RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780935|ref|YP_003065348.1| rare lipoprotein A [Candidatus Liberibacter asiaticus str. psy62] (276 letters) >d1w36c1 c.37.1.19 (C:1-347) Exodeoxyribonuclease V gamma chain (RecC), N-terminal domain {Escherichia coli [TaxId: 562]} Length = 347 Score = 26.1 bits (57), Expect = 3.0 Identities = 9/20 (45%), Positives = 10/20 (50%) Query: 149 YHSNRLIDLSNAAAKILRVE 168 YHSNRL L I+ E Sbjct: 5 YHSNRLDVLEALMEFIVERE 24 >d2vzsa5 c.1.8.3 (A:336-674) Exochitosanase CsxA {Amycolatopsis orientalis [TaxId: 31958]} Length = 339 Score = 26.0 bits (56), Expect = 3.3 Identities = 10/27 (37%), Positives = 13/27 (48%), Gaps = 2/27 (7%) Query: 62 GGRYFL--GKPYQIMGRWYVPRQYTAY 86 GGR + GKP I G Y P + + Sbjct: 10 GGRQYSVNGKPLLIRGGGYTPDLFLRW 36 >d2p0ma1 a.119.1.2 (A:113-663) 15-Lipoxygenase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 551 Score = 25.3 bits (55), Expect = 5.0 Identities = 9/22 (40%), Positives = 10/22 (45%), Gaps = 2/22 (9%) Query: 232 NCDD--DSLQKQREISLRERKK 251 D QK RE L ER+K Sbjct: 5 TVGDPQGLFQKHREQELEERRK 26 >d2ae0x1 b.52.1.4 (X:3-337) Membrane-bound lytic murein transglycosylase A, MLTA {Escherichia coli [TaxId: 562]} Length = 335 Score = 24.8 bits (54), Expect = 8.9 Identities = 11/78 (14%), Positives = 23/78 (29%), Gaps = 11/78 (14%) Query: 51 RIVSGKRVPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVY 110 G + G Y+ +G+ + R + M + + + + E Sbjct: 166 DFGDGSPLNFFSYAGKNGHAYRSIGKVLIDRGEVKKEDMSMQAI--RHW---GETHSEAE 220 Query: 111 GTEYITAAHPTLPLPSYV 128 E + PS+V Sbjct: 221 VRELLEQN------PSFV 232 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.321 0.137 0.415 Gapped Lambda K H 0.267 0.0451 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 1,071,814 Number of extensions: 50093 Number of successful extensions: 85 Number of sequences better than 10.0: 1 Number of HSP's gapped: 85 Number of HSP's successfully gapped: 4 Length of query: 276 Length of database: 2,407,596 Length adjustment: 84 Effective length of query: 192 Effective length of database: 1,254,276 Effective search space: 240820992 Effective search space used: 240820992 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 52 (24.5 bits)