>cd04150 Arf1_5_like Arf1-Arf5-like subfamily. This subfamily contains Arf1, Arf2, Arf3, Arf4, Arf5, and related proteins. Arfs1-5 are soluble proteins that are crucial for assembling coat proteins during vesicle formation. Each contains an N-terminal myristoylated amphipathic helix that is folded into the protein in the GDP-bound state. GDP/GTP exchange exposes the helix, which anchors to the membrane. Following GTP hydrolysis, the helix dissociates from the membrane and folds back into the protein. A general feature of Arf1-5 signaling may be the cooperation of two Arfs at the same site. Arfs1-5 are generally considered to be interchangeable in function and location, but some specific functions have been assigned. Arf1 localizes to the early/cis-Golgi, where it is activated by GBF1 and recruits the coat protein COPI. It also localizes to the trans-Golgi network (TGN), where it is activated by BIG1/BIG2 and recruits the AP1, AP3, AP4, and GGA proteins. Humans, but not rodents

Probab=99.73 E-value=3.1e-17 Score=131.40 Aligned_cols=150 Identities=19% Similarity=0.205 Sum_probs=97.3 Q ss_pred EEEEECCCCCCHHHHHHHHHCCCEEEECCCCCCEEEEEEEEEEECCEEEEEEECCCCHHHCCCCCCCCCCHHHHHHHHHH Q ss_conf 89983389986889999986892021058888602127899973994899998798401012357532100234555532 Q gi|254780941|r 24 CVALVGATNAGKSTLVNRFVGAKVSIVTHKVQTTRSIVRGIVSEKESQIVFLDTPGIFNAKDSYHKLMIRLSWSTIKHAD 103 (311) Q Consensus 24 ~VaivG~pN~GKSTL~N~l~g~~vsivS~k~~TTr~~i~gi~~~~~~qiifvDTPG~~~~~~~l~~~~~~~~~~~l~~aD 103 (311) T Consensus 2 KililG~~~sGKTsll~~l~~~~~~~~~pT~g~~----~~~~~~~~~~l~iwD~~G~~--------~~r~l~~~Y~~~a~ 69 (159) T cd04150 2 RILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFN----VETVEYKNISFTVWDVGGQD--------KIRPLWRHYFQNTQ 69 (159) T ss_pred EEEEECCCCCCHHHHHHHHHCCCCCCCCCCCCCC----EEEEEECCEEEEEEECCCCC--------CCCHHHHHHCCCCC T ss_conf 9999999999989999999729967758968701----79999898999999789972--------14656786476873 Q ss_pred HHCCCCHHHHHHHCC-HHH----HHHHHHHCCCCCEEEEEECCCHH---HHHHHHHHHHHHHCCCCCCCCCCCCCCCCCH Q ss_conf 100110000100000-001----22345442872025787211010---4345788886410012334311000138742 Q gi|254780941|r 104 IVCLVVDSHRELKVN-IHD----LLKEIAKRSSRLILILNKIDCVK---PERLLEQAEIANKLVFIEKTFMVSATKGHGC 175 (311) Q Consensus 104 iil~VvDa~~~~~~~-~~~----il~~l~~~~~p~IiVlNKiDlv~---~~~l~~~~~~~~~~~~~~~i~~ISAk~g~Gi 175 (311) T Consensus 70 ~iI~VvD~sd~~~~~~~~~~l~~~l~~~~~~~~pili~~NK~Dl~~~~~~~ei~~~l~l~~~~~~~~~i~~~SA~tG~Gv 149 (159) T cd04150 70 GLIFVVDSNDRERIGEAREELQRMLNEDELRDAVLLVFANKQDLPNAMSAAEVTDKLGLHSLRNRNWYIQATCATSGDGL 149 (159) T ss_pred EEEEEEECCCHHHHHHHHHHHHHHHCCHHHCCCEEEEEEECCCCCCCCCHHHHHHHHCHHHHHCCCEEEEEEECCCCCCH T ss_conf 89999977777899999999999962353369829999975667789899999999686666379859998268679398 Q ss_pred HHHHHHHHHH Q ss_conf 6789999983 Q gi|254780941|r 176 DDVLNYLCST 185 (311) Q Consensus 176 d~L~~~L~~~ 185 (311) T Consensus 150 ~e~f~WL~~~ 159 (159) T cd04150 150 YEGLDWLSNN 159 (159) T ss_pred HHHHHHHHCC T ss_conf 9999998559

HHsearch alignment for GI: 254780941 and conserved domain: cd04150