HHsearch alignment for GI: 254780936 and conserved domain: smart00475

>smart00475 53EXOc 5'-3' exonuclease.
Probab=95.54  E-value=0.22  Score=29.10  Aligned_cols=53  Identities=23%  Similarity=0.136  Sum_probs=35.1

Q ss_pred             HHHHHHHHCCCEEEEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHH
Q ss_conf             999889755956975345895378886543565329999999994211588999838665899999
Q gi|254780936|r   65 PLLDWLHYNGFQVVAKVAKEFTENCGRKRVKSSMDVELAVDAFEQSEGLEHLVIFSGDGCFTTLVA  130 (182)
Q Consensus        65 ~~~~~l~~~g~~v~~~~~~~~~~~~~~~~~kk~~Dv~laiD~~~~a~~~d~~iLvSGD~Df~pli~  130 (182)
T Consensus        88 ~i~~~l~~~gi~~~~~~-------------g~EADDvIatla~~~~~~~~~v~IvS~DkDl~QLv~  140 (259)
T smart00475       88 LIKELLDALGIPVLEVE-------------GYEADDVIATLAKKAEAEGYEVRIVSGDKDLLQLVS  140 (259)
T ss_pred             HHHHHHHHCCCCEEECC-------------CCCHHHHHHHHHHHHHHCCCEEEEECCCCCHHHHCC
T ss_conf             99999997699876238-------------854799999999999986992699508837888488