RPSBLAST alignment for GI: 254780936 and conserved domain: pfam01936

>gnl|CDD|145225 pfam01936, DUF88, Protein of unknown function DUF88. This highly conserved bacterial protein has no known function. The alignment contains many conserved aspartates, suggesting an enzymatic function such as an endonuclease or glycosyl hydrolase (Bateman A pers. obs). Length = 140
 Score =  105 bits (264), Expect = 7e-24
 Identities = 51/162 (31%), Positives = 73/162 (45%), Gaps = 25/162 (15%)

Query: 7   KIALFIDGANLYASSKALGFDIDYRKLLKAFRSRAIVIRAYYYTTVVGDPEQQFSPLHPL 66
           ++A+FIDG N    +      IDYRK+L+  +S   V+RA  Y       +     L   
Sbjct: 1   RVAVFIDGENCPVPAG-----IDYRKVLEEIKSGGEVVRARAYG------DWSDPKLRKF 49

Query: 67  LDWLHYNGFQVVAKVAKEFTENCGRKRVKSSMDVELAVDAFEQSE--GLEHLVIFSGDGC 124
            D L   G  V  K           K  K+++DV LAVDA E +     +  V+ SGDG 
Sbjct: 50  PDALSSTGIPVQHKPLT--------KSGKNAVDVGLAVDALELAYDNNPDTFVLVSGDGD 101

Query: 125 FTTLVAALQRKVKKVTIVSTVLSDPSMASDQLRRQADYFMDL 166
           F  L+  L+ + K+V ++          SD L   AD F+DL
Sbjct: 102 FAPLLERLRERGKRVEVLGA----EPSTSDALINAADRFIDL 139