HHsearch alignment for GI: 254780942 and conserved domain: cd05825

>cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E. coli wcaF gene and similar proteins. WcaF is part of the gene cluster responsible for the biosynthesis of the extracellular polysaccharide colanic acid. The wcaF protein is predicted to contain a left-handed parallel beta-helix (LbH) domain encoded by imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). Proteins containing hexapeptide repeats are often enzymes showing acyltransferase activity. Many are trimeric in their active forms.
Probab=99.71  E-value=5.8e-17  Score=114.98  Aligned_cols=51  Identities=20%  Similarity=0.341  Sum_probs=48.1

Q ss_pred             CCEECCCCEECCCCEEECCEEECCCCEECCCCEECCCCCCCCEEEECCCEE
Q ss_conf             629878879886998937839889989977835766436986898135607
Q gi|254780942|r  379 KTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARSRQI  429 (442)
Q Consensus       379 ~~~ig~~~~iG~~~~i~~gv~ig~~~~i~ag~~v~~dv~~~~~v~~~~~~~  429 (442)
T Consensus        56 ~v~Ig~~v~IG~~~~I~~gv~Ig~~svVgagSvV~kdvp~~~i~~G~PAk~  106 (107)
T cd05825          56 PIVIGDGAWVAAEAFVGPGVTIGEGAVVGARSVVVRDLPAWTVYAGNPAVP  106 (107)
T ss_pred             CEEECCCCEECCCCEEECCCEECCCCEEECCCEECCCCCCCCEEEEECCEE
T ss_conf             979938858749878969919189979948988903859997998147589