HHsearch alignment for GI: 254780936 and conserved domain: COG1432

>COG1432 Uncharacterized conserved protein [Function unknown].
Probab=99.95  E-value=7.2e-27  Score=188.50  Aligned_cols=171  Identities=41%  Similarity=0.550  Sum_probs=146.6

Q ss_pred             CCCCCCEEEEEEEHHHHHHHH-HHCCCCCCHHHHHHHHHHCCEEEEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCEEEE
Q ss_conf             987887189998078999999-8508767989999998517929999997306887314677757999889755956975
Q gi|254780936|r    1 MFDPREKIALFIDGANLYASS-KALGFDIDYRKLLKAFRSRAIVIRAYYYTTVVGDPEQQFSPLHPLLDWLHYNGFQVVA   79 (182)
Q Consensus         1 m~~~~~rvaIfID~~Nl~~~~-~~~~~~~d~~~L~~~l~~~~~l~~~~~y~~~~~~~~~~~~~~~~~~~~l~~~g~~v~~   79 (182)
T Consensus         1 ~~~~~~~i~~~id~~n~~~~~~~~~~~~~d~~~ll~~~~~~~~l~~~~~~~~~~~~~--~~~~~~~~~~~~~~~g~~v~~   78 (181)
T COG1432           1 TPIMVDRIALFIDGKNLYASQRKNLGILIDYRKLLRKELKRIYLYEAAPYTAEYGDI--EIQEVFLNEYELRSDGFTVVT   78 (181)
T ss_pred             CCCCCCCEEEEEEHHHHHHHHHHHCCCCCCHHHHHHHHHCCCEEEEHHHHHHHCCHH--HHHHHHHHHHHHHCCCEEEEE
T ss_conf             976566300345332204567651561026999999864577485126565231615--541344128887337718983


Q ss_pred             EEEEEECCCCCCCCCCCCCHHHHHHHHHHHHC--CCCEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCHHHHH
Q ss_conf             34589537888654356532999999999421--1588999838665899999999849889999831577654708999
Q gi|254780936|r   80 KVAKEFTENCGRKRVKSSMDVELAVDAFEQSE--GLEHLVIFSGDGCFTTLVAALQRKVKKVTIVSTVLSDPSMASDQLR  157 (182)
Q Consensus        80 ~~~~~~~~~~~~~~~kk~~Dv~laiD~~~~a~--~~d~~iLvSGD~Df~pli~~lr~~Gk~V~v~~~~~~~~~~~S~~L~  157 (182)
T Consensus        79 ~~~~~~~~---~~~~k~~vDv~la~D~~~l~~~~~~D~ivl~SgD~DF~p~v~~~~~~G~rv~v~~~~----~~~s~~L~  151 (181)
T COG1432          79 SNLDGFTD---LRITKGDVDVELAVDAMELADKKNVDTIVLFSGDGDFIPLVEAARDKGKRVEVAGIE----PMTSSDLR  151 (181)
T ss_pred             ECCCCCCC---CCCCCCCCCHHHHHHHHHHHCCCCCCEEEEECCCCCHHHHHHHHHHCCCEEEEEECC----CCCHHHHH
T ss_conf             04333342---110103545999999999741146786999747765288999999669879999457----76879998


Q ss_pred             HHCCCCEEHHHHHHHHCCCCCCC
Q ss_conf             85211151899787622583115
Q gi|254780936|r  158 RQADYFMDLAYLKNEIARDPDED  180 (182)
Q Consensus       158 ~~ad~fi~l~~l~~~i~r~~~~~  180 (182)
T Consensus       152 ~~aD~~i~L~~~~~~~~~~~~~~  174 (181)
T COG1432         152 NAADYYIDLKSLEEAILLPEIER  174 (181)
T ss_pred             HHCCCEEECCHHHHHHCCCCCCC
T ss_conf             63261677707665442332345