>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily. RERG (Ras-related and Estrogen- Regulated Growth inhibitor) and Ras-like 11 are members of a novel subfamily of Ras that were identified based on their behavior in breast and prostate tumors, respectively. RERG expression was decreased or lost in a significant fraction of primary human breast tumors that lack estrogen receptor and are correlated with poor clinical prognosis. Elevated RERG expression correlated with favorable patient outcome in a breast tumor subtype that is positive for estrogen receptor expression. In contrast to most Ras proteins, RERG overexpression inhibited the growth of breast tumor cells in vitro and in vivo. RasL11 was found to be ubiquitously expressed in human tissue, but down-regulated in prostate tumors. Both RERG and RasL11 lack the C-terminal CaaX prenylation motif, where a = an aliphatic amino acid and X = any amino acid, and are localized primarily in the cytoplasm. Both are believed to have tu

Probab=99.58 E-value=2.5e-14 Score=112.53 Aligned_cols=153 Identities=27% Similarity=0.309 Sum_probs=95.5 Q ss_pred EEEECCCCCCHHHHHHHHHCCCEEEECCCCCCEEEEEEEEEEECC--EEEEEEECCCCHHHCCCCCCCCCCHHHHHHHHH Q ss_conf 998338998688999998689202105888860212789997399--489999879840101235753210023455553 Q gi|254780941|r 25 VALVGATNAGKSTLVNRFVGAKVSIVTHKVQTTRSIVRGIVSEKE--SQIVFLDTPGIFNAKDSYHKLMIRLSWSTIKHA 102 (311) Q Consensus 25 VaivG~pN~GKSTL~N~l~g~~vsivS~k~~TTr~~i~gi~~~~~--~qiifvDTPG~~~~~~~l~~~~~~~~~~~l~~a 102 (311) T Consensus 2 iv~vGd~~VGKTsli~rf~~~~f~--~~y~~T~~~~~~~~~~v~~~~~~l~iwDtaG~e~~~----~---~~~~~~~~~a 72 (165) T cd04146 2 IAVLGASGVGKSALVVRFLTKRFI--GEYDPNLESLYSRQVTIDGEQVSLEILDTAGQQQAD----T---EQLERSIRWA 72 (165) T ss_pred EEEECCCCCCHHHHHHHHHHCCCC--CCCCCCCCCEEEEEEEECCEEEEEEEEECCCCCCCC----H---HHHHHHCCCC T ss_conf 999998997789999999749899--875995563057999999999999999289850122----0---1255430458 Q ss_pred HHHCCCCHHHHHHHCC-HHHHHHHHH-----HCCCCCEEEEEECCCHHHHHH-HHHHHHHHHCCCCCCCCCCCCCCC-CC Q ss_conf 2100110000100000-001223454-----428720257872110104345-788886410012334311000138-74 Q gi|254780941|r 103 DIVCLVVDSHRELKVN-IHDLLKEIA-----KRSSRLILILNKIDCVKPERL-LEQAEIANKLVFIEKTFMVSATKG-HG 174 (311) Q Consensus 103 Diil~VvDa~~~~~~~-~~~il~~l~-----~~~~p~IiVlNKiDlv~~~~l-~~~~~~~~~~~~~~~i~~ISAk~g-~G 174 (311) T Consensus 73 ~~~ilvydit~~~Sf~~~~~~~~~i~~~~~~~~~~piilVGNK~DL~~~r~Vs~ee~~~~a~~~~~-~f~E~SAk~~~~~ 151 (165) T cd04146 73 DGFVLVYSITDRSSFDEISQLKQLIREIKKRDREIPVILVGNKADLLHYRQVSTEEGEKLASELGC-LFFEVSAAEDYDG 151 (165) T ss_pred CEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCHHHHHHHHHHCCC-EEEEEECCCCCCC T ss_conf 789999865888999999999999999846699953998445545210367799999999998199-8999752087826 Q ss_pred HHHHHHHHHHHCC Q ss_conf 2678999998366 Q gi|254780941|r 175 CDDVLNYLCSTLP 187 (311) Q Consensus 175 id~L~~~L~~~lp 187 (311) T Consensus 152 V~~~F~~l~~~i~ 164 (165) T cd04146 152 VHSVFHELCREVR 164 (165) T ss_pred HHHHHHHHHHHHC T ss_conf 9999999999966

HHsearch alignment for GI: 254780941 and conserved domain: cd04146