BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780940|ref|YP_003065353.1| ribonuclease III [Candidatus Liberibacter asiaticus str. psy62] (227 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780940|ref|YP_003065353.1| ribonuclease III [Candidatus Liberibacter asiaticus str. psy62] Length = 227 Score = 466 bits (1198), Expect = e-133, Method: Compositional matrix adjust. Identities = 227/227 (100%), Positives = 227/227 (100%) Query: 1 MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60 MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF Sbjct: 1 MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60 Query: 61 NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120 NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE Sbjct: 61 NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120 Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFR 180 SLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFR Sbjct: 121 SLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFR 180 Query: 181 SGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIWT 227 SGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIWT Sbjct: 181 SGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIWT 227 >gi|254780342|ref|YP_003064755.1| substrate-binding region of ABC-type glycine betaine transport system [Candidatus Liberibacter asiaticus str. psy62] Length = 309 Score = 28.9 bits (63), Expect = 0.068, Method: Compositional matrix adjust. Identities = 14/45 (31%), Positives = 25/45 (55%) Query: 92 DLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGGIEVAG 136 +LASF ++ D R ++ + S + + S + YL GG E++G Sbjct: 176 ELASFSQIRRDQRNNIPAVFLSWEPHPINSDLNIHYLPGGEEISG 220 >gi|254780956|ref|YP_003065369.1| thymidylate synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 264 Score = 26.6 bits (57), Expect = 0.34, Method: Compositional matrix adjust. Identities = 17/57 (29%), Positives = 25/57 (43%), Gaps = 2/57 (3%) Query: 153 FRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKR 209 R + EWA + P Y V +RS PD+D V+ +IS + + D R Sbjct: 72 LHRHGVSIWDEWADKDGELGPIYGVQWRSWPDYDG--NVIDQISSIVQSLRADPYSR 126 >gi|254781141|ref|YP_003065554.1| hypothetical protein CLIBASIA_05225 [Candidatus Liberibacter asiaticus str. psy62] Length = 196 Score = 22.3 bits (46), Expect = 6.6, Method: Compositional matrix adjust. Identities = 9/33 (27%), Positives = 18/33 (54%), Gaps = 6/33 (18%) Query: 31 SISHSYQESYERLEFLGDRILGLLISTLLFNHF 63 ++ +Y E+Y R+ +L + L ++ NHF Sbjct: 30 TLEKTYPETYHRIRYLRQKALNII------NHF 56 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.319 0.132 0.377 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 128,731 Number of Sequences: 1233 Number of extensions: 4750 Number of successful extensions: 13 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 10 Number of HSP's gapped (non-prelim): 5 length of query: 227 length of database: 328,796 effective HSP length: 71 effective length of query: 156 effective length of database: 241,253 effective search space: 37635468 effective search space used: 37635468 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 37 (18.9 bits)