbjct: 74  DLDQVMAPADVVRDYMDKAGM----------------------LHFLQGDPIVDQGINYR 111

Query: 128 SISAISRYKIPLKFCT-----FIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSR 182
            ++A +   +PL F         P+      + +  +S+ +        +++ +VLDVS 
Sbjct: 112 IVTANASAPMPLFFYDLPKVFSSPFTPGMSSLTVSGSSTAEERVSD---VEISLVLDVSS 168

Query: 183 SMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSH 242
           SM S       ++     +    +  V             +             +     
Sbjct: 169 SMNSN-----NRMTNLRPAAREFVTTVLANNTNAPQGLITISMIPYSAVVNPGTDIAPHL 223

Query: 243 LQRKIKY-----LSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDG 297
              +        +      T +   L  +Y+ +        +    + NY        + 
Sbjct: 224 NINRTHEYSTCPMFDDTEFTTTALNLGASYDHVSHFSYGGSNDMPINPNYTWCFAGDLNA 283

Query: 298 ENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRA 338
               T  +       N     G    AI + V      L +
Sbjct: 284 IKPHTTNEADLHTAINNLHAYGNT--AIDMGVKWGVALLDS 322



 Score = 59.9 bits (143), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 17/109 (15%), Positives = 38/109 (34%), Gaps = 7/109 (6%)

Query: 263 LKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIV 322
             + +   +       +      N    ++         ++ + +    C  A+ +G ++
Sbjct: 486 NNHYFLDAYYAGAWSWNEYWGTDNSIDHLIV------NGSEANTRLSNICAAARAQGIVI 539

Query: 323 YAIGIRVIRS-HEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           Y +           L+ CAS +S Y   +   +  AFS I  DI   ++
Sbjct: 540 YTVAFEAPSGGQTALQDCASSSSHYFDVDGTDISGAFSAIASDIRNLKL 588


>gi|84502751|ref|ZP_01000870.1| hypothetical protein OB2597_00965 [Oceanicola batsensis HTCC2597]
 gi|84389146|gb|EAQ01944.1| hypothetical protein OB2597_00965 [Oceanicola batsensis HTCC2597]
          Length = 470

 Score = 94.1 bits (232), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 63/457 (13%), Positives = 125/457 (27%), Gaps = 90/457 (19%)

Query: 3   SLNLNIRN----FFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSL 58
            L   +R     F     G M  L    L  +  V G+ ++V      +T +  +ID S 
Sbjct: 13  VLRDRVRRHVVDFARAEDGVMLALVMFMLLTMMTVAGIGVDVMRTEMERTRIQQVIDAST 72

Query: 59  VHAA--------TQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDI 110
           + AA         Q++ +                 +      +                 
Sbjct: 73  LAAAHKDNALDPKQVVLDYFDKAALASYISADDILVGGGETSTAVEVNLTAQVKTPFIRH 132

Query: 111 VRSTSLDIVV------VPQNEGYSISAISRYKIP---------LKFCTFIPWYTNSRHIV 155
           + + S ++           N   S+       +               F+        + 
Sbjct: 133 LGNESFNVPARGRAEQAYGNSEVSLVLDISGSMDDNRRMSRLHRAANEFVDTVLTPDSVD 192

Query: 156 MPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDV 215
               S +      +   D+   ++V +  +  +    T  D +  +I+     ++     
Sbjct: 193 RVSVSLIPYTGDVNVGWDIFSRMNVRQLHDYSYCVQFTPDDFSTTAIDPEDAYIQGQHFS 252

Query: 216 NNVVQSGLVTFSNKIE-EFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQ----- 269
           +   +   ++   +            + L+ +I  L+     T+   G+K+         
Sbjct: 253 HVDARFNYISCPTQSYETVTPFSQNNAALEAQINRLTGRER-TSIHIGIKWGAAMLDEAF 311

Query: 270 ----------IFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTK-------EDQQSLY-- 310
                         +  R       +N  K+IV MTDG N  TK       +        
Sbjct: 312 RPLVNDLVDNSIVDEAFRDRPAPFTSNTLKVIVVMTDGMNTETKRIKEFAYDTPDMRAHW 371

Query: 311 ------------------------------------YCNEAKKRGAIVYAIGIRVIRSH- 333
                                                CN AK  G I+Y+IG  +     
Sbjct: 372 ARHAMDDWDNDVDGSVEDHLFDTYYDTAIGNALLQNICNAAKANGIIIYSIGFEINNDAA 431

Query: 334 EFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370
           + +  CAS  S +       + +AFS I + +   R+
Sbjct: 432 QEMEDCASSPSHFYRVEGVQISEAFSSIAQQLKQLRL 468


>gi|218961690|ref|YP_001741465.1| BatA protein (fragment) [Candidatus Cloacamonas acidaminovorans]
 gi|167730347|emb|CAO81259.1| BatA protein (fragment) [Candidatus Cloacamonas acidaminovorans]
          Length = 270

 Score = 94.1 bits (232), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 36/226 (15%), Positives = 71/226 (31%), Gaps = 43/226 (19%)

Query: 168 TDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFS 227
           ++  +D+++ +D+S SM +   +   ++  A+      ++            + GLV FS
Sbjct: 21  SNKGVDIVMAIDISGSMLAMDFAPKNRLSAAVSVAKDFVKR-------RPNDRFGLVAFS 73

Query: 228 NKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287
                   L +    +   +  L     ++ +  G+  A                     
Sbjct: 74  EYALTQVPLTFDHLAMLNSLDKLKVNEEASATAIGMGLA---------KAVARLKNSTAK 124

Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRV------------------ 329
            K+I+ +TDG + + + D   L     AK+ G  VY IG+                    
Sbjct: 125 SKVIILITDGVSNTGEID--PLTAAGMAKELGIKVYPIGVGSKGLVPFPYSDPIFGTRYI 182

Query: 330 ----IRSHEFLRACA---SPNSFYLVENPHSMYDAFSHIGKDIVTK 368
                   E L   A         L  +   + D  + I +   T 
Sbjct: 183 NTYIDLDMETLNKIAETTGTGKAALATDAKGLADIMNEIDRLEKTL 228


>gi|313837214|gb|EFS74928.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL037PA2]
 gi|314927768|gb|EFS91599.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL044PA1]
 gi|314971985|gb|EFT16083.1| von Willebrand factor type A domain protein [Propionibacterium
           acnes HL037PA3]
          Length = 320

 Score = 94.1 bits (232), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 39/255 (15%), Positives = 82/255 (32%), Gaps = 30/255 (11%)

Query: 133 SRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSI 192
              +   +  T      +   +V+        ++    R  +++ +DVSRSM +      
Sbjct: 50  PNSRPWRQHVTMGLSVLSMATMVLAFAQPKAYHNVPRDRATVVVAIDVSRSMVATDVD-P 108

Query: 193 TKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSK 252
           +++  A  +          + D+       LV F+   +         + +   I  L  
Sbjct: 109 SRLSAAKTAAKDF------LGDLPPRFNVSLVKFAASSQVVVPPTTDRAVVSTAIANLQV 162

Query: 253 FGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYC 312
              ST    G+  + N +  +    +H           IV ++DG     +     L   
Sbjct: 163 L-PSTAIGEGIYSSLNALKLVPDDPKH---PGQKPPAAIVLLSDGATNVGRPS---LEAA 215

Query: 313 NEAKKRGAIVYAIGIRV--------------IRSHEFLRACA--SPNSFYLVENPHSMYD 356
            EA ++   VY I                    +H  L A A  S    +  E+   + D
Sbjct: 216 KEAGRQHVPVYTIAYGTAGGYVVEGGQRQPVPVNHYELAAVAKASGGEKFSAESLGQLSD 275

Query: 357 AFSHIGKDIVTKRIW 371
            +  I + +  ++++
Sbjct: 276 VYKSIAQSVGYEKVF 290


>gi|219852403|ref|YP_002466835.1| hypothetical protein Mpal_1806 [Methanosphaerula palustris E1-9c]
 gi|219546662|gb|ACL17112.1| conserved hypothetical protein [Methanosphaerula palustris E1-9c]
          Length = 316

 Score = 94.1 bits (232), Expect = 3e-17,   Method: Composition-base