>pfam05783 DLIC Dynein light intermediate chain (DLIC). This family consists of several eukaryotic dynein light intermediate chain proteins. The light intermediate chains (LICs) of cytoplasmic dynein consist of multiple isoforms, which undergo post-translational modification to produce a large number of species. DLIC1 is known to be involved in assembly, organisation, and function of centrosomes and mitotic spindles when bound to pericentrin. DLIC2 is a subunit of cytoplasmic dynein 2 that may play a role in maintaining Golgi organisation by binding cytoplasmic dynein 2 to its Golgi-associated cargo.

Probab=97.81 E-value=0.00035 Score=46.93 Aligned_cols=60 Identities=10% Similarity=0.107 Sum_probs=41.3 Q ss_pred HCCCCCEEEEEECCCHH---H-----HHHHHHHHHHHH----CCCCCCCCCCCCCCCCCHHHHHHHHHHHCCC Q ss_conf 42872025787211010---4-----345788886410----0123343110001387426789999983662 Q gi|254780941|r 128 KRSSRLILILNKIDCVK---P-----ERLLEQAEIANK----LVFIEKTFMVSATKGHGCDDVLNYLCSTLPL 188 (311) Q Consensus 128 ~~~~p~IiVlNKiDlv~---~-----~~l~~~~~~~~~----~~~~~~i~~ISAk~g~Gid~L~~~L~~~lpe 188 (311) T Consensus 213 NLGiPIvVV~tKsD~me~LEKe~dy~dEhFDfIqq~LR~fCLqyG-AALiYTSvKe~kN~dlLykYl~HRiYg 284 (490) T pfam05783 213 NLGIPVVVVCTKCDAMSVLEKEHDYRDEHFDFIQSHIRRFCLQYG-AALIYTSVKEEKNLDLLYKYLVHKIYG 284 (490) T ss_pred CCCCCEEEEEECCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHCC-CEEEEEECCCCCCHHHHHHHHHHHHCC T ss_conf 479877999946418888765126206778999999999998619-657885235450189999999988618

HHsearch alignment for GI: 254780941 and conserved domain: pfam05783