BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780938|ref|YP_003065351.1| 4'-phosphopantetheinyl transferase [Candidatus Liberibacter asiaticus str. psy62] (132 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780938|ref|YP_003065351.1| 4'-phosphopantetheinyl transferase [Candidatus Liberibacter asiaticus str. psy62] Length = 132 Score = 266 bits (680), Expect = 9e-74, Method: Compositional matrix adjust. Identities = 132/132 (100%), Positives = 132/132 (100%) Query: 1 MIIGIGSDIVSIQRISRLLQSFNRKFESRCFSSLEQDVCDLSCNRVASYAKRFAAKEAFS 60 MIIGIGSDIVSIQRISRLLQSFNRKFESRCFSSLEQDVCDLSCNRVASYAKRFAAKEAFS Sbjct: 1 MIIGIGSDIVSIQRISRLLQSFNRKFESRCFSSLEQDVCDLSCNRVASYAKRFAAKEAFS 60 Query: 61 KAIGTGISKGVSWKDIEVCHFPGGKPYISISGRASDVLSSLVPKGYKPVVHLTISDDFPF 120 KAIGTGISKGVSWKDIEVCHFPGGKPYISISGRASDVLSSLVPKGYKPVVHLTISDDFPF Sbjct: 61 KAIGTGISKGVSWKDIEVCHFPGGKPYISISGRASDVLSSLVPKGYKPVVHLTISDDFPF 120 Query: 121 AQAFVVIESLLI 132 AQAFVVIESLLI Sbjct: 121 AQAFVVIESLLI 132 >gi|254781225|ref|YP_003065638.1| P4 family phage/plasmid primase [Candidatus Liberibacter asiaticus str. psy62] Length = 789 Score = 25.4 bits (54), Expect = 0.40, Method: Composition-based stats. Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 6/42 (14%) Query: 44 NRVASYAKRFA------AKEAFSKAIGTGISKGVSWKDIEVC 79 NR AS+A++ AK+ F K + ISKG+ EVC Sbjct: 638 NRDASFAQKLETKYTLEAKKWFLKGVKAYISKGLDVDIPEVC 679 >gi|254780920|ref|YP_003065333.1| dTDP-glucose 4,6-dehydratase [Candidatus Liberibacter asiaticus str. psy62] Length = 358 Score = 24.6 bits (52), Expect = 0.63, Method: Compositional matrix adjust. Identities = 12/29 (41%), Positives = 15/29 (51%) Query: 19 LQSFNRKFESRCFSSLEQDVCDLSCNRVA 47 L S +S FS L+ D+CD C R A Sbjct: 40 LNSLKEISQSNLFSFLQVDICDRECIRSA 68 >gi|255764461|ref|YP_003064629.2| methionyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 511 Score = 23.9 bits (50), Expect = 1.1, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 12/37 (32%) Query: 12 IQRISRLLQSF-----NRKF-------ESRCFSSLEQ 36 I++++ LLQ+F N+ F E+RCF SL+Q Sbjct: 455 IRQLAILLQAFVPKLANKIFDILFVADENRCFQSLDQ 491 >gi|254781166|ref|YP_003065579.1| enoyl-(acyl carrier protein) reductase [Candidatus Liberibacter asiaticus str. psy62] Length = 284 Score = 23.9 bits (50), Expect = 1.1, Method: Compositional matrix adjust. Identities = 8/33 (24%), Positives = 18/33 (54%) Query: 63 IGTGISKGVSWKDIEVCHFPGGKPYISISGRAS 95 +G ++ ++W ++CH G K ++ G A+ Sbjct: 16 LGVANNRSLAWSIAKMCHAAGAKVALTWQGDAT 48 >gi|254780399|ref|YP_003064812.1| DNA mismatch repair protein [Candidatus Liberibacter asiaticus str. psy62] Length = 594 Score = 22.3 bits (46), Expect = 3.1, Method: Composition-based stats. Identities = 12/42 (28%), Positives = 17/42 (40%) Query: 83 GGKPYISISGRASDVLSSLVPKGYKPVVHLTISDDFPFAQAF 124 GGK + I+ + S +P + ISDDF F Sbjct: 49 GGKSFFQITDNGFGMTSEEIPMAVQRHCTSKISDDFSNIHTF 90 >gi|254780450|ref|YP_003064863.1| two-component sensor histidine kinase/response regulator hybrid protein [Candidatus Liberibacter asiaticus str. psy62] Length = 803 Score = 21.6 bits (44), Expect = 5.4, Method: Composition-based stats. Identities = 10/21 (47%), Positives = 12/21 (57%) Query: 87 YISISGRASDVLSSLVPKGYK 107 +I ISG A D S +PK K Sbjct: 758 FIFISGYAEDAFSKNLPKDAK 778 >gi|254780596|ref|YP_003065009.1| ABC transporter nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 438 Score = 21.6 bits (44), Expect = 5.9, Method: Composition-based stats. Identities = 9/13 (69%), Positives = 11/13 (84%) Query: 120 FAQAFVVIESLLI 132 FA+AFVV SLL+ Sbjct: 155 FARAFVVFPSLLL 167 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.323 0.138 0.404 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 82,815 Number of Sequences: 1233 Number of extensions: 3201 Number of successful extensions: 9 Number of sequences better than 100.0: 8 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 8 length of query: 132 length of database: 328,796 effective HSP length: 65 effective length of query: 67 effective length of database: 248,651 effective search space: 16659617 effective search space used: 16659617 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 34 (17.7 bits)