HHsearch alignment for GI: 254780942 and conserved domain: KOG2638

>KOG2638 consensus.
Probab=96.67  E-value=0.039  Score=30.61  Aligned_cols=74  Identities=16%  Similarity=0.403  Sum_probs=45.3

Q ss_pred             CCEEEE-ECCCCCCCCCCCCCCCEEEEC-CEEHHHHH---HHHHHHC-CCC-EEEEEECCCHH-HHHHH---HCCCCCEE
Q ss_conf             408999-458877232788874412588-48579999---9999977-997-79999579889-99997---30269728
Q gi|254780942|r    4 KRLAIV-LAAGRGHRMKSSSSKVLQKIA-GKPMISHV---METIAAA-GIE-NVALVLGYGAE-EITRI---NFPPTLSV   72 (442)
Q Consensus         4 ~~~AiI-LAaG~GtRl~p~~pKpLlpi~-gkpli~~~---i~~l~~~-g~~-~ivvv~~~~~e-~i~~~---~~~~~~~i   72 (442)
T Consensus       102 ~KLavlKLNGGlGttmGc~gPKS~ieVR~g~tFLDL~V~QIe~LN~~Y~~dVPlvLMNSfnTdedT~kil~ky~~~kv~i  181 (498)
T KOG2638         102 NKLAVLKLNGGLGTTMGCKGPKSVIEVRDGLTFLDLTVRQIENLNKTYNVDVPLVLMNSFNTDEDTQKILKKYAGSKVDI  181 (498)
T ss_pred             HHEEEEEECCCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCHHHHHHHHHHCCCCEEE
T ss_conf             31489994588677545678730699728972157899999987763289977798505566177999999832674038


Q ss_pred             EEEEC
Q ss_conf             99985
Q gi|254780942|r   73 EYYIQ   77 (442)
Q Consensus        73 ~~v~q   77 (442)
T Consensus       182 ~TF~Q  186 (498)
T KOG2638         182 KTFNQ  186 (498)
T ss_pred             EEECC
T ss_conf             98603