>cd00761 Glyco_tranf_GTA_type Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it als

Probab=97.46 E-value=0.00048 Score=41.45 Aligned_cols=91 Identities=16% Similarity=0.112 Sum_probs=64.3 Q ss_pred EEEECCE-EHHHHHHHHHHHCC--CCEEEEEECCCHHHHHHHHCCC---CCEEEEEECCCCCCHHHHHHHCCCCCCCCCC Q ss_conf 1258848-57999999999779--9779999579889999973026---9728999859988614466410000123446 Q gi|254780942|r 26 LQKIAGK-PMISHVMETIAAAG--IENVALVLGYGAEEITRINFPP---TLSVEYYIQDCQQGTAHAVLTAQDAIKPGYD 99 (442) Q Consensus 26 Llpi~gk-pli~~~i~~l~~~g--~~~ivvv~~~~~e~i~~~~~~~---~~~i~~v~q~~~~GTa~Ai~~a~~~l~~~~~ 99 (442) T Consensus 2 ii~~~n~~~~l~~~l~si~~~~~~~~eiiiid~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~n~~~~~~~~--~ 79 (156) T cd00761 2 IIPAYNEEPYLERCLESLLAQTYPNFEVIVVDDGSTDGTLEILEEYAKKDPRVIRVINEENQGLAAARNAGLKAARG--E 79 (156) T ss_pred EEEECCCHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHCCC--C T ss_conf 99988988999999999982899897999998999800221000001456638995056787846887788874899--9 Q ss_pred EEEEEECCCCCCCCCCCCCC Q ss_conf 05898515411153322000 Q gi|254780942|r 100 DVIIMYGDVPLVSSHTLKKA 119 (442) Q Consensus 100 ~~lVl~GD~~li~~~~l~~l 119 (442) T Consensus 80 ~v~~~d~D~~-~~~~~~~~~ 98 (156) T cd00761 80 YILFLDADDL-LLPDWLERL 98 (156) T ss_pred EEEEECCCCC-CCHHHHHHH T ss_conf 9999999985-787499999

HHsearch alignment for GI: 254780942 and conserved domain: cd00761