BLAST/PSIBLAST alignment of GI: 254780936 and GI: 222148076 at iteration 1
>gi|222148076|ref|YP_002549033.1| hypothetical protein Avi_1440 [Agrobacterium vitis S4] Length = 192
>gi|221735064|gb|ACM36027.1| conserved hypothetical protein [Agrobacterium vitis S4] Length = 192
 Score =  254 bits (650), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 150/179 (83%), Gaps = 2/179 (1%)

Query: 1   MFDPREKIALFIDGANLYASSKALGFDIDYRKLLKAFRSRAIVIRAYYYTTVVGDPEQQF 60
           MFDPREKIALFIDGANLYA+SK+LGFDIDYRKLLKAF+ R  ++RAYYYT ++ D  Q++
Sbjct: 1   MFDPREKIALFIDGANLYAASKSLGFDIDYRKLLKAFQKRGYLLRAYYYTALIED--QEY 58

Query: 61  SPLHPLLDWLHYNGFQVVAKVAKEFTENCGRKRVKSSMDVELAVDAFEQSEGLEHLVIFS 120
           S + PL+DWL YNG++V+ K AKEFT++ GR++VK +MD+ELA+DA EQSE ++HLVIFS
Sbjct: 59  SSIRPLIDWLDYNGYKVITKPAKEFTDSMGRRKVKGNMDIELAIDAMEQSETVDHLVIFS 118

Query: 121 GDGCFTTLVAALQRKVKKVTIVSTVLSDPSMASDQLRRQADYFMDLAYLKNEIARDPDE 179
           GDG FTTLV ALQRK +KV++VST+ + P M +D LRRQAD+F+DL  LK EI RDP E
Sbjct: 119 GDGDFTTLVEALQRKGRKVSVVSTMSTQPPMIADDLRRQADHFIDLVSLKAEIGRDPSE 177