RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780937|ref|YP_003065350.1| DNA-directed RNA polymerase subunit omega [Candidatus Liberibacter asiaticus str. psy62] (122 letters) >d1m22a_ c.117.1.1 (A:) Peptide amidase Pam {Stenotrophomonas maltophilia [TaxId: 40324]} Length = 490 Score = 26.2 bits (56), Expect = 0.86 Identities = 9/53 (16%), Positives = 20/53 (37%), Gaps = 6/53 (11%) Query: 46 TVVALRE-IASGTLSPDDLEEDFIHSLQKHVEIDEPDSPTENSDFSWHKPEAL 97 V L+ + +G L L + ++ + + + P + P+AL Sbjct: 8 DVADLQARMTAGELDSTTLTQAYL----QRIAALDRTGPRLRA-VIELNPDAL 55 >d1mw9x_ e.10.1.1 (X:) DNA topoisomerase I, 67K N-terminal domain {Escherichia coli [TaxId: 562]} Length = 591 Score = 25.6 bits (55), Expect = 1.4 Identities = 3/27 (11%), Positives = 11/27 (40%) Query: 50 LREIASGTLSPDDLEEDFIHSLQKHVE 76 L ++A+ + + F + ++ Sbjct: 549 LDQVANHEAEWKAVLDHFFSDFTQQLD 575 >d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Score = 25.4 bits (55), Expect = 1.6 Identities = 10/61 (16%), Positives = 18/61 (29%) Query: 46 TVVALREIASGTLSPDDLEEDFIHSLQKHVEIDEPDSPTENSDFSWHKPEALSFGQMSEG 105 TV AL ++ E + I ++ W + + + F M Sbjct: 60 TVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPD 119 Query: 106 D 106 D Sbjct: 120 D 120 >d1uzea_ d.92.1.5 (A:) Angiotensin converting enzyme, ACE {Human (Homo sapiens) [TaxId: 9606]} Length = 579 Score = 24.8 bits (53), Expect = 2.2 Identities = 6/42 (14%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Query: 51 REIASGTLSPDDLEEDFIHSLQKHVEIDEPDSPTENSDFSWH 92 + G+++ ++ +++ K+ + P T+ DF Sbjct: 430 WRVFDGSITKENYNQEWWSLRLKYQGLCPPVPRTQG-DFDPG 470 >d1twff_ a.143.1.2 (F:) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 84 Score = 24.6 bits (54), Expect = 2.5 Identities = 8/34 (23%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 26 RTRHLSQGAKPTVDVGKDKNTV-VALREIASGTL 58 R +S A VD+ + + + +A++E+A + Sbjct: 26 RALQISMNAPVFVDLEGETDPLRIAMKELAEKKI 59 >d1of8a_ c.1.10.4 (A:) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Baker's yeast (Saccharomyces cerevisiae), tyrosine-regulated isozyme [TaxId: 4932]} Length = 346 Score = 24.0 bits (52), Expect = 4.0 Identities = 6/19 (31%), Positives = 9/19 (47%) Query: 2 ARTTVEDCIDKVDNRFLLV 20 R D I D+R L++ Sbjct: 32 GRREAIDIITGKDDRVLVI 50 >d1pmya_ b.6.1.1 (A:) Pseudoazurin {Methylobacterium extorquens, strain am1 [TaxId: 408]} Length = 123 Score = 23.9 bits (51), Expect = 4.2 Identities = 9/43 (20%), Positives = 16/43 (37%) Query: 25 HRTRHLSQGAKPTVDVGKDKNTVVALREIASGTLSPDDLEEDF 67 H G V VG ++ + A + + L+ L+ F Sbjct: 77 KCAPHYMMGMVALVVVGDKRDNLEAAKSVQHNKLTQKRLDPLF 119 >d1n8fa_ c.1.10.4 (A:) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Escherichia coli, phenylalanine-regulated isozyme [TaxId: 562]} Length = 343 Score = 23.6 bits (51), Expect = 5.2 Identities = 6/19 (31%), Positives = 10/19 (52%) Query: 2 ARTTVEDCIDKVDNRFLLV 20 AR + + D+R L+V Sbjct: 32 ARKAIHKILKGNDDRLLVV 50 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.313 0.132 0.380 Gapped Lambda K H 0.267 0.0606 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 450,030 Number of extensions: 19123 Number of successful extensions: 43 Number of sequences better than 10.0: 1 Number of HSP's gapped: 43 Number of HSP's successfully gapped: 12 Length of query: 122 Length of database: 2,407,596 Length adjustment: 75 Effective length of query: 47 Effective length of database: 1,377,846 Effective search space: 64758762 Effective search space used: 64758762 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 47 (22.1 bits)