RPSBLAST alignment for GI: 254780934 and conserved domain: pfam00092

>gnl|CDD|143873 pfam00092, VWA, von Willebrand factor type A domain. Length = 177
 Score = 63.6 bits (155), Expect = 9e-11
 Identities = 47/199 (23%), Positives = 81/199 (40%), Gaps = 32/199 (16%)

Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232
           D++ +LD S S+           +   + I  ++E + + PD   V   GLV +S+ +  
Sbjct: 1   DIVFLLDGSGSI------GEANFEKVKEFIKKLVENLDIGPDGTRV---GLVQYSSDVTT 51

Query: 233 FFLL----EWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286
            F L         +S + R I YL      TN+   LKYA   +F   G R        N
Sbjct: 52  EFSLNDYKSKDDLLSAVLRNIYYLGG---GTNTGKALKYALENLFRSAGSRP-------N 101

Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNS-- 344
             K+++ +TDG++        +       +K G IV+ +G+  +   E LR  AS     
Sbjct: 102 APKVVILLTDGKSNDGGLVPAAAA--ALRRKVGIIVFGVGVGDV-DEEELRLIASEPCSE 158

Query: 345 --FYLVENPHSMYDAFSHI 361
              + V +  ++ D    +
Sbjct: 159 GHVFYVTDFDALSDIQEEL 177